current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: gi|40548796|ref|NP_395146.2| hypothetical protein (YPCD1.09c) [Yersinia pestis CO92], from Y.pestis

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# E-value Template Links and tools%idFirst MAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLMEAREQRVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKDTSVLast
1 5.000e-30gi|652861993|ref|WP_027132577.1| antitoxin [Geminicoccus roseus]  clstr ali  35  1MARNTSISLGDHFASFIDSQVQTGRYGSASDVVRAGLRLLEEHEAKVQALQAALIAGEESGTPEPFDFDAFIAKKR.... 76
2 4.000e-29gi|914216570|ref|WP_050532815.1| antitoxin [Aestuariivita atlantica]  clstr ali  40  1MAKNTSMSLGDHFTGFIDTQVQSGRYGSASDVVRAGLRLLEEHESKVKALQDALIAGEQSGEPQPFDFEEFKARKRA... 77
3 5.000e-29gi|495027218|ref|WP_007752793.1| antitoxin [Rhizobium sp. CF080]  clstr ali  34  1MARNTSISLGDHFASFIDTQVESGRYGSASDVVRAGLRLLEEHEARVKALQDALIAGEESGPPQPFDNQAFLKRMRERH. 79
4 1.000e-28gi|502311250|ref|WP_012760089.1| antitoxin [Rhizobium leguminosarum]  clstr ali  33  1MARNTSISLSDHFTSFIDTQVQAGRYGSASDVVRAGLRLLEEHEAKVKALQDALIEGEESGPATPFDFDAFNARKRAA.. 78
5 1.000e-28gi|759963284|ref|WP_043647217.1| antitoxin [Caenispirillum salinarum]  clstr ali  33  1MPRNTSVSLGDHFAAFIDNQVATGRYGSASDVVRAGLRLLEEHEAKVAALRQALIEGEESGPSEPFDVESFIREKRR... 77
6 3.000e-28JGI.Meta 7062734481 SRS017227_Baylor_scaffold_166553__gene_242677 putative addiction module antidote protein, CC2985 family [Human Supraging  ali  36  35MSRNTSVSLGPHFASFIDGLVQGGRYGTTSDVVRAGLRLLEEHEARVKALQDALREGMASGEPRPFDFEDFKARKRA... 111
7 4.000e-28gi|502621224|ref|WP_012858049.1| CopG family transcriptional regulator [Paracoccus aminophilus]  clstr ali  33  1MARNTSVSLGDHFTTFIDTQVQAGRYGSASDVVRAGLRLLQEHEAKVKALEAALIEGEESGEPQPFDFEAFKKRKRA... 77
8 5.000e-28gi|503028146|ref|WP_013263122.1| antitoxin [gamma proteobacterium HdN1]  clstr ali  36  2..RNTSVSLGQHFTNFIDSQVQGGRYGSASDVVRAGLRLLEEHETKVKALQDALNAGLESGEPRPFDFEAFKARKRAA.. 77
9 6.000e-28gi|516070807|ref|WP_017501390.1| hypothetical protein [alpha proteobacterium LLX12A]  clstr ali  40  1MARNTSVTIGDHFTRFISDQVQTGRYGSASDVVRAGLRLLEEHEAQVQALQAALIAGEESGAATPFDFEVFKAAKR.... 76
10 7.000e-28gi|1019514383|emb|SAL84896.1| addiction module antidote protein [Paraburkholderia choica]  clstr ali  38  1MARNTSVSLGDHFAEFVDESVKAGRYGTVSDVVRAGLRLLEEQETKLEALRAALIEGERSGPSTPFDFDAFIARKK.... 76
11 8.000e-28gi|517253073|ref|WP_018441891.1| antitoxin [Burkholderia sp. JPY347]  clstr ali  35  1MPRNTSVSLGDHFADFVDAQVDSGRYGSASDVVRAGLRLLESHETQVRALQEALKAGEASGAPVPFDSEAFLERMR.... 76
12 9.000e-28gi|740145415|ref|WP_037991886.1| antitoxin [Thalassospira permensis]  clstr ali  40  1MARNTSVSLGEHFTGFIDGQVQSGRYGSASDVVRAGLRLLEEHEAKVRALQDALIEGEKSGTATSFDGEAFLARMNAKH. 79
13 1.000e-27gi|563148177|gb|ESY71946.1| antitoxin [Mesorhizobium sp. LNHC252B00]  clstr ali  32  4MPRNTSVSLGDHFAGFIDTQVQTGRYGSASDVVRAGLRLLEEHEAKVRALQNALIAGEESGAPVAFDSTAFLSKMRAKHA 83
14 2.000e-27gi|985611787|ref|WP_060851282.1| antitoxin [Methylobacterium aquaticum]  clstr ali  44  1MAKNTSVTLGDHFTGFIGRQVEAGRYGSASEVVRAGLRLLEEHEAKVQALQAAIQAGEESGPSTAFDFEAFIASKRA... 77
15 3.000e-27gi|1004052859|ref|WP_061507300.1| antitoxin [Acetobacter malorum]  clstr ali  36  1MSGNTSVSLGSHFLSFVDEQVQSGRYSSTSETVRAGLRLLEEHETKVKSLQAALLEGERSGPAKPFDFDAFKARKRK... 77
16 3.000e-27gi|960395761|ref|WP_058287874.1| antitoxin [Leisingera aquaemixtae]  clstr ali  33  1MAKNTSIALGEHFETFIGARVKAGRYGSASEVVRAGLRLLEEQETKLEALQAALIEGEMSGPAQPHDPEAFLSAMRERHA 80
17 4.000e-27gi|645066683|ref|WP_025437762.1| antitoxin [Komagataeibacter xylinus]  clstr ali  35  1MARNTSISLGDHFADFVDQQVKGGRYGSASDVVRAGLRILEERETRLETLRSALIDGEQSGVAEPFDIEDFLTTKAK... 77
18 4.000e-27gi|501432167|ref|WP_012456831.1| antitoxin [Methylobacterium populi]  clstr ali  33  1MARNTSISLGDHFAQFIDSQVQGGRYGSASDVVRAGLRLLEEREAKLEALRSALDEGEASGDFQEFDADTFLASMRQ... 77
19 6.000e-27gi|947800820|ref|WP_056462352.1| antitoxin [Methylobacterium sp. Leaf90]  clstr ali  33  1MPRNTSVSLGEHFAQFIDRQVEGGRYGSASEVVRAGLRLLEEQEAALDTLRAALIEGEESGPPEPFDTEAFLGEKRE... 77
20 6.000e-27gi|504873633|ref|WP_015060735.1| CopG family transcriptional regulator [Paracoccus aestuarii]  clstr ali  37  1MPRTTSVSLGEHFTGFISAQVDAGRYGSASDVVRAGLRLLEEHETKVKALQDALIAGEQSGEPRPFDFDGFKARKRA... 77
21 7.000e-27gi|545306572|ref|WP_021585840.1| hypothetical protein [Ochrobactrum sp. EGD-AQ16]  clstr ali  40  1MSRNTSVTLGDHFANFVDSQVKGGRYGSASDVVRAGLRLLEEHETRVRSLQETLIAGEKSGQSKPLDREGFLQKMKTKHV 80
22 9.000e-27gi|800971878|ref|WP_045998534.1| antitoxin [Loktanella sp. S4079]  clstr ali  32  1MPKNTSMSLGDHFATFINDQVQTGRYGSASDVVRAGLRLLEEHEAKVKALQDALIEGEKSGEPREFDRQAFKAALLNQHA 80
23 1.000e-26gi|936192096|ref|WP_054526264.1| antitoxin [Citromicrobium sp. WPS32]  clstr ali  33  1MSKNTSITLGDHFSGFVETQVSEGRFASTSEVVRAGLRLLEEHEAKVHALRQALIEGERSGPTRPFDGDAFLERM..... 75
24 1.000e-26gi|516623399|ref|WP_017998186.1| antitoxin [Paracoccus sp. N5]  clstr ali  45  1MPRNTSVTLGEHFTGFIAEQVQAGRYGSASDVVRAGLRLLEEHEARVKALRDALIAGEASGEPRPFDSEAFLARMNRTHA 80
25 1.000e-26gi|665887199|ref|WP_031254405.1| antitoxin [Curvibacter lanceolatus]  clstr ali  36  1MSRNTSVSLGMHFTSFIDAQVQGGRYGSASDVVRAGLRLLEEHEAKVNALQDALRTGLESGEPRPFDFETFKARKRA... 77
26 2.000e-26gi|503417455|ref|WP_013652116.1| antitoxin [Polymorphum gilvum]  clstr ali  36  1MARNTSISLGDHFADFVDQRVKTGRYGSASDVVRAGLRLLEEHETRMDALRAALEAGEASGEPKDFDFDTFLA....... 73
27 2.000e-26gi|982137053|ref|WP_060303366.1| antitoxin [Burkholderia ubonensis]  clstr ali  31  1MSSNTPISLGDHFAEFVDAQVRSGRYGSASDVVRAGLRLLESHETQVRALQEALKAGETSGAPAPFNSDAFLARMRAKH. 79
28 2.000e-26gi|737534960|ref|WP_035508694.1| antitoxin [Burkholderia jiangsuensis]  clstr ali  36  1MPKNTSVSLGDHFTDFVENRVRAGRYSTASDVVRAGLRLLEEQEAKLGALRAALDAGEQSGPSKPLDFDAFIARKRK... 77
29 2.000e-26gi|930040837|ref|WP_054144390.1| antitoxin [Bosea sp. AAP35]  clstr ali  35  1MSKITSVSLDEHFSSFVGVQIETGRYGSASDVVRAGLRLLEDHEAKVKALENALIEGEQSGPPRPFDNEAFKARMRARN. 79
30 2.000e-26gi|154155116|gb|ABS62333.1| putative transcriptional regulator, CopG/Arc/MetJ family [Parvibaculum lavamentivorans DS-1]  clstr ali  38  9MAKNTSISLGDHFNDFVESRVARGRYGSASEVVRAALRLLEEHEAKVEALRAALIAGEQSGPSSPFDFDDFIREKQ.... 84
31 2.000e-26gi|913727505|ref|WP_050475298.1| antitoxin [Pannonibacter phragmitetus]  clstr ali  36  1MARNTSITIGDHFTAFIQEQVGAGRYGSASEVVRAGLRLLEEHEARVKALEAALITGEQSGEPEPFDFEAFKTRMR.... 76
32 2.000e-26gi|671547270|ref|WP_031530693.1| antitoxin [Dyadobacter crusticola]  clstr ali  33  1MGKNTSISMGQHFDSFIQTQIANGRYASTSEVVRAGLRLLEQEEQKLSLLRQALIEGEESGWSENFDPADFKAKLKK... 77
33 3.000e-26gi|981295127|ref|WP_059512483.1| antitoxin [Burkholderia sp. TSV85]  clstr ali  31  1MPRNTSISLGDHLTQFVDTQVASGRYCSVSDVVRAGLRLLETQETELKVLQEALKAGESSGEPMAFDSQLFLTRMRAKHA 80
34 3.000e-26gi|497510351|ref|WP_009824549.1| antitoxin [Sulfitobacter sp. NAS-14.1]  clstr ali  37  1MPRNTSVTLGTHFSDFIGEQVQAGRYGSASDVVRAGLRLLEEHETKVRALQDALIAGEQSGTPRSFDSEAFLSRMHAKHA 80
35 3.000e-26gi|327374719|gb|AEA66070.1| Putative transcriptional regulator, CopG/Arc/MetJ family protein [Burkholderia gladioli BSR3]  clstr ali  34  2MPRNTSISLGDHLTQFVDSQVASGRYGSASDVVRAGLRLLETQETELRALQEALRAGEASGTPAVFDGQAFLARLRAKH. 80
36 3.000e-26gi|1011190619|ref|WP_062111002.1| antitoxin [Aureimonas sp. AU40]  clstr ali  34  1MGKNTSVIMGDHFSDFVAEQVRTGRYGSTSEVVRAGLRLLEEHEARRAALRVAIAEGEASGAAEPFDPDAFLDAMTRKH. 79
37 3.000e-26gi|996068373|gb|KXG86351.1| hypothetical protein ATO67_02620 [Agrobacterium sp. R89-1]  clstr ali  31  1MGKNTSVNLNDHFDAFIEQQIEQGRFTSASEVVRAGLRLLEEREAELSNLRAALIEGENSGSAAPFDFDTFVQRKKNAG. 79
38 4.000e-26gi|501242032|ref|WP_012285050.1| antitoxin [Caulobacter sp. K31]  clstr ali  36  1MSKNTSISLGDHFQTFIEGQISDGRYGSASEVVRAGLRLLEERETRLAALRAALIEGEESGFAEDFDFDAFIAEK..... 75
39 5.000e-26gi|512559734|ref|WP_016447039.1| hypothetical protein [Delftia acidovorans]  clstr ali  35  1MSRNTSVALGPHFTEFIDAQVQGGRYGSASDVVRAGLRLLEEHEIRVKALQEALNAGRQSGEPRPFDSEAFLSRMHAKH. 79
40 6.000e-26gi|738326941|ref|WP_036279781.1| antitoxin [Methylocystis sp. ATCC 49242]  clstr ali  33  1MAKNTSFVIGDHFASFVEAQVAAGRYGSASDVVRAALRLLEEQETKLAALRAALIEGETSGASTPFDFEAFIARKRADDA 80
41 7.000e-26gi|788034227|ref|WP_045776668.1| hypothetical protein [Elstera litoralis]  clstr ali  35  1MPENTSVSLGDHFARFIESQVAEGRYGSASDVIRAGLRLLEQREAKLTALRAALAEGEASGPPVELDFEAFLADRRR... 77
42 8.000e-26gi|1011291489|ref|WP_062208871.1| antitoxin [Aureimonas sp. AU12]  clstr ali  36  1MAKNTSVILGDHFSDFVAAQLHGGRYGSASEVVRAGLRLLEEHEVRLQGLRDAIREGEDSGPAEAFDPHDFLSDMHRKH. 79
43 9.000e-26gi|504559982|ref|WP_014747084.1| antitoxin [Tistrella mobilis]  clstr ali  39  1MARTTSITLGDHFADFVQTQVATGRYGSTSDVVRAGLRLLEEHEARVRALHDALQAGEDSGEPRLWDDEAFLARMMARH. 79
44 1.000e-25gi|635632044|ref|WP_024278941.1| antitoxin [Xanthobacter sp. 126]  clstr ali  32  1MSRNTSVSLGDHFASFVDRQVEAGRYSSASDVVRAGLRLLEEHEARLDALRSALAEGEASGPAQPFDVESFLAEKRSGAA 80
45 1.000e-25gi|528093890|gb|EPX75707.1| ParD protein (antitoxin to ParE) [Salipiger mucosus DSM 16094]  clstr ali  25  8MA-TMNVSLPDPMKEWVEGQTKSGRYSNASDYVRDLIRRDQDRQAAVAELQKLVDEGQASGPTQKFDMETFLTRKREDHA 86
46 1.000e-25gi|493779662|ref|WP_006728090.1| addiction module antitoxin [Agrobacterium albertimagni]  clstr ali  24  1MA-TMNVSLPDPMKAWVERQAESGRYGNASDYIRDLIRKDQERLAAFDQLQAAITKGIESGPPETFDPEAFKRRMRESH. 78
47 2.000e-25gi|1018799030|gb|AMY67958.1| hypothetical protein AKL17_0699 [Defluviimonas alba]  clstr ali  36  1MPRNTSVTIGDHFASFIAEQVKTGRYGSTSDVIRAGLRLLEEHEARVKALQGALVAGEESGAPAEFDFEAFKARKR.... 76
48 2.000e-25gi|780900044|gb|KJS68053.1| antitoxin [Comamonadaceae bacterium BICA1-1]  clstr ali  36  1MSRNTSVSLGAHFASFIDAQVQGGRYGTASDVVRAGLRLLEEHEAKVQALQAALNAGLQSGEPRSFDFEAFKARKRA... 77
49 2.000e-25gi|953949245|dbj|BAT57718.1| antitoxin ParD1 [Variibacter gotjawalensis]  clstr ali  35  1MGKHTSFSLGDHFATFIDEQIAQGRYSNASDVVRAGLRLLEEQEAKLASLRSALIEGENSGASTPFDFDEFIAGQRK... 77
