Protein Structure Modeling

Sanford Burnham Prebys Medical Discovery Institute

Home Server Status Logout My Jobs Servers Help

Welcome

User: example

Query By

  1. Sequence (example)
  2. Template (example)
  3. Alignment (example)

Document

  1. What is it?
  2. How does it work?
  3. FAQ
  4. Comments and Questions
  5. Related Links

Note

Please send bugs and questions to Zhanwen Li. Thanks for your help and patience.

54.92.173.9

Job Name: TM0006
Created Date: 01-17-2007 11:19:32
Query(target) Sequence:

MSRIVNVKLSLKRYEYEKPFHITGSVSSESRNVEVEIVLESGVKGYGEASPSFRVNGERV
EALLAIENAVREMITGIDVRNYARIFEITDRLFGFPSLKAAVQFATLDALSQELGTQVCY
LLGGKRDEIETDKTVGIDTVENRVKEAKKIFEEGFRVIKIKVGENLKEDIEAVEEIAKVT
RGAKYIVDANMGYTQKEAVEFARAVYQKGIDIAVYEQPVRREDIEGLKFVRFHSPFPVAA
DESARTKFDVMRLVKEEAVDYVNIKLMKSGISDALAIVEIAESSGLKLMIGCMGESSLGI
NQSVHFALGTGAFEFHDLDSHLMLKEEVFRGKFIQDGPRMRVKDQ

The Predicted Protein Structure(s) for this Query:

Download Model PDB files:

Indexmodel 3DTemplateAlignmentModeling MethodModel Type
1 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
2 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
3 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
4 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
5 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
6 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
7 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
8 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
9 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
10 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
11 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
12 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
13 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
14 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
15 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
16 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
17 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
18 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
19 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
20 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
21 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
22 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
23 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
24 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
25 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
26 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
27 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
28 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
29 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
30 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
31 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
32 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
33 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
34 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
35 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
36 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
37 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
38 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
39 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
40 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
41 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
42 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
43 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
44 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
45 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
46 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
47 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
48 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
49 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
50 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
51 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
52 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
53 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
54 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
55 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
56 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
57 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
58 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
59 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
60 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
61 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
62 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
63 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
64 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
65 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
66 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
67 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
68 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
69 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
70 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
71 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
72 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
73 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
74 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
75 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
76 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
77 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
78 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
79 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
80 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
81 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
82 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
83 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
84 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
85 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
86 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
87 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
88 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
89 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
90 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
91 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
92 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
93 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
94 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
95 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
96 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
97 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
98 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
99 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
100 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
101 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
102 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
103 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
104 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
105 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
106 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
107 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
108 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
109 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
110 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
111 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
112 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
113 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
114 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
115 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
116 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
117 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
118 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
119 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
120 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
121 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
122 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
123 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
124 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
125 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
126 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
127 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
128 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
129 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
130 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
131 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
132 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
133 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
134 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
135 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
136 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
137 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
138 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
139 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
140 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
141 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
142 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
143 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
144 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
145 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
146 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
147 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
148 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
149 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
150 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
151 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
152 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
153 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
154 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
155 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
156 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
157 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
158 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
159 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
160 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
161 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
162 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
163 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
164 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
165 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
166 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
167 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
168 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
169 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
170 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
171 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
172 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
173 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
174 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
175 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
176 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
177 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
178 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
179 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
180 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
181 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
182 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
183 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
184 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
185 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
186 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
187 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
188 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
189 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
190 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
191 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
192 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
193 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
194 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
195 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
196 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
197 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
198 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
199 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
200 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
201 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
202 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
203 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
204 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
205 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
206 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
207 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
208 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
209 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
210 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
211 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
212 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
213 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
214 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
215 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
216 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
217 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
218 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
219 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
220 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
221 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
222 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
223 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
224 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
225 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
226 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
227 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
228 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
229 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
230 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
231 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
232 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
233 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
234 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
235 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
236 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
237 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
238 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
239 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
240 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
241 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
242 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
243 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
244 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
245 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
246 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
247 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
248 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
249 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
250 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
251 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
252 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
253 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
254 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
255 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
256 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
257 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
258 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
259 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
260 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
261 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
262 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
263 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
264 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
265 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
266 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
267 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
268 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
269 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
270 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
271 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
272 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
273 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
274 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
275 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
276 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
277 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
278 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
279 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
280 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
281 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
282 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
283 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
284 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
285 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
286 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
287 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
288 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
289 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
290 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
291 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
292 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
293 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
294 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
295 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
296 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
297 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
298 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
299 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
300 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
301 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
302 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
303 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
304 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
305 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
306 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
307 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
308 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
309 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
310 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
311 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
312 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
313 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
314 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
315 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
316 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
317 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
318 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
319 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
320 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
321 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
322 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
323 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
324 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
325 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
326 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
327 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
328 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
329 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
330 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
331 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
332 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
333 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
334 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
335 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
336 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
337 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
338 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
339 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
340 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
341 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
342 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
343 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
344 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
345 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
346 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
347 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
348 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
349 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
350 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
351 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
352 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
353 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
354 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
355 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
356 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
357 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
358 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
359 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
360 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
361 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
362 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
363 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
364 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
365 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
366 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
367 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
368 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
369 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
370 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
371 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
372 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
373 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
374 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
375 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
376 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
377 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
378 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
379 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
380 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
381 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
382 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
383 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
384 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
385 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
386 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
387 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
388 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
389 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
390 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
391 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
392 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
393 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
394 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
395 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
396 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
397 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
398 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
399 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
400 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
401 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
402 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
403 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
404 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
405 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
406 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
407 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
408 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
409 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
410 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
411 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
412 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
413 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
414 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
415 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
416 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
417 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
418 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
419 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
420 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
421 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
422 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
423 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
424 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
425 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
426 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
427 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
428 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
429 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
430 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
431 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
432 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
433 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
434 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
435 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
436 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
437 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
438 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
439 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
440 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
441 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
442 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
443 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
444 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
445 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
446 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
447 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
448 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
449 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
450 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
451 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
452 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
453 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
454 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
455 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
456 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
457 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
458 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
459 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
460 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
461 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
462 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
463 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
464 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
465 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
466 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
467 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
468 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
469 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
470 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
471 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
472 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
473 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
474 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
475 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
476 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
477 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
478 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
479 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
480 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
481 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
482 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
483 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
484 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
485 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
486 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
487 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
488 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
489 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
490 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
491 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
492 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
493 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
494 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
495 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
496 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
497 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
498 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
499 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
500 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
501 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
502 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
503 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
504 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
505 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
506 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
507 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
508 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
509 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
510 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
511 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
512 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
513 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
514 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
515 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
516 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
517 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
518 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
519 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
520 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
521 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
522 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
523 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
524 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
525 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
526 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
527 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
528 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
529 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
530 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
531 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
532 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
533 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
534 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
535 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
536 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
537 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
538 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
539 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
540 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
541 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
542 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
543 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
544 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
545 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
546 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
547 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
548 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
549 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller
550 view by JSmol   Jmol   download PDB 1jpm_A detail SCWRL
551 view by JSmol   Jmol   download PDB 1jpm_A detail Jackal
552 view by JSmol   Jmol   download PDB 1jpm_A detail Modeller