50 2.000e-25gi|930461204|ref|WP_054208832.1| antitoxin [Bosea vaviloviae]  clstr ali  29  1MSKTTPIVLDDHFDHFVGAQVKAGRFGSPSDVVKAGLQLLEEHEAKVQALQDALIAGEQSGPPIAFDNDAFLARMRARH. 79
51 3.000e-25gi|648286948|ref|WP_026068097.1| antitoxin [Pusillimonas noertemannii]  clstr ali  33  1MPRNTSVSLGDHFIEFVDSQVSSGRYGSASEVVRAGLRMLESHENQVRALQEALKAGEDSGAAVPFDTTSFLKRMRTSHV 80
52 3.000e-25gi|516730196|ref|WP_018070760.1| CopG family transcriptional regulator [Rhizobium leguminosarum]  clstr ali  29  32MA-TMNVSLPGPMKDWVEAQARTGRYSNASDYVRDLIRRDQTRNDKIAAMQSFVEAGLQSGVGIRSKDELFAEAMARAN. 109
53 4.000e-25gi|737609597|ref|WP_035580249.1| antitoxin [Halomonas sp. TG39a]  clstr ali  36  1MAKNTSITLGDHFENFVTTQVQSGRYGSTSEVIRSALRLLENQETKLHTLRQLLIEGEQSGDADYDLSSFINELDSEKS. 79
54 4.000e-25gi|668347204|emb|CDW96538.1| Antitoxin ParD [Thiomonas sp. CB2]  clstr ali  36  1MNRNTSVSLGTHFVSFIDSQVQGGRYGTASDVIRAGLRLLEEHEFKVKALQDALRAGLESGEPRTVDFEAFKARKRA... 77
55 4.000e-25gi|981332128|ref|WP_059548420.1| antitoxin [Burkholderia vietnamiensis]  clstr ali  36  1MARNTLVSLGDHLTQFVDTQIASGRYGSASGVVRAGLRLLETQETELRVLQEALKAGEASGTPVGFDGPTFLARIRAKHA 80
56 4.000e-25gi|530268517|gb|EQB10901.1| hypothetical protein RLDS_26055 [Sphingobium lactosutens DS20]  clstr ali  28  21MARNTSVTISDHFATFISDQVRTGRYGSASDVVRAGLRLLEEQDTQLRSLQEALIAGEQSGPPERFDLDAMKARKRTERA 100
57 4.000e-25gi|653756338|ref|WP_027675634.1| antitoxin [Agrobacterium larrymoorei]  clstr ali  36  1MARNTSITLGDHFASFIRDQVQTGRYGSTSDVVRAGLRLLEEHEAKVKSLQDALIAGEQSGEPRAFDFEAFKTRKRA... 77
58 4.000e-25gi|390618878|gb|AFM20027.1| putative addiction module antidote protein, CC2985 family (plasmid) [Mycobacterium chubuense NBB4]  clstr ali  35  1MGKNTSFSLDDHFTTFINNEVASGRYGSASDVVRAALRLLQDRETRLGALRQALVAGENSGESTPFDFDEFVTRQRAR.. 78
59 4.000e-25gi|77967013|gb|ABB08393.1| putative transcriptional regulators, CopG/Arc/MetJ DNA-binding domain protein [Burkholderia lata]  clstr ali  35  1MSRNTSVSLGDHFAEFVDAQVQSGQYGSASDVIRVGLRFLESHETQMRALQEALQAGDASGASGPFDSEAFLARMRATH. 82
60 5.000e-25gi|505152449|ref|WP_015339551.1| hypothetical protein [Rhizobium tropici]  clstr ali  36  1MAHNTSVSLGDHFSAFIEAQIQTGRYGSASDVVRAGLRLLEEHEAKVKALQSALIAGEESGEIASFDNAAFLKRMRA... 77
61 5.000e-25gi|944371450|gb|ALL69062.1| ParD protein, antitoxin to ParE [Paraburkholderia caribensis MBA4]  clstr ali  32  2MGKNTSVSLGDHFAEFVEDRVRAGRYNTASDVVRAGLRLLEEQEAKLDALRVELEKGERSGPSRPFDFDAFLARKRK... 78
62 6.000e-25gi|640626211|ref|WP_025054219.1| addiction module antitoxin [Sulfitobacter noctilucicola]  clstr ali  18  1MA-TMNVSLPDPMKTWVEARLKDGSFSNTSDYVRHLIRRDQERAQAIDALQQAIDEGLKSGDPEPFDFKTFKARMREKHA 79
63 6.000e-25gi|502845515|ref|WP_013080491.1| antitoxin [Caulobacter segnis]  clstr ali  35  1MSKNTSIVLSEHFQSFITEKVEEGRYGSASEVVRAGLRLLEDHEAKLTALRTAVREGFESGKPEPFDVDTFLA....... 73
64 6.000e-25gi|981958396|ref|WP_060138954.1| antitoxin [Burkholderia ubonensis]  clstr ali  32  1MPRNTSISLGDHLTQFVDTQVASGRYGSASTWLRAGLRLLETQETELRALQEALKAGEASGEPVTFDSQAFLTRMRTKHA 81
65 8.000e-25gi|738636351|ref|WP_036545822.1| antitoxin [Nitrincola lacisaponensis]  clstr ali  35  1MAKNTSISLGDHFDSFIAHQIKSGRYGSASEVIRSALRLLENQETKLQTLRQLLVEGEQSGDADYELDSFINELDSEH.. 78
66 8.000e-25gi|930023660|ref|WP_054127768.1| antitoxin [alpha proteobacterium AAP81b]  clstr ali  40  1MAKNTSVSLGDHMLRFAQAQVASGRYNSTSDVVRAGLRLLEEHESRLQALRDALIAGENSGESQPFDFDAFIAAKRSKPA 81
67 8.000e-25gi|653376109|ref|WP_027510423.1| antitoxin [Rhizobium sullae]  clstr ali  30  1MA-TMNVSLPDPMKDWVEAQTTTGRYANASDYVRDLIRKDQERNGKIDAMPRFVDEGLKSGVGNRSKDEFFAAAKAK... 76
68 1.000e-24gi|1002743794|gb|AMN47708.1| antitoxin [Steroidobacter denitrificans]  clstr ali  35  1MAKNTSISLGDHFEGFINRQIESGRYGSASEVVRASLRLLEEHEQKIGALRQALIDGEKSGDAGELDMDDIKNKARRRA. 79
69 1.000e-24gi|515079824|ref|WP_016709595.1| antitoxin [Pseudoalteromonas haloplanktis]  clstr ali  39  1MAKNTSVTLGDHFDKFINQQLNSGRYGSASEVIRAGLRALEDQEIKTMNLRNMLIDGENSGVADYSYDSLILELDKDNH. 79
70 1.000e-24gi|657050524|ref|WP_029293330.1| antitoxin [Chryseobacterium hispalense]  clstr ali  31  1MGRNTSVSLGDYFEDFVDSKVSEGRFKNASEVIRAGLRLLEQEENKIQMLKNAIEEGISSGIAHDFNPQKHLEFMK.... 76
71 1.000e-24gi|653012117|ref|WP_027264276.1| addiction module antitoxin [Sedimentitalea nanhaiensis]  clstr ali  22  3...TMNISLPDPMKSWVEDQAKSGRYANSSDYVRDLIRRDRMRHDAIAEIQAAVDAGIASGPAKSFDCNAFKARMHAKHA 79
72 1.000e-24gi|943624583|ref|WP_055454034.1| hypothetical protein [Pannonibacter indicus]  clstr ali  30  1MA-TMNVSLPDPMKDWVEAQAASGRYSNASDYVRDLIRRDQERCGKIAHMQMLVTEGLESGISGQSMEDILKAARQR... 76
73 1.000e-24gi|754887928|ref|WP_042246959.1| antitoxin [Paracoccus sp. PAMC 22219]  clstr ali  35  1MPRNTSVSLGEHFTGFISAQVETGRYSSASDVVRAGLRLLEEHEDRVRTLQAALDEGEASGTPEPLDIAAFKAELRAGRA 80
74 2.000e-24gi|499772417|ref|WP_011453151.1| transcriptional regulator [Jannaschia sp. CCS1]  clstr ali  35  1MARNTSVSLGDHFGEFINEKVQEGRYGSASDVIRAGLRLLEEEEAKLAHLRELIAQGDASGPGKPWNYEDWKAKRHADYA 80
75 2.000e-24gi|652558333|ref|WP_026951872.1| antitoxin [Algoriphagus mannitolivorans]  clstr ali  29  1MGRNTSVSLGDYFEEFVDSKVSEGRYSSASEVIRAGLRLLEEEENKLIALKNAVQEGIESGIVKDFDPEKHLELKAKKR. 80
76 2.000e-24gi|255292738|dbj|BAH89844.1| putative transcriptional regulators [uncultured bacterium]  clstr ali  26  1MA-TMNVSLPDPMKTWVEAQTKDGRYSNASDYVRDLIRRDQDRHQAIAELQQLVDEGIASGPARHLDVEAFLVRKRDQNA 79
77 2.000e-24gi|652356607|ref|WP_026752751.1| antitoxin [Sediminibacterium sp. C3]  clstr ali  30  1MGRNTSISLGDHFEDFVDDKVATGRFKNASEVIRAGLRLLEEEESKIQALKKAIKDGIESGVARSFDPKKHLEKLKAAR. 79
78 2.000e-24gi|696551830|ref|WP_033084496.1| antitoxin [Colwellia psychrerythraea]  clstr ali  40  1MAKNTSVTLGEHFDQFINQQLNTGRYGSASEVVRAGLRVLEDQETKILNLRNMLIEGENSVVSDYSYDSLITELDKDNH. 79
79 3.000e-24gi|500072664|ref|WP_011748677.1| antitoxin [Paracoccus denitrificans]  clstr ali  33  1MSRNTSVSLGDHFVSFIDAQVKGGRYGSASDVVRAGLRLLEEHEAKVKALQDALITGEDSGRAEGFDLDQFIARK..... 75
80 3.000e-24gi|908704562|ref|WP_049836232.1| hypothetical protein [Octadecabacter temperatus]  clstr ali  24  1MA-TMNVSLPEQMKSWVEQQSEGGRFSNSSDYVRDLIRRDQERGVRIAELQAAIDAGLNSGPAKTFDPAVFKRKMHQAR. 78
81 3.000e-24gi|750564327|ref|WP_040846196.1| hypothetical protein [Nitrospirillum amazonense]  clstr ali  31  1MSKGTSVSLDPHYAKFVEEQVSEGRYDTANDVVRAGLRLLEEHETKLAALRSALIEGEESGPATDFDFEDFIARKR.... 76
82 3.000e-24gi|652598002|ref|WP_026981010.1| antitoxin [Flavobacterium suncheonense]  clstr ali  30  1MGKNTSISLGNHFEDFIESSINNGRFSNASEVVRAGLRLLEDEENKIIALRNALQEGIDSGIVKDFEPKKFLESLKARK. 79
83 3.000e-24gi|902713787|ref|WP_049629216.1| antitoxin [Cellvibrio sp. pealriver]  clstr ali  35  1MAKNTSITLGEHFDSFISSQLESGRYGSASEVVRAGLRLLEDSENKLQALRQMLIQGEESGIAEYNYSDFLNELDEQKN. 79
84 3.000e-24JGI.Meta 7050720528 SRS015440_WUGC_scaffold_51194__gene_65726 putative addiction module antidote protein, CC2985 family [Human Supragingival  ali  34  4MSVNTSVSLDDHFAGFIASQVGSGRYRSASEVIRAGLRLLEDRETEMSALREALASGEASGQAEPFDFDAFIAAKAAR.. 81
85 3.000e-24gi|496011587|ref|WP_008736166.1| antitoxin [Alcanivorax pacificus]  clstr ali  30  1MARNTSITLGPHFDEFISTQVENGRYSSASEVVRAGLRLLEETESKLTRLRRLLDEGEQSGIAEYSYESIIAELDSEAH. 79
86 3.000e-24gi|671517651|ref|WP_031503117.1| antitoxin [Chryseobacterium haifense]  clstr ali  32  1MGRNTSVSLGEYFEDFVDAKVTQGRYKNASEVIRAGLRLLEEEENKIQILKNAIQEGIDSGIAEDFNPKKHLESLKTR.. 78
87 4.000e-24gi|494533194|ref|WP_007322644.1| antitoxin [Gordonia araii]  clstr ali  35  1MAQNTSISLDDHFSEFLSREVASGRYRSASEVVRAGLRLLEDRETHLAALRTALVTGEESGAPEPFDFDAFIAAKK.... 76
88 4.000e-24gi|652608267|ref|WP_026988072.1| antitoxin [Fodinicurvata fenggangensis]  clstr ali  32  1MSRNTSISLGDHFDHFISERVDSGRYSSASDVVRAGLRLLEEQEVKAEALRKALIQGEQSGPAEEFDFEAFITDRKSA.. 78
89 5.000e-24gi|736010250|ref|WP_034184154.1| antitoxin [Burkholderia pyrrocinia]  clstr ali  34  1MSRNISVSLGDHFAEFVDAQVQSGRYSSASAVVRAGLRLLESHETQMRALQEALKAGEASGEPHAFASEAFLVRMRTTH. 79
90 5.000e-24gi|780815226|gb|KJS19647.1| hypothetical protein VR78_02940 [Hoeflea sp. BRH_c9]  clstr ali  41  1MGKNTSVILGDHYERFVGTQVGSGKYGSTSEVIRAGLRLLEERETAVSTLQAALIDGEKSGISARSPDEIIAAAIEKRR. 79
91 5.000e-24gi|702718512|ref|WP_033247015.1| antitoxin [Nocardia carnea]  clstr ali  35  1MGKNTSFSLDEHYSSFIDGEVASGRYRSASDVVRTALRLLEDRETQLRALRTALIDGENSGKSTPFDFDAFIARKRA... 77
92 6.000e-24gi|427349445|gb|AFY32169.1| addiction module antidote protein, CC2985 family [Calothrix sp. PCC 7507]  clstr ali  32  17MQKNTSVTLGDHFEAFINSQVECGRFSSASEVVRAGLRLLEEHEMKVAALRRALQEGENSGFAEYFLHGLLAELDKEK.. 94
93 6.000e-24gi|558562953|ref|WP_023493203.1| CopG family transcriptional regulator [Methyloglobulus morosus]  clstr ali  22  1MA-TMNISIPDPMKDWVQAQVETGAYANSSDYVRDLIRKDQENRNKLVSLQKAITEGLESGKSDKSFDEIIDAAK..... 74
94 6.000e-24gi|654840367|ref|WP_028293017.1| antitoxin [Oceanobacter kriegii]  clstr ali  35  1MAKNTSISLGEHFEGFIAKQVESGRYGSASEVIRSALRLLESEQTKLDTLRKALDEGEASGIAEYSLESVIKEL...... 74
95 6.000e-24gi|766755294|ref|WP_044836236.1| antitoxin [Thalassomonas actiniarum]  clstr ali  37  1MAKNTSITLGDHFDSFIASQIGSGRYGSASEVIRAGLRLLENTETKTETLRRMLVEGEKSGTADYTFDTFINEL...... 74
96 7.000e-24gi|652850583|ref|WP_027126126.1| antitoxin [Gelidibacter mesophilus]  clstr ali  31  1MSKNTSISLGNYFEEFVQSRIKEGRFKNVSEVIRAGLRLLEEEETKVIALRNAIQDGIDSGIAHDFDPKKHLESLKSKK. 79
97 7.000e-24gi|739424082|ref|WP_037284188.1| hypothetical protein [Rubellimicrobium mesophilum]  clstr ali  21  1MA-TMNVSLPDPMKDWVEQQTKGGRYSNASDYVRDLIRRDQERAAKIAAMQRLVTEGLESGTTEDFDFDSFQERMREEHA 79
98 7.000e-24gi|1001865459|gb|AMM31945.1| antitoxin ParD1 [Sinomonas atrocyanea]  clstr ali  35  1MARNTSISLDAHFSDFLAHEVATGRYGSASEVVRAGLRLLEDQEARLSALRSALSAGEASGEPEPFDFDAFIAAKR.... 76
99 8.000e-24gi|948076313|ref|WP_056735116.1| hypothetical protein [Phenylobacterium sp. Root700]  clstr ali  32  1MGKNTSISLGEHFASFIESEVAKGRYASASEVVRASLRLLEEREAQLGSLRAALVEGEESGASTPFDFDQFISSKRSA.. 78
100 8.000e-24gi|371642249|gb|EHO07820.1| CC2985 family putative addiction module antidote protein [Myroides odoratimimus CCUG 12901]  clstr ali  35  10MGRTTSVSLGDYFEGFVEAKINEGRYKNASEIIRAGLRLLEKEENEIQVLRNAIQEGIDSGIAEDFDPNNHLKALKA... 86
101 8.000e-24gi|503218904|ref|WP_013453565.1| antitoxin [Marivirga tractuosa]  clstr ali  30  1MSKNTSISLGEYFDQFVSTQVSAGRYKNVSEVIRAGLRLLENEESKAIALRNAIQEGIDSGIAHDFDPKKLEELKAKRR. 80
102 8.000e-24gi|736835665|ref|WP_034836944.1| antitoxin [Endozoicomonas numazuensis]  clstr ali  36  1MAKNTSITLGEHFDWFISSQVESGRYGSASEVIRAALRLLESKETKLNTLRNLLIEGEESGLAEYDYDTFINELDNE... 77
103 9.000e-24gi|759420629|ref|WP_043144421.1| hypothetical protein [Ponticoccus sp. UMTAT08]  clstr ali  24  1MA-TMNVSLPDPMKDWVESQARTGRYSNASDYVRDLIRRDQDRQAAIAEVQKLVDEGLASGAPREVDMDAFLARMRRDH. 78
104 9.000e-24gi|497868689|ref|WP_010182845.1| antitoxin [Aquimarina agarilytica]  clstr ali  30  1MSKNTSITLGNHFDNFIKSSVSNGRYKNASEVVRAGLRLLEEDESKVLILKKAINEGIESGINENFDPILHLQSLKEKR. 79
105 1.000e-23gi|491433692|ref|WP_005291485.1| antitoxin [Corynebacterium genitalium]  clstr ali  37  1MAKNTSVTLGPHYEEFIAQMVASGRYATSSEVIRAGLRMIEDYEQRLEVLRREIQKGEESGLAEDFDFNKFIEKMKR... 77
106 1.000e-23gi|648562739|ref|WP_026254490.1| antitoxin ParD1 [Corynebacterium pilosum]  clstr ali  36  1MSTNTSVSLDDHFVQFIADQVSSGRYRNASEVIRAGLRLLEERETYHEAVRQALIEGEESGPLTSFDFDKFIAER..... 75
107 1.000e-23gi|1011178687|ref|WP_062099815.1| antitoxin [Caulobacter sp. CCH5-E12]  clstr ali  36  1MSKNTSIVLSEHFQSFIAEQIGEGRYGSASEVVRAGLRLLENQEAKLAALRNALKEGWDSGKPEAFDVEAFLA....... 73
108 1.000e-23gi|806818308|emb|CQD24607.1| addiction module antidote protein, family protein [Mycobacterium lentiflavum]  clstr ali  32  15MGKNTSFSLDNHFSAFIEAEVASGRYGSSSDVVRAALRLLEDRETRLDALRQALIAGEHSGEATPFDFNARKRAERHAR. 93
109 1.000e-23gi|501451134|ref|WP_012474583.1| antitoxin [Chlorobium phaeobacteroides]  clstr ali  35  1MSKNTSITLGSHFEHFVQSSISVGRYKNASEVIRAGLRLLEEEESKVAALKQAIQEGIESGSKEDFDPEQFLKLKAERS. 80
110 1.000e-23gi|472822999|emb|CCE76559.1| antidote component of a toxin/antitoxin system [Clavibacter michiganensis subsp. nebraskensis NCPPB 2581]  clstr ali  35  18MAQNTSISLDGHFTGFLAREVESGRYRSASEVVRAGLRLLEDQETQLEALRAALVAGEASGEAAPFDLDAFIADKRA... 94
111 1.000e-23gi|737109297|ref|WP_035097093.1| antitoxin [Devosia sp. LC5]  clstr ali  33  1MAKNTSISLSEHFAGFVDGQVKTGRYGSASDVVRAGLRLLEEHEAKVKALQDALIEGEK-GPFTPFDRKAMLEELH.... 75
112 1.000e-23gi|738875085|ref|WP_036763148.1| hypothetical protein [Paracoccus yeei]  clstr ali  21  1MA-TMNVSLPDPMKSWVEERTRDGSYSNASDYVRHLIRRDQERARAIAQLQAAITEGLESGPPQPFDATGFKARMRRTH. 78
113 1.000e-23gi|749611104|ref|WP_040233135.1| antitoxin [Citrobacter pasteurii]  clstr ali  35  1MRQNTSVALGPHFSSFVDAQVQGGRYGSASDVIRAGLRLLEEHEARVKALQEALIAGRESGEPRSFDSEAFLRRMHTQH. 79
114 1.000e-23gi|653183873|ref|WP_027420343.1| antitoxin [Crocinitomix catalasitica]  clstr ali  30  1MNKNTSVSLGNYFDEFVQGRVNEGRFKNVSEVIRAGLRLLEEEENKVVALKNAIQQGIDSGIAHDFDPKKHLALKAKKH. 80
115 1.000e-23gi|504576530|ref|WP_014763632.1| addiction module antitoxin [Sinorhizobium fredii]  clstr ali  16  1MA-TMNISLPDPMKTWIETRLKQGEFSNTSDYVRHLIRRDQQREAAIATIQQAIDEGLSSGEPEPFDAASFNARMREQH. 78
116 1.000e-23gi|550980522|ref|WP_022728629.1| MULTISPECIES: CopG family transcriptional regulator [Fodinicurvata]  clstr ali  29  1MA-TMNISLPEQMKAWVESQSKSGRYGNASDYVRDLIRRDQDRQARLAELQQLIDEGVNSGVSSNSLDDLLAQARRQAG. 78
117 2.000e-23gi|517858111|ref|WP_019028319.1| antitoxin [Colwellia piezophila]  clstr ali  32  1MAKNTSVTLGDHFDQFINQQLNTGRYGSASEIIRAGLRALEDQEAKILNLRNMLIQGEQSGIADYNYESLLTELDKDNH. 79
118 2.000e-23gi|759597709|ref|WP_043316034.1| antitoxin [Microbulbifer sp. HZ11]  clstr ali  32  1MAKNTSMTLGSHFDKFIAKEVASGRYGSASEVVRAGLRLLEDTEIKLETLRSLLQEGEQSGFTDYTYESFIAELDEKK.. 78
119 2.000e-23gi|489884107|ref|WP_003787557.1| antitoxin [Actinomyces viscosus]  clstr ali  33  1MSVNTSVSLDDHFAGFIASQVGSGRYRSASEVIRAGLRLLEDQETEMSALREALASGEASGQAEPFDFDAFIAAKTAR.. 78
120 2.000e-23gi|757165763|ref|WP_042719851.1| antitoxin [Flavobacterium sp. B17]  clstr ali  32  1MGRNTSVSLGDYFEDFVHSKVSEGRFKNASEVIRAGLRLLEEEENKIQLVKNAIQEGINSGIAYDFDPKKHLESLK.... 76
121 2.000e-23gi|766763258|ref|WP_044839703.1| antitoxin [Thalassomonas viridans]  clstr ali  36  1MAKNTSITLGEHFDGFITSQINTGRYNSASEVIRAGLRLLEKSETKTEVLRRMLDEGEQSGIAEYSFDALIEELDAE... 77
122 2.000e-23gi|736053596|ref|WP_034197146.1| antitoxin [Burkholderia sp. MSh2]  clstr ali  31  1MPRNTSISPGDRLTQFADTQVASGRYGSASDVVRAGLRLLETRETELRVLQEALKAGEASGTPVAFDGPTFLARMRTRHA 80
123 2.000e-23gi|551323805|ref|WP_022943281.1| antitoxin [Psychromonas hadalis]  clstr ali  37  1MAKNTSVTLGDHFDQFISQQLHSGRYGSASEVLRAGLRVLEDQEAKILNLRTMLIQGEQSGTVEYNYDTFLAELDKDNH. 79
124 2.000e-23gi|518504264|ref|WP_019674471.1| antitoxin [Rheinheimera perlucida]  clstr ali  35  1MAKNTSISLGEHFDGFISHQIKSGRYGSASEVVRAGLRILESEEQKLETLRVLIREGIASGTTDYTYDSLMQELDDELG. 79
125 2.000e-23gi|495389295|ref|WP_008113998.1| MULTISPECIES: antitoxin [Alteromonadales]  clstr ali  39  1MAKNTSVTLGEHFDSFISQQLETGRYGSASEVLRAGLRALEDQELKMNNLRNMLVEGENSGIADYSYDTLLSDLDKENH. 79
126 2.000e-23gi|517216911|ref|WP_018405729.1| hypothetical protein [Marinobacter lipolyticus]  clstr ali  36  1MAKNTSITLGDHFDGFISDQIQSGRYGSASEVVRAGLRVLEDKDSKLNVLRQMLTDGEESGIADYSYDSLMAELDTE... 77
127 2.000e-23gi|490811429|ref|WP_004673546.1| MULTISPECIES: antitoxin [Rhizobium]  clstr ali  28  1MA-TMNVSLPDPMKDWVEAQTKTGRYANASDYVRDLIRKDQERNDKIAAMQRFVDEGLKSGVGSRSKDALFEAARAR... 76
128 2.000e-23gi|563281437|gb|ESZ86018.1| antitoxin [Blastomonas sp. CACIA14H2]  clstr ali  36  1MARNTSVTIGDHFSGFIAEQVRTGRYGSASDVVRAGLRLLEEHETKVRALQEALIEGEQSGEPRPIDFEAL......... 71
129 3.000e-23gi|693557142|dbj|GAL69214.1| ParD protein [Jejuia pallidilutea]  clstr ali  31  17..KNTSISLGNYFDQFVQTQVSAGRYKNVSEVIRAGLRLLENEESKVIALRNAIQEGLNSPLVEDFDFDELKKLKAEK.. 93
130 3.000e-23gi|930462813|ref|WP_054210441.1| hypothetical protein [Bosea vaviloviae]  clstr ali  31  1MA-TMNVSLPDRMKDWVETQANSGRYGNASDYVRDLIRRDQERQDAIARIQHAIDEGIRSGVSTRSMDELLDEARRRAGV 79
131 3.000e-23gi|910213676|ref|WP_050022626.1| MULTISPECIES: antitoxin [Chryseobacterium]  clstr ali  30  1MGRNTSVSLGDYFEDFVDHKVSEGRYKNASEVIRAGLRLLEEEENKILLLKNAIKEGIESGTAKNFNPEKHLETLKAK.. 78
132 3.000e-23gi|517444387|ref|WP_018615227.1| antitoxin [Segetibacter koreensis]  clstr ali  33  1MGKNTSVSLGDYFEDFVENRVAEGRYKNASEVLRAGLRLLEEEENKNAALKSAIQEGINSGVVKNFNPKKHVESLKA... 77
133 3.000e-23gi|518842209|ref|WP_019998099.1| hypothetical protein [Aureimonas ureilytica]  clstr ali  35  1MSRNTSIVLGDHFSDFIAEQVRDGRYGSASEVVRAGLRLLEERETKLQALREAIREGVESGPATDLD---FDELLRELNA 77
134 3.000e-23gi|652372851|ref|WP_026768807.1| MULTISPECIES: antitoxin [Sediminibacterium]  clstr ali  28  1MSRNTSISLGDHFEHFVDNRVSTGRFKNASEVVRAGLRLLEEEENKIIALKRAIEDGIESGLAKNFDAKKHLQKLKA... 77
135 3.000e-23gi|652444494|ref|WP_026839489.1| antitoxin [Gillisia sp. JM1]  clstr ali  30  1MSKNTSVSLGDYFDQFVHSRINEGRFKNVSEVIRAGLRLLEEEESKVIVLRNAIQEGIDSGIANDFEPKSHLELKAKKNA 81
136 3.000e-23gi|503028628|ref|WP_013263604.1| antitoxin [gamma proteobacterium HdN1]  clstr ali  31  1MAKNTSISLGDHFDGFIASQINTGRYGSVSEVIRAGLRKLEDEERKLETLRALIIEGRASGTAEYSYDSLMRELDDELG. 79
137 3.000e-23JGI.Meta 7063294438 C2629185__gene_163076 putative addiction module antidote protein, CC2985 family [Human Stool microbiome from visit numbe  ali  34  21MRRNTSVSLGSYFEAFVENKITQGRYKNASEVIRAGLRLLEEEEHRIAVLKNAIQEGLDSGVAVDFDPTEHLASLKAAR. 99
138 3.000e-23gi|652329005|ref|WP_026726298.1| antitoxin [Flavobacterium sasangense]  clstr ali  28  1MGRNTSVSLGDYFEKFVDDRVSEGRFKNASEVIRAGLRLLEDEETKITALKNAISEGIQSGIAKDFDPKKHLESLKA... 77
139 3.000e-23gi|923030061|ref|WP_053424086.1| antitoxin [Rheinheimera sp. KL1]  clstr ali  40  1MARTTSITIGSQLDDFVGKLIESGRYGSTSEVVRSALRLLEQQENQITALRNAIEAGEKSGESDLSLQDIAAELKRKHNV 80
140 3.000e-23gi|654355051|ref|WP_027847516.1| antitoxin [Marinospirillum minutulum]  clstr ali  29  1MAKNTSISLGNHFDQFIARQVADGRYGSASEVIRAGLRKLEDESQKLETLRALIQEGIVSGTAEYSYDALMAELDNELG. 79
141 3.000e-23gi|996005037|gb|AMJ62424.1| hypothetical protein AXW83_20875 [Bosea sp. PAMC 26642]  clstr ali  27  1MA-TMNVSLPDQMKAWVEAQTETGRYGNASDYVRDLIRRDQERREKIAEFQRLVDEGRASGISTRTLDEVWDEARRRARA 79
142 3.000e-23gi|503784948|ref|WP_014018942.1| MULTISPECIES: antitoxin [Cyclobacterium]  clstr ali  34  1MAKNTSITLGEHFESIIEKSIASGRYASASEVIRAGLRKIEEEEQKITALKEAIEAGENSGYITDFDPKEFLERMHAKH. 79
143 3.000e-23gi|503028627|ref|WP_013263603.1| antitoxin [gamma proteobacterium HdN1]  clstr ali  30  1MARNTSITLGSHFDDFIAAQVDNGRYGSASEVVRAGLRLLEETEGKIERLRRLMNEGEQSGIADYSLESVIAELDHEAH. 79
144 3.000e-23 [KEGG:K07746]|[COG3609] Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain  ali  41  86MARTTSVTIGEQLDSFISRLIDSGRYGSASEVMRSALRLLEQQETNDEVIRQAVIAGLESGESSLSLRDIAAQRKLRHRV 165
145 3.000e-23gi|739264532|ref|WP_037127458.1| antitoxin [Rhizobium sp. CF097]  clstr ali  26  1MA-TMNVSLPDPIKDWVEAQTRTGRYANASDYVRDLIRRDQERNDKIAAMQRFVDDGFESGVGNRSKGDLFAAAMARAE. 78
146 3.000e-23gi|752748070|ref|WP_041395188.1| antitoxin [Photobacterium profundum]  clstr ali  36  1MSKNTSVTLGSHFDQFISQQLKSGRYGSASEVVRAGLRSLEDSEMKLQHLRIMLNEGETSGNSNYSYQDLISELDQENH. 79
147 4.000e-23gi|803559280|ref|WP_046075937.1| antitoxin [Salinivibrio sp. KP-1]  clstr ali  36  1MAKNTSITLGEHFDGFIASQIETGRYSSTSEVVRAALRLLENQETKLHTLRQLLVEGEQSGDAEYDIDSFIHEIDAE... 77
148 4.000e-23gi|1011131099|ref|WP_062052839.1| antitoxin [Aquimarina longa]  clstr ali  27  1MSKNTSISLGNYFDQFIQSRIREGRFKNVSEVIRAGLRLLEEEESKAVALKNAIQEGIDSGIAHDFNPEKLKSLKAKKH. 80
149 4.000e-23gi|494020045|ref|WP_006962342.1| ParD protein (antitoxin to ParE) [Sphingobium japonicum]  clstr ali  27  1MA-TMNISLPDPMKHWVEGQAETGRYSNASDYVRDLIRRDQERAMKIAHMQALVDEGRASGTSPRSVEDIFADAAAR... 76
150 4.000e-23gi|1011142024|ref|WP_062063695.1| antitoxin [Cellvibrio sp. OA-2007]  clstr ali  33  1MVKNTSITLGDHFDGFISAQLESGRYGSASEIVRAGLRLLEDSENKLHVLRQMLIQGEESGVADYNYKDFLAELDEEK.. 78
151 4.000e-23gi|973377136|ref|WP_059120150.1| antitoxin [Vibrio sp. MEBiC08052]  clstr ali  38  1MAKNTSITLGEHFDNFIASQIQSGRYGSASEVIRSALRLLENQETKMNTLRQHLIEGEQSGDADYDLDDLIHEIDSE... 77
152 5.000e-23gi|835551225|ref|WP_047553170.1| antitoxin [Rhizobium leguminosarum]  clstr ali  43  1MARNTSVSLGDHFSAFIEAQIQTGRYGSASDVLRAGLRLLEEHEAKVRALQDALIAGEESGKPA................ 64
153 5.000e-23gi|504837952|ref|WP_015025054.1| antitoxin [Psychroflexus torquis]  clstr ali  29  1MNKNTSISLGDYFDQFVQSSISEGRFKNVSEVIRAGLRLLEEEESKVIALKKAIKEGADSGIAHDFIPKNHLELKAKKH. 80
154 5.000e-23gi|657124418|gb|AID30731.1| ParD [Mesorhizobium huakuii 7653R]  clstr ali  28  5MA-TMNVSLPDPMKDWVEAQTETGRYANASDYVRDLIRRDQERNDNIAAMQRFVDDGLKSGIGNRSRDALFTEAVKRAG. 82
155 5.000e-23gi|126628184|gb|EAZ98809.1| hypothetical protein MELB17_14216, partial [Marinobacter sp. ELB17]  clstr ali  38  87MARTTSITIGAPLDDFIGKLIESGRFGSTSEVVRSALRLLERQENQLAALRAAVEAGERSGESDLSLHDIAARVKQQHHV 166
156 5.000e-23gi|739618934|ref|WP_037475460.1| antitoxin ParD1 [Sphingobium sp. ba1]  clstr ali  31  3.SKTTSVALGDHFREFAERKVSEGRYGSTSEVIRAGLRLLESEEQKLEALRAAIQEGLDSGPGQEFDFDAWLDRR..... 76
157 6.000e-23gi|1000064155|gb|KXJ41451.1| antitoxin [Methylothermaceae bacteria B42]  clstr ali  31  1MSKNTSITLGPHFEDFINRQLKTGRFSSASEVIRAALRLLEEEETKLATLRKLLEEGEQSGMSDYTLTGLIDEL...... 74
158 7.000e-23gi|491116053|ref|WP_004974509.1| hypothetical protein [Acinetobacter towneri]  clstr ali  40  1MARTTSVTIGPQLDNFVSKLIESGRYGSTSEVMRSALRLLEQQENQTAALKQAIEAGENSGESTLSLKDIAAQVKQKHRV 80
159 7.000e-23gi|750557991|ref|WP_040839860.1| antitoxin [Nocardia brevicatena]  clstr ali  32  1MGKNTSFSLDEHYSAFIEAEVASGRYRSASDVVRSALRLLEDHETHLRALRQALVEGERSGSSTPFDFDAFLARKRA... 77
160 7.000e-23gi|996003437|gb|AMJ60824.1| antitoxin [Bosea sp. PAMC 26642]  clstr ali  29  1MGENTSISLGDHFVAFIDKQVAEGRYVSASEVVRAALQLLEENEAEIAALQAALIEGEESGDAEEFDFEAFIARMHAEH. 79
161 8.000e-23gi|930193917|ref|WP_054183109.1| antitoxin [Rhizobium acidisoli]  clstr ali  26  7...TMNVFLPDPMKDWVEAQTKTGRYANASDYVRDLIRRDQTRNDKIAAMQRFIDDGLNSGIGNRSKDELFAAALTRAE. 82
162 8.000e-23gi|503452680|ref|WP_013687341.1| antitoxin [Fluviicola taffensis]  clstr ali  29  1MGRNTSISLGNHFESFIESTVNKGRFNNASEVVRAGLRLLEEEENKIISLRKAIQEGIDSGIAEDFESNQFLESLKARK. 79
163 8.000e-23gi|948066402|ref|WP_056725264.1| hypothetical protein [Caulobacter sp. Root655]  clstr ali  27  13MA-TMNVSLPDAMKDWVESRAETGRYSNASDYVRDLIRRDQERATKIAAMQRLVDEAEESGVSPNSMNDILAAARRRAGV 91
164 9.000e-23gi|797006832|ref|WP_045818129.1| antitoxin [Teredinibacter sp. 1162T.S.0a.05]  clstr ali  35  1MAKNTSITLGEHFEDFIAQQIESGRYGSASEVVRAGLRMLEDTESKLGTLRRLLNEGEESGFVDYSLEGLISELDEDSH. 79
165 9.000e-23gi|494663081|ref|WP_007421025.1| antitoxin [Idiomarina sp. A28L]  clstr ali  36  1MAKNTSVSLGEYFEGFIATQIASGRYGSASEVVRAGLRMLEDNESKLNTLRRMLAEGEQSGTADYNYDALIAELDER... 77
166 9.000e-23gi|447030460|ref|WP_001107716.1| antitoxin [Vibrio cholerae]  clstr ali  40  1MAKNTSITLGDHFDGFIANQIQSGRYGSASEVIRSALRLLETQETKMNTLRQLLVAGEESGVADYDLDSFINELDSEER. 79
167 9.000e-23gi|764646751|ref|WP_044442136.1| antitoxin ParD1 [Agreia bicolorata]  clstr ali  33  1MATNTSISLDDHFSVFLAREVATGRYRSASEVVRAGLRLLEDQETQMSALRAALDAGEQSGKAEPFDFDEFIAAKKR... 77
168 1.000e-22gi|651233813|ref|WP_026373896.1| antitoxin ParD1 [Agrococcus lahaulensis]  clstr ali  36  1MAQNTSVSLDDHFAAFLAREVASGRYRSASEVIRAGLRLLEDQETRVAAMRAALIEGERSGAPEPFDFDAFVASKK.... 76
169 1.000e-22gi|504791116|ref|WP_014978218.1| antitoxin [Alteromonas macleodii]  clstr ali  40  1MAKNTSITLGDHFDGFIASQIQTGRYGSASEVIRSALRLLETQETKLNTLRQLLVAGEESGEAEYDLEHLISEL...... 74
170 1.000e-22gi|497290838|ref|WP_009605055.1| addiction module antidote protein, CC2985 family [SAR116 cluster alpha proteobacterium HIMB100]  clstr ali  19  1MS-TMNISLPEQMKAWVEEQTEDGKFSNLSHYVRHLIRCDQERAEVVRLTKAKYEKGLASGEPDPFDAEAFKKRMRRKH. 78
171 1.000e-22gi|754577098|ref|WP_041969952.1| antitoxin [Geobacter sp. OR-1]  clstr ali  28  1MQKNTSVSLGPHYEKFISNQVAQGRFGSASETIRAGLRLLEERETKLSLLRRALIEGEESGTADYSLKSLIDQLDNE... 77
172 1.000e-22gi|118166505|gb|ABK67402.1| putative addiction module antidote protein, CC2985 family protein [Mycobacterium avium 104]  clstr ali  33  41.GKNTSFSLDEHYSAFIESEVASGRYRSASDVVRSALRLLEDRETQLRALREALEAGERSGTSTPFDFDTFLDRKR.... 115
173 1.000e-22gi|935463542|ref|WP_054406323.1| antitoxin [Flavobacterium akiainvivens]  clstr ali  32  1MAKNTSILLGNHFDDFISKEVASGRYNSASEVIRSALRLLELEEDKIKRLRNELEEGENSGFIDDFNPQKHLENLRKKHV 80
174 2.000e-22gi|800986882|ref|WP_046013124.1| antitoxin ParD1 [Microbacterium sp. SA39]  clstr ali  34  1MGQNTSISLDEHFSDFLSREVASGRFRSASEVVRAGLRLLEDQETQMAALRASLVAGENSGEAEPFDFDAFIASKK.... 76
175 2.000e-22gi|917552023|ref|WP_052153401.1| hypothetical protein [Devosia sp. LC5]  clstr ali  30  1MA-TMNVSLPAAMKEWVEAQVETGRYGNSSDYVRDLVRRDQERGKKVEELRRLVQEGIDSGISPLTADEILDEARRRAR. 78
176 2.000e-22gi|491836845|ref|WP_005625064.1| antitoxin [Actinobacillus ureae]  clstr ali  43  1MARTTSVTLGEPLNDFVNQMVESGHYGSTSEVVRTALRLLEEKEQYLVQLRHSIQEGIDSGECNDSFDEIVTQARGTANV 80
177 2.000e-22gi|739377593|ref|WP_037238466.1| hypothetical protein [Roseovarius sp. MCTG156(2b)]  clstr ali  31  1MA-TMNVSLPNQMKDWVEAQTQSGQYSNSSDYVRDLIRRDQERQSKIAHMQRLVDEGLASGISSRSKDEIFEGARSRIEA 79
178 2.000e-22gi|738453649|ref|WP_036404828.1| antitoxin [Mycobacterium kansasii]  clstr ali  38  1MGKNTSFSLDEHFSAFIEEEIASGRYRSASDVVRTALRLLEDRETRLRALRQALIAGEQSGKSTQFDFDDFVARKRA... 77
179 2.000e-22gi|738855090|ref|WP_036744143.1| addiction module antitoxin [Paracoccus halophilus]  clstr ali  24  3...TMNISLPDPMKSWVEDQAKSGRYANSSDYVRDLIRRDRARAEAIGQLQAAIDAGFASGAAVPLDPATFKARMRDLDA 79
180 3.000e-22gi|652553162|ref|WP_026946779.1| antitoxin [Algoriphagus marincola]  clstr ali  34  1MSKNTSISLGDYFDRFVTTQLESGRYKNASEVIRAGLRLLENQETQALALKNAIEEGLNSPRVNEFDFD........... 69
181 3.000e-22gi|503794291|ref|WP_014028285.1| addiction module antitoxin [Acidithiobacillus ferrivorans]  clstr ali  27  1MATVRTISLTDQQDGWIKAQIQAGHYTNDSEYIRDLIRREQERVAQLDALRAALIEGENSGAPQPFDVQAFKARMAATH. 80
182 3.000e-22gi|499223282|ref|WP_010920822.1| antitoxin ParD4 [Caulobacter vibrioides]  clstr ali  31  14MA-TMNVSLPDAMREWVEGQTQSGRYHNASEYVRDLIRRDQERADKIAHLQRLIDEGLDSGVGERSLHEIRAEARRRAGV 92
183 3.000e-22gi|740798077|ref|WP_038583360.1| hypothetical protein [Corynebacterium glutamicum]  clstr ali  36  1MAMNTSISLDDHFASFLSEQVESGRYQTASEVIRAGLRLLEEREARLTALRAALVNGKMSGEAEEFDFDAFIASK..... 75
184 3.000e-22gi|754886817|ref|WP_042245878.1| addiction module antitoxin [Paracoccus sp. PAMC 22219]  clstr ali  18  1MA-TMNVSIPDPMKVWVEERARGGSFSNASDYVRHLIRRDQERADAIGQLQAAVTEGLQSGEPRPFDAKAFKAKMRHKHA 79
185 3.000e-22gi|923025326|ref|WP_053419356.1| antitoxin [Azoarcus sp. PA01]  clstr ali  40  1MAKNTSVTLGEHFEGFITSQIAQGRYGSASEVIRASLRLLEEHEQKVEALRRALIEGEESGEDSPLDLQEIKRAARRQA. 79
186 3.000e-22gi|504819189|ref|WP_015006291.1| antitoxin [Cycloclasticus sp. P1]  clstr ali  41  1MARNTSVTLGEHFDEFVHEKINSGRFQSVSEVVRAGLRKLEEDETKLQVLRDKLQAGENSPLVDDFDGKKFMSGLRSKH. 79
187 3.000e-22gi|85669970|gb|EAQ24833.1| helix-turn-helix protein, CopG [Roseovarius sp. 217]  clstr ali  22  23...TMNISLPDPMKSWVEDQAKAGRYANSSDYVRDLIRRDRARTEAIAEIQAAVDAGLASGPAAPLDRSTFKSRMRAEYA 99
188 3.000e-22gi|495086697|ref|WP_007811520.1| antitoxin [Roseobacter sp. AzwK-3b]  clstr ali  28  1MARNTSVVLSDHFNDFITQAVESGRYASASDVVRAGLRMLEMEEEKLERLRAAIAEGEASGPPEPFDFDEFLAEMHAKHL 80
189 3.000e-22gi|947572111|ref|WP_056235606.1| hypothetical protein [Devosia sp. Root635]  clstr ali  31  14MA-TMNVSLPDAMKQWVEDQVKTGRYGNASDYVRDLVRRDQERADKKAEFERLVQEGIDNGVSPLTPDEIFANARRKAGV 92
190 3.000e-22gi|810981790|ref|WP_046370578.1| antitoxin [Flavihumibacter petaseus]  clstr ali  27  1MGRNTSISLGDHFEDFIDKRISTGRFKNASEVIRAGLRLLEEEERKITTLKKAIVEGIESGTVDNFDAKQHLSKLKAAR. 79
191 4.000e-22gi|746355586|ref|WP_039400255.1| antitoxin ParD1 [Microbacterium mangrovi]  clstr ali  35  1MATNTSISLDEHFTDFLAREVSTGRYRSASEVVRAGLRLLEDQETQMAALRAALIAGEESGEPERFDFDEFIASKR.... 76
192 4.000e-22gi|738664535|ref|WP_036573213.1| antitoxin [Nitrosomonas cryotolerans]  clstr ali  32  5..KNTSVTLGKHFEKFLAHQVETGRYGSASEAIRAGLRLLEEREIKLEALRHALIEGEQSGTSDYSLQNILDELEDEK.. 80
193 4.000e-22gi|746731799|ref|WP_039689109.1| antitoxin [Tateyamaria sp. ANG-S1]  clstr ali  30  1MSRTTSVALGDHYSKFISDQVATGRYASASDVVRSGLRLLQEREAQVASLQAALEAGEASGPARPLDIDAYVAGRRARG. 79
194 4.000e-22gi|919931082|ref|WP_052911686.1| antitoxin [Riemerella anatipestifer]  clstr ali  31  2..KNTSVSLGNYFDQFVSSQVSAGRYKNVSEVIRAGLRLLENEESKAIALKNAIQQGIDSGIAHNFDPEKHLQELKMKR. 78
195 4.000e-22gi|495412707|ref|WP_008137405.1| MULTISPECIES: antitoxin [Pseudoalteromonas]  clstr ali  37  1MAKNTSVTLGDHFDQFISQQLHSGRYGSASEVLRAGLRALEDEETKRLNLRNMLVQGEQSGTVEYSYDSLIAELDKE... 77
196 4.000e-22gi|969845443|ref|WP_058606647.1| hypothetical protein [Methylobacterium radiotolerans]  clstr ali  26  1MA-TMNVSLPDPMKDWVEAQAGTGRYANASDYVRDLIRRDQDRLNKIAELQRLVDEGLASGISSRTPDEIRQLGRDRLAA 79
197 4.000e-22gi|978150196|gb|KVK51951.1| hypothetical protein L903_01055 [Agrobacterium sp. JL28]  clstr ali  26  40MA-TMNISLPAPMKEWVEAQSRTGRYSNASDYVRDLIRKDQERGEKIAAMQHFVDEGLRSGVGHRSQEALFAEAEAR... 115
198 4.000e-22gi|503612825|ref|WP_013846901.1| MULTISPECIES: antitoxin [Sphingomonadaceae]  clstr ali  25  1MA-TMNVSLPDAMKEWVEGQAGTGRYSNASDYVRDLIRRDQERREKIAAMQTMVDESLASGISPNSIDDMMKEARRRAGV 79
199 5.000e-22gi|959968900|gb|KSV78625.1| antitoxin [Sinorhizobium sp. GL2]  clstr ali  32  5MA-TMNVSLPDPMKDWVEAQTRTGRYANASDYVRDLIRRDQERIDKVAVMQRFVDDGLKSGVGSRSKDELFSAALTRAEV 83
200 6.000e-22gi|737699644|ref|WP_035668547.1| antitoxin [Flavobacterium sp. 83]  clstr ali  25  1MGKNTSISLGNHFEDFIDKSVSKGRFQNASEVIRAGLRMLEEEEDKILMLRNAIQEGIDSGLAKDYDPKKHLEMLQAKK. 79
201 6.000e-22gi|522049319|ref|WP_020560528.1| hypothetical protein [Thiothrix flexilis]  clstr ali  37  1MPRNTSITLGTHFEGFVDQLVNQGHYHSVSEVIRAGLRLLEEQELRVQQLREALIAGEQSGVAVAFDRQHFTKTMRQ... 77
202 7.000e-22gi|736102851|ref|WP_034235506.1| antitoxin [Arenibacter certesii]  clstr ali  35  2MSRNTSITLGRHFEDIVEKGIASGRYASVSEVIRAGLRLLEEEENRIEALRKALVAGEESGFVEHFDSEAFLDEMHRKH. 80
203 7.000e-22gi|952921608|ref|WP_057935268.1| antitoxin [Pedobacter ginsenosidimutans]  clstr ali  27  1MGRNTSILLGDHFDNFISEKIASGKFNSASEVIRTSLRLLEEEEKQIELLREALKIGEKSGFVKNFDPVEHLEKLHRKHL 80
204 7.000e-22gi|37518407|emb|CAE46774.1| hypothetical protein [Yersinia enterocolitica]  clstr ali  40  23MARTTSVTIGEQLDSFISRLIDSGRYGSASEVMRSALRLLEQQETNDEVIRQAVITGLESGESSLSLRDIAAERKLRHRV 102
205 7.000e-22gi|968551519|ref|WP_058578974.1| antitoxin [Idiomarina sp. H105]  clstr ali  35  1MPKNTSITLGEHFDEFIANQLKTGRYGSASEVIRSALRLLETQETKVNTLRQLLVEGEESGMAEYDLDSFIDELDSE... 77
206 7.000e-22gi|502299122|ref|WP_012755608.1| antitoxin [Rhizobium leguminosarum]  clstr ali  32  1MA-TMNVSLPDPMKDWVEAQARTGRYSNASDYVRDLIRRDQARSDKIAAMQRFVDDGVKSGVGGRSKDELFAAAVARAE. 78
207 7.000e-22gi|1016314920|ref|WP_062986123.1| antitoxin [Nocardia salmonicida]  clstr ali  32  1MGKNTSFSLDEHYSRFIAAEVASGRYGSASDVVRSALRMLENHETQLAALRGALIDGESSGPSTAFDFDSFIASKRA... 77
208 8.000e-22gi|504584346|ref|WP_014771448.1| antitoxin [Belliella baltica]  clstr ali  33  1MSKNTSITLGSHFEDFISKQIENGRYGSASETVRAALRLLEEKETKLAAIRQALSEGEASGRADYSLDSLIEEL...... 74
209 8.000e-22gi|1011810666|ref|WP_062630311.1| antitoxin [Devosia sp. Leaf64]  clstr ali  25  1MA-TMNVSLPGPMKDWVEAQAQTGRYANASDYVRDLIRRDQERSDKISTMQRHVDEGLASGAGTLTREGIFAEAKRRAVA 79
210 8.000e-22gi|493285962|ref|WP_006243694.1| antitoxin [Mycobacterium tusciae]  clstr ali  35  1MGKNTSFSLDEHYSAFIEQEVTSGRYRSASDVVRAALRLLEDRETRLRALRQALVDGERSGESTPFDVDEFVARKR.... 76
211 8.000e-22gi|497356867|ref|WP_009671080.1| antitoxin [gamma proteobacterium IMCC1989]  clstr ali  27  1MAKNTSISLGSHFDDFIKGQVTDGRYGSASEVIRAGLRKLEDDERKLETLRALIEEGKASGTVEYSYESLMQELDDELG. 79
212 9.000e-22gi|648573755|ref|WP_026265506.1| CopG family transcriptional regulator [Rhizobium leguminosarum]  clstr ali  25  1MA-TMNVSLPDPMKEWVDAQTKTGRYSNASDYVRDLIRRDQERAGKLAELQRLITDGLESGVSDRSKADILREARERLAA 79
213 9.000e-22gi|522163842|ref|WP_020675050.1| hypothetical protein [Geopsychrobacter electrodiphilus]  clstr ali  30  1MA-TMNISLPDQMKSWVEECVQSGRYANASDYVRDLIRND---HLKLEQLRQALIEGESSGPSTGLDINAFIADKKK... 73
214 1.000e-21gi|658434910|ref|WP_029661247.1| antitoxin [Algoriphagus marincola]  clstr ali  28  1MSKNTSIILGDHFDQFIQKEIKTGRYASASEIVRMGLRLLEQETRKIELINEALVVGEMSGKPVEFDNEEFKSRMKA... 77
215 1.000e-21gi|948078414|ref|WP_056737192.1| hypothetical protein [Phenylobacterium sp. Root700]  clstr ali  27  1MA-TMNVSLPDAMKVWVEGRAETGRYSNASDYVRDLIRRDQERAEKIAHLQHLIDEGVESGVSEKTMQDIRAEARRRAGV 79
216 1.000e-21gi|212685774|gb|EEB45302.1| addiction module antidote protein, CC2985 family [Providencia alcalifaciens DSM 30120]  clstr ali  66  6MARVTSVTLGEHFNRFIGDMIQSGRYGNTSEVIRDALRMMEEREQRLEYVRKMVLDGLNSPESESSMDDIFARAEKDLNV 85
217 1.000e-21gi|550892544|ref|WP_022653350.1| addiction module antitoxin [Aquaspirillum serpens]  clstr ali  22  7.....TITLTDQQDNWIKAQISTGRYTNDSEFIRDLIRREQERSLEMEAIRTALIEGEASGEPKPFNAEAFKQKMSQQH. 80
218 1.000e-21gi|1011530148|ref|WP_062423789.1| MULTISPECIES: antitoxin [Rhizobium]  clstr ali  29  1MA-TMNVSLPNPMKEWVETQAKTGRYSNASDYVRDLIRRDQIRAEKVAAMQRHVDEGIASGTGNRTSDELFKVAAARAEV 79
219 1.000e-21gi|928982079|ref|WP_054006405.1| addiction module antitoxin [Pseudorhodobacter psychrotolerans]  clstr ali  22  3...TMNISLPDPMKSWVEDQAKAGRYANSSDYVRDLIRRDRARSEAITELQAAIDEGLSSGPATLLDRESFKAEMRAQYA 79
220 1.000e-21gi|516247927|ref|WP_017651890.1| hypothetical protein [Microchaete sp. PCC 7126]  clstr ali  33  1MQKNTSVTLGEHFEAFIASQIKSGRFNNASEAIRAGLRLLEEREIKLVALQRALVEGENSGFTDYSLSGLLAELDRE... 77
221 1.000e-21gi|521970806|ref|WP_020482077.1| hypothetical protein [Methylomonas sp. MK1]  clstr ali  39  1MARNTSVTLGDHFDNFVQEKIQQGRFLSVSEAVRAGLRKLEEEELKLQTLRAKLQAGEDSPLQEDFDEEQFLASMRKNH. 79
222 1.000e-21gi|1011879778|ref|WP_062696592.1| antitoxin [Chryseobacterium indologenes]  clstr ali  30  1MAKNTSILLGDYFDNFINEQIKSGKYSSASEVIRNALRLFEYEESKKTELINELKKGEKSGFAENFNKDTFLNTLHEKH. 79
223 1.000e-21gi|504559375|ref|WP_014746477.1| antitoxin [Tistrella mobilis]  clstr ali  24  3MA-TMNVSVTDQMKIWVEGQVESGRYGNASDYIRDLIRRDQERRAALADIQRLIDEGLASGSSGLSMQDVLTEARRRAAL 81
224 1.000e-21gi|947657096|ref|WP_056319811.1| MULTISPECIES: antitoxin [Rhizobium]  clstr ali  32  1MA-TMNVSLPDPMKDWVEAKAKSGRYSNLSDYVRDLIRRDQVRTDKIAEMQRFVDDGIGSGVGTRSKDELFAAAVARAE. 78
225 1.000e-21gi|697084580|ref|WP_033159544.1| MULTISPECIES: hypothetical protein [Methylomonas]  clstr ali  25  1MA-TMNISLPDPMRDWVQTQIQDGKYSSSSDYVRDLIRRDQETRQQQQVLQAAITEGLKSGISNRSMDDVLREAQARLAA 79
226 1.000e-21gi|602232944|gb|EYT56290.1| antitoxin, partial [Dietzia sp. UCD-THP]  clstr ali  29  1MGQNTSISLDQHFIDFLAREVESGRYRSASEVVRAGLRLLEDHETQLAALRRALIAGEESGAPEEFDFDAFFRLLHQR.. 78
227 1.000e-21gi|517703780|ref|WP_018873988.1| addiction module antitoxin [Thioalkalivibrio sp. ALJ16]  clstr ali  25  7.....TITLTDHQDSWVKAQIEAGRYTNDSEYIRDLIRREQERSAEVEALRAALVEGEASGEPRAFDADAFKKKMMEAH. 80
228 1.000e-21gi|974226695|gb|KUO67337.1| antitoxin [Lutibacter sp. BRH_c52]  clstr ali  31  1MNKNTSISLGSYFDQFVQSRIREGRFKNVSEVIRAGLRLLEEEESKVIALRNEIQKGTDSGITQDFDPKHFESLKGKKH. 80
229 1.000e-21gi|550956583|ref|WP_022704958.1| antitoxin [Pseudorhodobacter ferrugineus]  clstr ali  35  1MGKNTSIALGDHFTEFLTTQVGSGRYGSASEVVRAGLRLLESKEMQLAELREAIRAGEESGEVEGFDLDSFYADMR.... 76
230 2.000e-21gi|518124268|ref|WP_019294476.1| MULTISPECIES: addiction module antitoxin [Leisingera]  clstr ali  28  1MA-TMNVSLPEQMKTWVEEQARTGTYANSSDYVRDLIRRDQARTAAIAELQSAIDAGLASGPAEQLTAEGFKASMRR... 76
231 2.000e-21gi|738480487|ref|WP_036430692.1| antitoxin [Mycobacterium mageritense]  clstr ali  38  1MGKNTSFSLDEHFSSFIEEEVASGRYRSASDVVRTALRLLEDRETRLRALRRELIAGERSGESTPFDFDQFIAGKR.... 76
232 2.000e-21gi|739523087|ref|WP_037382363.1| antitoxin [Sinorhizobium americanum]  clstr ali  30  1MA-TMNVSLPDPMKDWVEAQTRTGRYANASAYVRDLIRRDQERNDKIAIMQRFVDDGLKSGDGNRSKDELFSAAVARAE. 78
233 2.000e-21gi|521970228|ref|WP_020481499.1| hypothetical protein [Methylomonas sp. MK1]  clstr ali  31  1MQKNTSVTLGTHFEQFIAQQISNGRYGSASEAIRAGLRLLEEREAKLSALRLALKQGEESGAADYSLKGLLEELDSESH. 79
234 2.000e-21gi|517087380|ref|WP_018276198.1| MULTISPECIES: hypothetical protein [Teredinibacter]  clstr ali  30  1MPKNTSMTLGDHFDGFIAQQIADGRYASASEVVRAGLRMLEDNEHKLATLRRLLDEGENSGTAEYSYESLMNELDDELG. 79
235 2.000e-21gi|357226934|gb|EHJ05404.1| helix-turn-helix protein, CopG [Marinobacter manganoxydans MnI7-9]  clstr ali  28  1MA-TMNISLPDAMKTWVEQQAESGRYSNTSDYVRDLIRKDQDRRHKIDQLQSLVTAGIASGKGTCSMDELRVSAKKPAR. 78
236 2.000e-21gi|808050807|ref|WP_046212269.1| MULTISPECIES: hypothetical protein [Nautella]  clstr ali  21  1MA-TMNVSLPDPMKAWVEAQTRDGLYSNASDYVRDLIRKDQEKREAVATLQRAVTDGIESGTAEEFDPTAFKAEMRARYA 79
237 2.000e-21gi|648608062|ref|WP_026299813.1| antitoxin [Flavobacterium rivuli]  clstr ali  35  1MAKNTSILLGGHFEEFISNEVASGRYNSASEVVRSALRLLEIEEQKVKHLRYELEIGEQSGMVSDFDPEAHLEYLRKKHL 80
238 2.000e-21gi|504584356|ref|WP_014771458.1| antitoxin [Belliella baltica]  clstr ali  31  1MGRNTSVSLGSYFEDFVDSKISEGRFKNASEVIRAGLRLLEEEEGKIKLLKNAIQEGIESGRVKDFDSD........... 69
239 2.000e-21gi|643488556|ref|WP_025218127.1| antitoxin [Mannheimia varigena]  clstr ali  41  1MARTTSITLGEPLNDFVNEMVASGRYGSTSEVVRTALRMLEEKEQYLAQLRQAIDEGDASGYATESLDEMMVRVKTELNV 80
240 2.000e-21gi|739646807|ref|WP_037502613.1| antitoxin [Sphingobacterium sp. ACCC 05744]  clstr ali  35  1MGRNTSVSLGDYFEDFVTRHVADGRYKNASEVIRAGLRLLEVEEDKVKALKSAIEEGVNSGIATEFDA............ 68
241 2.000e-21gi|503411706|ref|WP_013646367.1| antitoxin [Nitrosomonas sp. AL212]  clstr ali  34  11..KNTSVTLGEHFEKFLAHQIETGRYGSASEAIREGLRLLEEREAKLELLRHALAEGEKSGSSNYSLQNVLDELENE... 85
242 2.000e-21gi|1018798513|gb|AMY67441.1| helix-turn-helix protein, CopG [Defluviimonas alba]  clstr ali  21  3...TMNISLPEQMKTWVETRAEQGPFANSSDYIRELIRRDQARQQAITTLQTALDEGLNSGPAEVFDPEAFLRARR.... 75
243 2.000e-21gi|1008908748|emb|CZT35889.1| antitoxin ParD1/3/4 [Rhizobium sp. 9140]  clstr ali  28  1MA-TMNVSLPNPMKEWVEAQAKTGRYANASDYVRDLIRRDQTRTDKIAEMQRFVDDGIESGVGTRSKDDLFATAVRRAN. 78
244 2.000e-21gi|501447182|ref|WP_012470631.1| antitoxin [Geobacter lovleyi]  clstr ali  31  1MQKNTSVTLGKHYENFISQQVVQGRFGSASETIRAGLRLLEERETKLSLLRRSLIEGEESGIADYSLSGLLAEL...... 74
245 2.000e-21gi|1016939518|ref|WP_063141257.1| addiction module antitoxin [Sphingobium yanoikuyae]  clstr ali  27  7MA-TMNISLPDPMKNWVEAQSATGRYSNASDYVRDLIRRDQERQAKIAHMQMLVDEGREGGISDETMDDIRERALKQAGL 85
246 2.000e-21gi|295899249|gb|EFG78714.1| addiction module antidote protein, CC2985 family [Mycobacterium parascrofulaceum ATCC BAA-614]  clstr ali  31  25.GKNTSFSLDEHYSAFIEAEVAAGRYRSASDVVRSALRLLEDREIQLRALREALVAGERSGTSTPFDFDAFLDGKRA... 100
247 2.000e-21gi|654073462|ref|WP_027710377.1| antitoxin [Zooshikella ganghwensis]  clstr ali  38  1MAKNTSISLGDHFDGFIAEQLKTGRFGSASEVIRAGLRLLEEREAKLDALRKLIAEGVVEAEAGKTVD............ 68
248 3.000e-21gi|736835250|ref|WP_034836544.1| addiction module antitoxin [Inquilinus limosus]  clstr ali  19  1MA-TITVSLPDAMKAWVERQADGNRYGNVSNYIRDLIRKDQERMEAIAALQTAITRGVESGPPEPFDVAALKHRMHRQH. 78
249 3.000e-21gi|575405851|gb|ETW93076.1| antitoxin [Candidatus Entotheonella sp. TSY1]  clstr ali  37  1MPKNTSVTLGEHFDGFIARQIEKGRFASTSEVVRAGLRLLEEHEMKLAALRQALKEGEDSGIADYS.............. 66
250 3.000e-21gi|797118216|ref|WP_045834139.1| CopG family transcriptional regulator [Pantoea sp. BL1]  clstr ali  27  1MARTMTIDLGDELREFVESLVASGDYRTQSEVVRDSLRLLQEKQAKLENLRRLIQEGMDSGEPIEWDIDVFLKKMKARA. 81
251 3.000e-21gi|985812652|ref|WP_060873099.1| antitoxin [Myroides odoratus]  clstr ali  35  1MGRNTSISLGDYFEDFVEAKITEGRYKNVSEVIRAGLRLLE-KEDKVQMLKKAIQEGVDSGIANDFDP............ 67
252 3.000e-21gi|503597051|ref|WP_013831127.1| antitoxin [Mycobacterium sinense]  clstr ali  32  1MGKNTSFVLDDHYQAFIDQEIAAGRYRSVSEVIRSALRLLEDREAQLRALRTALEDGERSGESTPFDFDAFLDRKR.... 76
253 3.000e-21gi|498328003|ref|WP_010642159.1| antitoxin [Acidithiobacillus thiooxidans]  clstr ali  29  1MSKNTSVSLGNHFDQFIAAQLSRGRYGSATEVVRAGLRLLENEEQKLEALRQLIAEGRASGTAAYSYETFMAELDNELN. 79
254 3.000e-21gi|655330125|ref|WP_028738351.1| CopG family transcriptional regulator [Rhizobium selenitireducens]  clstr ali  27  1MA-TMNVSLPDPMKEWVDAQTRTGRYSNASDYVRALIRRDQERADSLAQLQGLVTEGLDSGVSDRSKDDILQAARERLAA 79
255 3.000e-21gi|657030901|ref|WP_029274381.1| antitoxin [Pedobacter borealis]  clstr ali  32  1MGRNTSVVLGHHFEKFVGKKISEGRFKNASEVIRAGLRLLEDEENKIEILREALKVGIDGGMVEDFDPKKHLEMLKKKN. 79
256 3.000e-21gi|501058554|ref|WP_012109924.1| antitoxin [Parvibaculum lavamentivorans]  clstr ali  28  1MA-TMNVSLPDPMKDWVEAQAETGRYSNASDYVRDLIRRDQERQDKISHMQVLVTQALESGVSDKSMDDILNEARQRA.. 77
257 3.000e-21gi|801395906|emb|CFE35437.1| Conserved protein of uncharacterised function%2C possible antitoxin ParD1 [Mycobacterium tuberculosis]  clstr ali  34  18.GKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRA... 93
258 3.000e-21gi|652602855|ref|WP_026984346.1| antitoxin [Flavobacterium sp. URHB0058]  clstr ali  29  1MGRNTSISLGNHFENFIDHTLSEGRFKNASEVVRAGLRLLEEEENRLILLKNAVQEGINSGRAENFDPNRHLELKAKKR. 80
259 3.000e-21gi|805460393|ref|WP_046110633.1| hypothetical protein [Devosia geojensis]  clstr ali  26  1MA-TMNISLPDQMKDWVDAQAKSGKYGNASDYVRDLIRHDQERTEKIAEFQRLVQEGIDSGMTDYTMEDIRRMARKDLGL 79
260 4.000e-21gi|30138857|emb|CAD85435.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718]  clstr ali  20  42MATVRTISLTNQQDAWITAQVEAGRFTNDSELIRDLIRREQERMAEIDNIRAALIDGEQSGEPQPFDFDQFKRHKLAQH. 121
261 4.000e-21gi|880911217|ref|WP_048673551.1| antitoxin [Candidatus Competibacter denitrificans]  clstr ali  32  1MQKNTSVTLGSHFEDFITKQISEGRYGSASEAIRAGLRLLEEHEIKLSALRLALKEGEESGRADYSLKSLLDEL...... 74
262 4.000e-21gi|1012140178|gb|KYP10879.1| antitoxin [Limnobacter sp. CACIAM 66H1]  clstr ali  32  1MARKKSVSLGPHFDQFIASQVHSGRYESASEVVTAGLRLLEKHETQLAQLRQYLDEGEQSGLSDYSYESIISQLNEDAE. 79
263 4.000e-21gi|643874605|ref|WP_025265721.1| antitoxin [Thalassolituus oleivorans]  clstr ali  35  1MAKNTSMTLGEHFDVFIAHQIESGRYSSASEVIRAGLRALEDHESKLEVLRQMLKDGEASGVAEYSYESFVAELDNE... 77
264 4.000e-21gi|941296850|ref|WP_055109409.1| antitoxin [Mycobacterium peregrinum]  clstr ali  36  1MGRNTSFSLDEHFNAFIDDEVASGRYRSASDVVRAALRLLEERETRLNALREALVAGENSGASTPFEFDAFVARKRAQE. 79
265 4.000e-21gi|959932419|ref|WP_058190483.1| CopG family transcriptional regulator [Methylobacterium sp. GXS13]  clstr ali  22  21...TLNVSLPEAMKDWVEAQAGTGHFGSASDYVRDLIRRDQEKIDGLAQLQTLIAEGFDSGVSERSLDDVLTEARERVRV 97
266 4.000e-21gi|499456639|ref|WP_011144103.1| antitoxin [Gloeobacter violaceus]  clstr ali  32  1MQKNTSVTLGEHFEAFIARQIDSGRYASASEAIRAGLRLLEEHEIKFAALRRALQDGESSGLTDYSLHGLLEELDQEHAV 80
267 5.000e-21 GL0043263 [Complete] locus=scaffold4030_7:2328:2603:-  ali  32  12..KTTSVALGVYFEDFIKAKIAQGRYNNASEVIRAGLRLLEENESRLTELKAAIREGVDSGVAEEFDPEEHLKTLKAKRA 89
268 5.000e-21gi|501669650|ref|WP_012615282.1| MULTISPECIES: hypothetical protein [Vibrio]  clstr ali  37  1MARTTSVTIGESLDCFIERMIATGRYGSTSEVMRSALRLLEQQENQQDLLRKALDEGEASGECSLSLKEVAARRKAKLHV 80
269 5.000e-21gi|657249836|ref|WP_029360213.1| hypothetical protein [Methylobacterium sp. L2-4]  clstr ali  26  1MA-TMNVSLPDPMKAWVEAQADTGRYANASDYVRDLIRRDQDRAGKVAELQELINAGMASGPSTRTPEEIRQLGRERLAA 79
270 5.000e-21gi|817130193|ref|WP_046502712.1| CopG family transcriptional regulator [Kiloniella litopenaei]  clstr ali  30  1MA-TMNVSLPDQMKAWVEDNVQSGRYANASDYVRDLIRQDHLR---LEKLRAALIEGEQSGTATPLDLETFISHKKR... 73
271 6.000e-21gi|643471690|ref|WP_025214239.1| addiction module antitoxin [Pseudomonas brassicacearum]  clstr ali  25  1MATVRTITVTDQQDSWIKSQIDAGHYTNDSEYIRDLIRREQERSAEVDAIRAALLEGEASGRARPFDPEVFKQRMLKVH. 80
272 6.000e-21gi|557838156|ref|WP_023461319.1| hypothetical protein [Asticcacaulis sp. YBE204]  clstr ali  24  1MA-TMNISLPEQMKAWAEAQAETGRYSNTSDYVRDLIRRDQTRAEKITAMQAKIDEGMASGISPHSVSEILEMARKRAA. 78
273 6.000e-21gi|496163536|ref|WP_008888043.1| addiction module antitoxin [Citreicella sp. SE45]  clstr ali  26  1MA-TMNVSLPDPMKSWVESRTRDGRYSNASDYVRDLIRRDQAREAAVAEIQRLVDEGLQSGPARPFDMAAFLKDRA.... 75
274 6.000e-21gi|655989250|ref|WP_029030946.1| hypothetical protein [Salinarimonas rosea]  clstr ali  29  1MA-TMNVSLPEAMKEWVEAQAETGRYANSSDYVRDLIRRDQERREKLAAFQALVTEGLESGFSDRSIDDMIAEALK.... 75
275 6.000e-21gi|493315897|ref|WP_006273284.1| antitoxin [Asticcacaulis biprosthecium]  clstr ali  25  1MA-TMNISLPDQMKDWVESRSGDGRYANSSDYVRDLIRRDQERAEKIAAMQVKITEGINSGISPHSFDEIMAIARRRA.. 77
276 6.000e-21gi|495156728|ref|WP_007881531.1| hypothetical protein [Ochrobactrum sp. CDB2]  clstr ali  28  1MA-TMNVSLPHPMKEWVEAQAKTGRYSNASDYVRDLIRKDQMRGDKIAAMQRFVDEGLQSGVGTRSRDELFATALASAE. 78
277 6.000e-21gi|736755399|ref|WP_034758982.1| addiction module antitoxin [Janthinobacterium lividum]  clstr ali  24  1MATVRTITLTDQQDDWIKAQIDAGRYTNDSEYIRDLIRREQERSAELDAIRAALMEGEASGEPQPFDAKAFKQRMLAAH. 80
278 6.000e-21gi|836625860|ref|WP_047775854.1| antitoxin [Flavobacterium sp. ABG]  clstr ali  25  1MPKNTSILLGDYFDNFINSQVKNGKFTSASEVVRAALRLFEQEETKKTELINELKKGEKSGFAKDFNRESFLNNLHEKH. 79
279 7.000e-21gi|491046326|ref|WP_004907981.1| hypothetical protein [Providencia rettgeri]  clstr ali  40  1MARTTSVTIGAQLDEFVNQLISSGRYGSTSEVVRSALRLLEAQEKQTAALKMLIDAGEKSGESSLTLHDIAKKVKNAHNV 80
280 7.000e-21JGI.Meta 7047405889 SRS015794_Baylor_scaffold_33790__gene_69698 putative addiction module antidote protein, CC2985 family [Human Stool micro  ali  34  2..KTTSVALGTYFEDFIKVKIAQGRYNNASEVVRAALRLLEENESRLIELKNAIKEGIESGEAEDFDPDRHLAAMKSKRV 79
281 7.000e-21gi|738919374|ref|WP_036806178.1| antitoxin [Photorhabdus luminescens]  clstr ali  72  1MARVTSVTLGEHFNRFVGDMIQSGRYGNTSEVIRDALRLMEAREQSIQNVREMVLAGLNSPVSKNSMDDIFVMATKDLNV 80
282 7.000e-21gi|971092334|emb|CRI67031.1| putative addiction module antidote protein, CopG/Arc/MetJ family [Thiocapsa sp. KS1]  clstr ali  35  1MARTQTITLGDHWNDFVVTLVESGRYASVSEVIRDSLRLLQEQEARLEALRQALIEGENSAPAGPLDMEAIKRRGRQ... 79
283 7.000e-21gi|651773685|ref|WP_026632995.1| antitoxin [Dyadobacter alkalitolerans]  clstr ali  33  1MPKNTSISIGQHFDSFIQNQVNSGRYASTSEVVRAGLRXXXXXXXXXXXXRQALIDGEQSGWVENFDPEKFKAGLKRR.. 78
284 8.000e-21gi|654759484|ref|WP_028214535.1| antitoxin [Paraburkholderia mimosarum]  clstr ali  33  1MSKSTSFTLGEHFSEFVDDRVRSGRYSTASDVVRAGLRLLETEEARLEALRNALIEGEQSGASRPFDFRRYVAGKRNKAA 80
285 9.000e-21gi|938283282|gb|KPQ17933.1| toxin-antitoxin system CC2985 family antidote component [Rhodobacteraceae bacterium HLUCCO18]  clstr ali  35  1MGKNTSVSLGDHFAGFIEEKVKEGRYGSASDVIRAGLRLLEEEEVKLARLKELIAEGEASGVAREWDAEWIAEARKR... 82
286 9.000e-21gi|1001207510|gb|KXO94626.1| antitoxin ParD1 [Tsukamurella pulmonis]  clstr ali  34  1MATNTSISLDDHMTEFLAREVATGRYRSASEVVRAGLRMLEDHETRMATLRGALIEGEEGGTPEAFDFDEFIAAKK.... 76
287 9.000e-21 [KEGG:K07746]|[COG3609] Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain  ali  32  12..KTTSVALGVYFEDFIKAKIAQGRYNNASEVIRAGLRLLEENESRLTELKAAIREGVDSGVAEEFDPEEHLKTLKAKRA 89
288 9.000e-21gi|497284531|ref|WP_009598748.1| antitoxin [Alistipes sp. HGB5]  clstr ali  32  2..KTTSVALGVYFEDFIKAKIAQGRYNNASEVIRAGLRLLEENESRLTELKAAIREGIDSGVAEGFDPEDHLKTLKAK.. 77
289 1.000e-20gi|495256185|ref|WP_007980940.1| addiction module antitoxin [Pseudomonas sp. GM33]  clstr ali  18  7.....TITVTDQQDHWIKAQIEAGHYTNDSEYIRDLIRREQERSAELETIRAALREGEASGKPRPFDPVAFKQRMLTAH. 80
290 1.000e-20gi|406896972|gb|EKD41076.1| hypothetical protein ACD_74C00058G0002 [uncultured bacterium]  clstr ali  29  1MPKNTSVTIGNHYEKFIAQQVAQGRFGSASEAIRAGLRLLEERETKLSLLRRALKEGEESGIAEYSLKGLLEEL...... 74
291 1.000e-20JGI.Meta 7008676733 C2502890__gene_201604 putative addiction module antidote protein, CC2985 family [Human Stool microbiome from visit numbe  ali  30  13..KTTSVALGVYFEDFIKAKIAQGRYNNASEVIRAGLRLLEENESRLTELKAAIREGIDSGVAEGFDPAEHLRTLKAKRA 90
292 1.000e-20gi|520792036|ref|WP_020291737.1| MULTISPECIES: hypothetical protein [Pseudomonas]  clstr ali  21  7.....TITVTDQQDTWIKAQIEAGRYTNDSEYIRDLIRREQERSAEIEGIRLALIEGESSGEPRPFNAEDFKQRMLKAH. 80
293 1.000e-20gi|445066517|gb|AGE14096.1| putative uncharacterized protein [uncultured prokaryote]  clstr ali  21  7.....TITLTDKQDSWIRAQIDAGHYTNDSEYIRDLIRREQERNSETEAVRAALIEGEASGEPGHFNADAFKQKMLTAH. 80
294 1.000e-20gi|657917021|ref|WP_029618870.1| antitoxin [Rhizobium sp. MGL06]  clstr ali  25  1MA-TMNVSLPEKMKDWAEDQARSGGYSNVSDYVRDLIRRDQERSEKVAAMQRLVDEGLASGLGGRSAAALFDEAKTRA.. 77
295 1.000e-20gi|670497686|ref|WP_031445645.1| antitoxin [Arenibacter algicola]  clstr ali  30  1MSKNTSISLGNHFEEFVNDEVKSGRYSSVSEVIRSALRLLEHEEKKERELIKALEIGERSGFVDNFDPEQHLKDLHQRHL 80
296 1.000e-20gi|913733936|ref|WP_050479163.1| addiction module antitoxin [Herbaspirillum rhizosphaerae]  clstr ali  20  7.....TITLTDKQDSWIKAQIDAGHYTNDSEYIRDLIRREQERSVELEAIRAALIEGESSGEPRPFDVGAFKQRMSAKH. 80
297 1.000e-20gi|640632846|ref|WP_025060842.1| hypothetical protein [Sulfitobacter donghicola]  clstr ali  25  1MA-TMNISLPDTMKNWVETQAQNGLYANSSDYVRDLIRRDQSRAQIIGDVQAALDAGRASGPATAFDAQAFKQSLK.... 75
298 1.000e-20gi|1018803333|gb|AMY72192.1| antitoxin protein ParD-4 (plasmid) [Defluviimonas alba]  clstr ali  22  3...TMNISLPEQMKAWVESRTEHGRFANSSDYMRDLIRRDQARQLAVATLQAAIDDGMSSGPAEVFDPEAFLRARRR... 76
299 1.000e-20gi|504511329|ref|WP_014698431.1| addiction module antidote protein, CC2985 family [Pectobacterium sp. SCC3193]  clstr ali  37  1MPRTTSITIGEQLDDFVSKLIDSGRYSSTSEVIRSALRLLEQQESKTEALKKAIYAGEQSGESSLTLREIAAKKEAR... 77
300 2.000e-20gi|490575386|ref|WP_004440406.1| MULTISPECIES: antitoxin [Rhizobium/Agrobacterium group]  clstr ali  25  3...TMNISLPGQMKEWVEAQSKTGRYSNASDYVRDLIRKDQERSEKIAAMQGLVDEGLQAPSGHRSEDALFAEAEAR... 76
301 2.000e-20gi|973773923|gb|KUM53293.1| antitoxin [Rheinheimera sp. EpRS3]  clstr ali  40  1MARTTSVTIGTQLDDFVSKLLESGRYGSTSEVMRSALRLLERQENQMAALRQAVAAGEQSGESDLTLSQIADRVKQKHHV 80
302 2.000e-20gi|150960643|gb|ABR82668.1| putative addiction module antidote protein, family [Pseudomonas aeruginosa PA7]  clstr ali  25  30MS-TMNISLPDTLKSFVDEQVSQRGYGTSSEYVRELIRKDQDR----QRLRGLLIAGAESMPAAPADDDYFESLRTRVH. 103
303 2.000e-20gi|495040944|ref|WP_007765803.1| antitoxin [Rhizobium sp. CF080]  clstr ali  26  1MGKMTSITVDEELTAFIDRQVNGGNYSSASEVVEAALRLLRDSEDGIEAIRAAIEEGEASGEPQPFDFDEFIEKKRAARA 80
304 2.000e-20gi|1011762939|ref|WP_062586387.1| MULTISPECIES: antitoxin [Rhizobium]  clstr ali  18  1MAKSAQITLNDELGDFVDRQVRDGNYASANDVVEAGLRLLREDDAKLEVLKAALIEGEESGEPIEFDFDSFLQHMRAKHA 80
305 2.000e-20gi|491647524|ref|WP_005505050.1| antitoxin [Grimontia hollisae]  clstr ali  40  1MAKNTSITLGEHFDSFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLVEGEQSDDADYDIDSFVNELDSE... 77
306 2.000e-20gi|490364728|ref|WP_004244397.1| MULTISPECIES: antitoxin [Enterobacteriaceae]  clstr ali  65  1MARVTSVTLGEHFNDFVGSMINSGRYGNTSEVIRDALRMMEIREERLQLVRKMVLDGVNSLESKNDMDDIFARAEKDLNV 80
307 2.000e-20gi|498912354|ref|WP_010847554.1| hypothetical protein [Xenorhabdus nematophila]  clstr ali  41  1MRKITSFSMGEQLDGFVQRMIESGRYGSTSEVMRSALRLLEQQENQDEAIRNAVIDGLNSGKSSLTLRDIAEQRKRQR.. 78
308 2.000e-20gi|769879306|ref|WP_045021048.1| antitoxin [Rhizobium nepotum]  clstr ali  22  3...TMNISLPGPMKEWVEAQSKTGRYSNASDYVRDLIRKDQERGEKIAAMQRLADEGLKSGVGLRSQDALFAEAKAR... 76
309 2.000e-20gi|769948098|ref|WP_045081386.1| addiction module antitoxin [Vitellibacter vladivostokensis]  clstr ali  29  1....MNVSLTEKQRKYIDDKVASGDYMNASEVVREALRLHEINHQKLENLRKEIQKGIDSGISPYSMKDILEEKKRKYN. 75
310 2.000e-20gi|970456335|ref|WP_058736543.1| hypothetical protein [Novosphingobium barchaimii]  clstr ali  21  1MA-TMNISLPDQMKSWVEAQSIDGRYSNASDYVRDLIRRDQVRSEKIANMQRLLDEARASGISDDTMDDIWKRVRTRAG. 78
311 2.000e-20gi|498207365|ref|WP_010521521.1| antitoxin [Aquimarina agarivorans]  clstr ali  30  1MEKNISISLGNHFENFIREEVNSGRYGSVSEVIRSALRLLEHEEKKERELIKALEVGENSGFVENFDPKLHLKELHSKHL 80
312 2.000e-20gi|577001389|emb|CDH46225.1| Antitoxin ParD [Candidatus Contendobacter odensis Run_B_J11]  clstr ali  31  3MQKNTSVTLDAHFENFIGQQVSEGRFGSASEAIQAGLRLLEEREIKLAALRQALKAGAESGKTDYSLKGLLDELDKE... 79
313 2.000e-20gi|653020844|ref|WP_027272745.1| antitoxin [Leminorella grimontii]  clstr ali  43  1MPRTTSITIGEQLDEFVSRMIASGRYGSTSEVVRSALRLLEQKESQMDALRKAVLAGEQSGESELTLREIAARIKQKYGV 80
314 2.000e-20gi|930459814|ref|WP_054207442.1| antitoxin [Bosea vaviloviae]  clstr ali  38  1MGKNTSVSLSDHFTAFVEAEVESGRYGSASEVVRAGLRLLEESEARLAALRAALDEGEVSGPSTPFDFDAFIAKK..... 75
315 3.000e-20gi|635637015|ref|WP_024283910.1| antitoxin [Algoriphagus marincola]  clstr ali  32  1MSKNTSISLGNHFEEFIREEVDSGRYSSASEVIRAALRLLESEEKKERHLIRALQEGEDSGFVEDFEPEYLKKIQKKAH. 80
316 3.000e-20gi|16421506|gb|AAL21835.1| putative transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain and a metal-binding domain [Salmonella  clstr ali  35  24MARTMTVDLGDELREFIESLIESGDYRTQSEVIRESLRLLREKESRLQALRELLAEGLNSGEPQAWEKDAFLRKVK.... 101
317 3.000e-20gi|190013390|emb|CAQ47024.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]  clstr ali  23  21MA-TMNISLTDPLKQFVDEEVREGGYSSTSDYVRDLIRQRQ-RSKAEELLKQLIAEGLASGPSAPLAPDHFDKLRERAR. 97
318 3.000e-20gi|551328786|ref|WP_022948229.1| antitoxin [Methylohalobius crimeensis]  clstr ali  17  1MA-TMNVSLPDPMKDWVEARVKGGKFANSSDYIRDLIRRDQLYQEKRHVLVQALIEGEESGPAGKLDMEEIKQKARQKA. 78
319 3.000e-20gi|493217574|ref|WP_006199648.1| antitoxin [Mesorhizobium amorphae]  clstr ali  25  1MA-TMNVSLPDPMKDWVEGQAKTGRYANASDYVRDLIRRDQERNDKIAAMKRFVDDGLKRGAGKRSRETLFAEAAKRAE. 78
320 3.000e-20gi|640721674|ref|WP_025144776.1| antitoxin [Sphingobacterium sp. H1ai]  clstr ali  31  1MGRNTSMALGDHFENFVDERISEGRFKNVSEVIRAGLRLLEDEENKIKILREALQVGIDSGMVKDFDPKKHLEMLKAKK. 79
321 3.000e-20 FMSKG9S01B9Z1T|FMSKG9S01B9Z1T|metagene|gene_1  ali  33  3...TTSVALGVYFEDFIKAKIAQGRYNNASEVIRAGLRLLEENESRLTELKAAIREGIDSGVAEGFDPEDHLKTLKAK.. 77
322 3.000e-20gi|653743382|ref|WP_027672276.1| antitoxin [Rheinheimera baltica]  clstr ali  31  1MA-TMNVSLPDGMKHWVEQQAQTGRYSNASDYVRDLIRRDQERAAKVAHLQQLVDEGVNSDRGNRTMAQLEAAAMAK... 76
323 3.000e-20gi|496325852|ref|WP_009035030.1| antitoxin [Indibacter alkaliphilus]  clstr ali  34  1MSKNTSVTLGSHFEDFFNKQIQKGRYGSTSETVRAALRLLEEKEVKLDLLRKAIIEGEESGRAEYSLESFLEKWM..... 75
324 3.000e-20gi|746409778|ref|WP_039451266.1| antitoxin [Pedobacter glucosidilyticus]  clstr ali  27  1MAKNTSILLGDYFEKFINEQVQTGKFSSASEVVRAALRMFEHEETKKTELIKELVKGEKSGFVKNFSRDTFLDNLHQKHV 80
325 3.000e-20gi|503602045|ref|WP_013836121.1| CopG family transcriptional regulator [Thioalkalimicrobium cyclicum]  clstr ali  25  1MA-TMNISLPDKMKDWVEESVQTGLYANASDYVRDLIRQD---HQKMAALRQALIEGEKSGFACEFDIEAFINTKKQAA. 75
326 4.000e-20gi|946961459|ref|WP_055883120.1| MULTISPECIES: hypothetical protein [Devosia]  clstr ali  27  1MA-TMNISLPDKMKQWVEEQVATGRYANASDLMRDIIRERQEKSAAIARLQAEIDKGRASGISDKSVDEIFAEARKKA.. 77
327 4.000e-20gi|491057040|ref|WP_004918681.1| hypothetical protein [Acinetobacter junii]  clstr ali  38  1MARTTSVTIGTQLDDFVAELIDSGRYGSTSEVVRSALRLLERQENQTIALKKAIEDGEKSGESRLTLRDITAQIKNKHNV 80
328 4.000e-20gi|780831563|gb|KJS34162.1| addiction module antitoxin [Rhodospirillaceae bacterium BRH_c57]  clstr ali  22  1MA-TMKVSLPDSVNAWVETQAESGQYCNACDYARDLIRKDQERCKAIATVQAAITEGFESGDPQPLNAAAFKLRMRERYV 79
329 4.000e-20JGI.Meta 7056872597 C2598603__gene_269173 putative addiction module antidote protein, CC2985 family [Human Stool microbiome from visit numbe  ali  35  2..KTTSVALGAYFENFIQSTIAQGRYNNASEVVRAGLRLLEEQESRIVALKSAIDEGLGSGVATEFDPEQHLRALK.... 75
330 4.000e-20gi|759566109|ref|WP_043285509.1| antitoxin [Reyranella massiliensis]  clstr ali  26  1MVRNVSFSLDDHAAEFIDAQVQTGRYDSASDVVQADLRLLEKHEASVHALQSALVAGEESGTPAPFDSKGFLKRMRAKYV 80
331 4.000e-20gi|738601453|ref|WP_036511917.1| antitoxin [Oceanicaulis sp. HL-87]  clstr ali  29  1MSRNTSIALNAHLAAYIDEQVATGRYGSASEVVRAGLRLLQERDAQLAALRGALEHGERSGPATAITSAEFLQGMKARA. 79
332 4.000e-20gi|764526464|ref|WP_044406749.1| CopG family transcriptional regulator [Thioalkalimicrobium microaerophilum]  clstr ali  27  1MA-TMNISLPDQMKNWVEESVQSGLYANASDYMRSLIRQD---HLKMAQLRQALVDGENSGTPTEFDFNAFVAAKKA... 73
333 4.000e-20gi|753208555|ref|WP_041514536.1| antitoxin [Nitrosospira sp. NpAV]  clstr ali  34  5..KNTSVTLGEHFEKFLAYQIESGRYGSASEAIRAGLRLLEERETKLEALCRALTEGERSGIADYSLQNILDELESE... 79
334 5.000e-20gi|736984236|ref|WP_034980432.1| antitoxin [Epilithonimonas tenax]  clstr ali  32  2..KNTSVSLGNYFDQFVSSQVSIGRYKNVSEVIRAGLRLLENEESKVIALKSAIQQGLDSPRVENFDFDEHLSKLK.... 75
335 5.000e-20gi|491340320|ref|WP_005198275.1| hypothetical protein [Acinetobacter sp. NIPH 298]  clstr ali  37  1MARTTSITIGAELDDFVAQLITTGRYGSTSEVVRSALRLLERQENQNIALKQAIEAGERSGESHLSLQDIATQIKQKHHV 80
336 5.000e-20gi|497466825|ref|WP_009781023.1| antitoxin [Leeuwenhoekiella blandensis]  clstr ali  34  1MGKNTSISLGSHFEDFVNEEVKSGRYSSVSEVIRSALRLFEHEELKERELIKALEAGEQSGFVDDFDSEKKLEALHKK.. 78
337 6.000e-20gi|489921931|ref|WP_003825282.1| MULTISPECIES: antitoxin [Citrobacter freundii complex]  clstr ali  42  1MPRTTSITIGEHLDRFINEMIESGRYGSTSEVVRSALRLLEEQELRNNALRDALEDGIHSGTSDLTLQEVAHRKKRSLNV 80
338 6.000e-20gi|503402607|ref|WP_013637268.1| MULTISPECIES: antitoxin [Agrobacterium]  clstr ali  28  1MA-TMNVSLPDPMKDWVEAQAKTGRYSNASDYVRDLIRRDQARTDKIAEMQRFVDDGIRSGVGSRSTEELFALATSRA.. 77
339 6.000e-20gi|737246774|ref|WP_035230988.1| antitoxin [Alcanivorax sp. 19-m-6]  clstr ali  26  3...TMNVSLPEAMKKWVEQQSATGRYSNSSDYIRDLIRQDQEKKAKIARLQELVSEGLNSGTGSRSMSELKDQAIA.... 75
340 6.000e-20 GL0047127 [Complete] locus=scaffold63937_3:449:772:+  ali  31  22..KTTSVALGDYFENFIRTNVERGRYNNASEVIRAGLRLLEENECRLVQLKSAIKAGEDSGIACDFSPEEHLKELKAA.. 97
341 6.000e-20gi|973981164|emb|CUB00187.1| putative addiction module antidote protein, CC2985 family [Thiomonas bhubaneswarensis]  clstr ali  25  15MS-TMNISLPDTLKSFVDEQVSQRGYGTSSEYVRELIRKDQERLQ----LRSLLLAGAASAPTAPADVGYFDGLRDRVR. 88
342 6.000e-20gi|946728149|ref|WP_055754014.1| addiction module antitoxin [Brevundimonas sp. Leaf280]  clstr ali  24  1MA-TMNISLPGPMKAWVEEQAKSGRYANTSDVVRDLIRREQVKAEKIANMQRLIDEAYASGISDQTPREIFEEVRAEYLA 79
343 6.000e-20gi|517685931|ref|WP_018856139.1| antitoxin [Rhizobium sp. 42MFCr.1]  clstr ali  33  1MA-TMSVSLPDPMKDWVEAQAKTGRYSNASDYVRDLIRRDRARTNKIAEMQRFFDDGIKSGVGGRSKDELFSAAVARAE. 78
344 7.000e-20gi|506316041|ref|WP_015835816.1| antitoxin [Photorhabdus asymbiotica]  clstr ali  40  1MARTTSVTIGEYLDNFITRMIQNGRYGSTSEVVRSALRLLEQQEYKIDSLREAIEQGELSGESSLTLKDIAEQKKRSLNV 80
345 7.000e-20gi|501090465|ref|WP_012140687.1| MULTISPECIES: transcriptional regulator [Marinobacter]  clstr ali  33  1MQKNTSITLGQHFDAFIAEQLKNGRYSSTSEVVRAALRLLEESETRLTTLRKLLKEGEDSGFEDYSYDSFIRELDNE... 77
346 7.000e-20gi|497411619|ref|WP_009725817.1| hypothetical protein [Methylophaga lonarensis]  clstr ali  32  1MQKNTSITLGKHFDSFIAEQLKSGRYSSTSEVVRAGLRLLEESETRLNTLRKMLKDGEAGGFEDYSYQSLLDELDNEQR. 79
347 7.000e-20gi|446057191|ref|WP_000135046.1| antitoxin [Salmonella enterica]  clstr ali  80  1MARVTSVTLGEHFNGFVGEMIESGRYGNTSEVLRDALRLMEAREQRVQNVREMVLAGVNAPVSQRSMEEIFAAAVKNANV 80
348 8.000e-20gi|504566189|ref|WP_014753291.1| addiction module antitoxin [Tistrella mobilis]  clstr ali  27  1MA-TMNVSLPDAMKAWVEGQVDGGRYGDASDYVRDLIRRDRARKEAIAALQTAVTDGTDSGEPQALDVEAFKLRMRDRHL 79
349 8.000e-20gi|739406121|ref|WP_037266629.1| antitoxin [Roseivivax halodurans]  clstr ali  27  1MA-TMNVSLPDPMKTWVEQQTAQGRYANASDYVRDLIRRDQARSDAIARMQGLVDEGLRSGDGSRSMAEIKAQARRRAGL 79
350 8.000e-20gi|494950345|ref|WP_007676373.1| antitoxin [Caulobacter sp. AP07]  clstr ali  31  1MSKNTSVSLGDHFQTFIEAQMADGRYGSASEVVRAGLRLLENHEARMAALRATLNKGVESGFIDDFDFDAFIEERNRKA. 79
351 8.000e-20gi|973336193|gb|KUL96046.1| antitoxin [Bosea sp. WAO]  clstr ali  23  1MA-TMNISLPASMKEWAEAQTETGRYANTSDYVRDLIRRDQDRNDKIAAMQRFVDEGVRSGAGTQSSDALFATALKR... 76
352 9.000e-20gi|970524179|ref|WP_058798966.1| CopG family transcriptional regulator [Pseudoalteromonas rubra]  clstr ali  26  3.SRTMTVDTGEELRAFVEGLVESGDYKTNSEVIRDGLRLLQEKTAKLAALRQLIDEGEQSGEAVPWDRDSFLARMRQKG. 82
353 1.000e-19gi|653080643|ref|WP_027331207.1| hypothetical protein [Marinimicrobium agarilyticum]  clstr ali  17  1MA-TMNISLPDPMKSWAEQQAKTGKYSNTSDYVRDLIRKDQEKAEKIAHLQGLVDQGLSSGPGS-ADMKTLKDIARKA.. 76
354 1.000e-19gi|550953655|ref|WP_022702049.1| antitoxin [Oceanicaulis alexandrii]  clstr ali  26  1MA-TMNVSLPDAMKAWVEAQTEDGRYSNASDYVRDLIRRDQDRHTKINHMQTLVTEALESGEGSRTLDELRAAALSQLNA 79
355 1.000e-19gi|472146513|emb|CCV03260.1| hypothetical protein MESS2_1030117 [Mesorhizobium metallidurans STM 2683]  clstr ali  26  3...TMNISLPDSLKHFVDRQVADRGYGTSSEYVRELIRHDQDR----QRLRGLLLEGASSAPGTPVDDDYFAALRKRA.. 73
356 1.000e-19gi|493575231|ref|WP_006528381.1| addiction module antidote protein, CC2985 family [Gloeocapsa sp. PCC 73106]  clstr ali  31  1MQKNTSVTLGEHFDEFIAIQIDRGRFASASEAIRAGLRLLEEHETKLLALQRALEEGENSGFVEYSLHGLLEELDKEQSA 80
357 1.000e-19gi|495881743|ref|WP_008606322.1| MULTISPECIES: CopG family transcriptional regulator [Alishewanella]  clstr ali  22  1MA-TMNVSLPDSMKQWVELQAKDGRYSNASDYVRDLIRRDQEQAAKIAQLQQRVTEGLASGTGERTMVQLAAEAMARMGA 79
358 1.000e-19gi|924282832|ref|WP_053470152.1| antitoxin [Flavobacterium sp. VMW]  clstr ali  26  1MPKNTSILLGDYFDNFINSQVKTGRFSSASEVIRAALRMFEEEETKKSELIKELKKGEKSGFVKDFDRASFL........ 72
359 1.000e-19gi|906868680|ref|WP_049727110.1| hypothetical protein [Wenzhouxiangella marina]  clstr ali  27  1MA-TMNVSIPEEMKRWVEDQRKTGRFGNSSDYVRDLIRRDQERQAKIADLQALVKEGVESGPSEMTMSDLLQAARKQA.. 77
360 1.000e-19gi|493293047|ref|WP_006250727.1| antitoxin [Mannheimia haemolytica]  clstr ali  40  1MSRTTSVTLAEPLSQFVNQMVESGRYGSTNEVISAALKILEAQEQQLIQLRALIDEGLESGVSEETVQSIISKAKAKRNV 80
361 1.000e-19gi|762038351|ref|WP_043874288.1| CopG family transcriptional regulator [Legionella massiliensis]  clstr ali  28  1MTGTMTVDLGNELRNYVESLVSSGDYRSNSEVLRESLRLLREKESKLEQLRHLIDEGDASGKPETWDAHDFLKKMKKKSL 82
362 1.000e-19gi|648664013|ref|WP_026355760.1| antitoxin [Pannonibacter phragmitetus]  clstr ali  26  1MA-TMTVSLPDPVKEWMEEQARTGHYANASDYVLDLIRKDQERSNKIAAMQRHVDEGLQSGLGSRLKEELFAAALTRTAA 79
363 1.000e-19gi|489021353|ref|WP_002931846.1| MULTISPECIES: addiction module antidote protein, CC2985 family [Thauera]  clstr ali  24  7.....TITLTDQQDNWVKAQINAGHYTNDSECIRDLIRREQERSAEIEAIRAALIEGEASGEPRRFDAAAFKQRM..... 76
364 1.000e-19gi|497227609|ref|WP_009541871.1| ParD protein (antitoxin to ParE) [Caenispirillum salinarum]  clstr ali  26  1MA-TMNVSLPDPMKDWVEAQARTGRYSNASDYVRDLIRRDQERAAALAELQALVTEGINSGISSRTTDDVWEGVRRR... 76
365 1.000e-19gi|516566086|ref|WP_017941272.1| MULTISPECIES: hypothetical protein [Thioalkalivibrio]  clstr ali  26  1MA-TMNVSLPDPMKNWVEKQAESGRYSNASDYVRDLIRHDQERAEKVERMQTFVKEALESGPGQHSMEELRERAARQ... 76
366 2.000e-19gi|809271592|emb|CEJ14856.1| Antitoxin ParD4 [bacterium YEK0313]  clstr ali  29  1MA-TMNVSLPDPMKDWVEAQARSGRYANASDYVRDLIRRDQERNDRIAAMQRLVDEGLKSGIGDRTADDLFAAALARA.. 77
367 2.000e-19gi|496237589|ref|WP_008950974.1| antitoxin [Alishewanella jeotgali]  clstr ali  40  1MARTTSVTIGAQLDDFISELIATGRYGSTSEVVRSALRLLERQEKQMVALRQAVLAGEQSGASDLTLSQIAAQVKQKHN. 79
368 2.000e-19gi|495168626|ref|WP_007893423.1| MULTISPECIES: CopG family transcriptional regulator [Pantoea]  clstr ali  29  1MARTMTIDLGDELREFVESLVESGDYRTQSEVVRDSLRLLREKESKLENLKKLIQQGLDSGVAEDWDGETFLKKMRAR.. 80
369 2.000e-19gi|516262389|ref|WP_017666352.1| CopG family transcriptional regulator [Porphyrobacter sp. AAP82]  clstr ali  22  1MS-TMNISLPDTLKSFVDQQVSTRGYGTSSEYVRELIRKDQD----IQKLRGLLLDGAASAPTAPADETYFAGLRAR... 72
370 2.000e-19gi|589608450|gb|EXI80006.1| Antitoxin ParD1 [Candidatus Accumulibacter sp. BA-92]  clstr ali  34  9..RNTSVTLGEHFEGFIAQQIGAGRFESKSEVVRAAMRLLEEHEQKVSALRQALVEGETSGEPVPFAMASIIEEARQ... 83
371 2.000e-19gi|550982846|ref|WP_022730945.1| CopG family transcriptional regulator [Thalassospira lucentensis]  clstr ali  31  1MA-TMNVSLPDPMREWVETQIESGEYASSSDYVRDLIRQDQ-RKQKL--LQRALTEGLNSGQSPRTVEDIMDAAHK.... 72
372 2.000e-19gi|928925887|ref|WP_053950814.1| addiction module antitoxin [Candidatus Thioglobus autotrophica]  clstr ali  28  1MLRKT-ITVTEQQNSWIKSQIESGQYGNDSEYMRDLVRKDQEYNQKLSALQVALKEGEDSGESTLSMNDILIKVKK.... 75
373 2.000e-19gi|521252424|ref|WP_020438989.1| MULTISPECIES: CopG family transcriptional regulator [Serratia]  clstr ali  38  1MPRTTSVTIGEQLDAFVSRLVESGRYGSTSEVMRSALRLLEQKEYHIETLRLALENGERSGESALSLREIAAKKKREHNV 80
374 2.000e-19gi|656055434|ref|WP_029093816.1| addiction module antitoxin [Budvicia aquatica]  clstr ali  33  3....TSISLSPHFENFIQEQIKSGRYNNVSEVIRAGLRELEEQERKLEILQAAVAAGIGSGESIP-AETVFDRLQQKYH. 78
375 2.000e-19gi|668920904|gb|KFC50425.1| antitoxin [Halomonas sp. SUBG004]  clstr ali  26  2.......TLGPHFDEFIATQVEKGRYGSVSEVVRAGLRLLEETESKLERLQRLLDEGEQSGIAEYSLESVITELDNEAH. 73
376 2.000e-19gi|494833990|ref|WP_007560412.1| antitoxin [Methylobacterium sp. GXF4]  clstr ali  35  1MAKNTSVSLGDHFAGFIDRQVADGRYGSASEVVRAGLRLLEEHEVRIAALQAALIAGEESGPAEELDSPAFLREMRAK.. 78
377 2.000e-19gi|655487346|ref|WP_028868876.1| antitoxin [Psychromonas arctica]  clstr ali  45  1MSRTTSVTIGESLNGFVGKMVKSGRYGSTSEVMRSALRLLEQEENQLNLLRKAVEEGENSGVCDLSLKEIATRKKAMLRV 80
378 2.000e-19gi|973239300|ref|WP_059100462.1| MULTISPECIES: antitoxin [Mycobacterium]  clstr ali  32  1MGRNTSFSLDDHYNAFIEDEVASGRYRSASDVVRAALRLLEDRETRLRALRQSLIVGERSGASTAFDFDEFVSRKRA... 77
379 2.000e-19gi|552167909|ref|WP_022987704.1| hypothetical protein [Marinobacter sp. ES-1]  clstr ali  33  1MA-TMNISLPEAMKHWAELQAQSGRYSNTSDYVRDLIRKDQDRLRKVEELQALVTAGIASGPGTRSMDELRAVAKK.... 75
380 2.000e-19gi|1011649735|ref|WP_062499642.1| antitoxin [Gluconobacter oxydans]  clstr ali  34  7..RATSVILGDYYQGFVNAQINAGRYGSTSEAIRAGLRLLEEHDTEIEQIRRALIAGEESGPCTPIDRDAFK........ 76
381 3.000e-19gi|930002284|ref|WP_054107769.1| addiction module antitoxin [Novosphingobium sp. AAP83]  clstr ali  24  1MA-TMNISLPDPMKQWVEAQAETGRYSNVSDYVRDLIRREQERGDKIAQMQRLVDEARASGISDLTMADIRALALKQAGL 79
382 3.000e-19gi|1015519135|gb|AMV73452.1| Antitoxin ParD1 [Desulfuromonas sp. DDH964]  clstr ali  36  1MGKNTSVTLGEHYERFISHAIEEGRYGSTSEAIRAGLRLLEERETRLEVLRRALVEGEQSGMADYSLDALNRELDKELG. 79
383 3.000e-19gi|951443254|ref|WP_057815872.1| hypothetical protein [Roseovarius indicus]  clstr ali  23  1MA-TMNVSLPDHMKTCVEARAKGGQYSNVSDYVRDLIRKDLERQQAIGELQGMIEEGLRSGEPQAFDMAGFIDRKTR... 76
384 3.000e-19gi|974213024|gb|KUO54584.1| antitoxin [Sphingomonadales bacterium BRH_c42]  clstr ali  23  1MGKNTSISLTERHQEYLRAKVESGEFASASEVVREALRRAEERDRKREALDRAIQEGLDSGPPQPFDFDEFLKEMRA... 77
385 3.000e-19gi|647728954|ref|WP_025977750.1| hypothetical protein [Brevundimonas naejangsanensis]  clstr ali  22  3...TMNISLPDPMKAFVDEQVAERGYGSSSEYVRDLIRKDGDRQK----LRSLLLVGAESGPTGPADGAYFESLRAR... 72
386 3.000e-19gi|749007191|ref|WP_040066520.1| addiction module antitoxin [Pseudomonas batumici]  clstr ali  22  7.....TITVTDQQDGWIKAQIDAGRYTNDSEYIRDLIRRDQGRSAELEAIRAALIDGESSGEPRRFNADEFKKRMLTAH. 80
387 3.000e-19JGI.Meta 7007522810 C2611291__gene_247795 putative addiction module antidote protein, CC2985 family [Human Stool microbiome from visit numbe  ali  32  2..KTTSVALGTYFENFIQSKISQGRYNNASEVIRAGLRLLEEDESRVIALKNAIEDGIDSGVAANFDPAKHLSSLKAQK. 78
388 3.000e-19gi|736898371|ref|WP_034897324.1| antitoxin [Erwinia typographi]  clstr ali  42  1MARTTSVTIGEQLDSFVSQLIDSGRYGSVSEVMRSALRLLEQQETSNEAVRQAVVKGLESGESTLSLHDIAEQRKRMQRV 80
389 3.000e-19gi|654479245|ref|WP_027949335.1| antitoxin [Haliea salexigens]  clstr ali  34  1MARNTSVTLGDHFEAFITSKIEQGRFQSVSEAVRAGLRKLEEDEARLDMLRTRLRAGEDSPVAENFDSREFLEKLHKK.. 78
390 3.000e-19gi|820887443|ref|WP_046793612.1| antitoxin [Rhizobium sp. LC145]  clstr ali  28  1MA-TMNISLPNPMKDWVEAQVRTGRYSNASDYVRDLIARDQARSDKTTTTQHFVEEGFGSGVGSRSKDELF......... 70
391 4.000e-19gi|960856531|ref|WP_058335220.1| addiction module antitoxin [Phaeobacter sp. CECT 5382]  clstr ali  14  3...TIDISLPDPMKAWVETQAEQGSYSDTSDYVQHLIRREQNRQQALDRLQTAVTDGLQSGAATPFDMGAFKTRMQEAH. 78
392 4.000e-19gi|654760597|ref|WP_028215555.1| hypothetical protein [Paraburkholderia mimosarum]  clstr ali  22  3...TMNISLPDSLKEYVDEQVGQGGYGTSSEYVRELIRKDQDRK----RLRGLILQGAASGLADPVDSKYFESLRVRVR. 74
393 4.000e-19gi|643374809|ref|WP_025203205.1| addiction module antitoxin [Enterobacter cloacae]  clstr ali  38  3....TSVALTPHFEAFIREQIESGRYNNTSEVIRAGLRALEEREQKLESLQEAIIAGINSGES-KSAEEVFGRLTHKYK. 78
394 4.000e-19gi|959934627|ref|WP_058192547.1| hypothetical protein [Methylobacterium sp. GXS13]  clstr ali  25  1MA-TMNVSLPDPMKAWVEAQAETGRYANASDYVRDLIRRDQDRLAKLGDLQRRIDEGLASGVSGRSEEEIRQLGRERLAA 79
395 4.000e-19gi|510825950|ref|WP_016199107.1| hypothetical protein [Elizabethkingia meningoseptica]  clstr ali  27  1MAKNTSILLGDYFENFINQQIKSGKFSSTSEVVRAALRMFEYEETKKSELINELKQGEKSGFVENFDSKAFLNNLHQTH. 79
396 4.000e-19gi|947699481|ref|WP_056361938.1| CopG family transcriptional regulator [Burkholderia sp. Leaf177]  clstr ali  23  2..TTMNISLPDSLMVYVHEQVGEGRYGSSSEYVRELIRKDQDRKP----LREIILQGAMSGLAAPVDADYFKSLRARVH. 74
397 4.000e-19gi|754020410|ref|WP_041682736.1| CopG family transcriptional regulator [Pusillimonas sp. T7-7]  clstr ali  25  1MS-TMNISLPSTLKTFVDEQVSQRGYGTSSEYVRELIRKDQD----CQKLRGLLLAGAASPPTSPVDSNYFNSLRARVR. 74
398 4.000e-19gi|504423806|ref|WP_014610908.1| antitoxin [Shewanella putrefaciens]  clstr ali  36  1MSRTTSVTIGSQLDEFVSQLISSGRYGSTSEVVRSALRLLERQENQTIALKMAIEAGEQSGECALSLHDIAAMVKQKHNV 80
399 4.000e-19gi|984741863|gb|AMC11385.1| antitoxin [Lutibacter sp. LP1]  clstr ali  28  1MGKNTSISIGNHFEEFIQNEVKSGKYGSVSEVIRSALRLLEREETKEKELIKALKIGEKSGFIENFNPENLKELHRQY.. 79
400 4.000e-19gi|914618083|ref|WP_050610605.1| CopG family transcriptional regulator [Candidatus Burkholderia brachyanthoides]  clstr ali  22  1....MNISLPDSLKDYVDEQVGEGGYGTSSEYVRELIRKDQDSK----RLRAIILQGATSGLTAPVDTKYFEALRARVH. 71
401 4.000e-19gi|666637520|emb|CDH22555.1| Antitoxin ParD [Xenorhabdus bovienii str. kraussei Becker Underwood]  clstr ali  42  4MRKITTVSMGEQLDEFVQRMIKSGRYGNASEVMRSALRLLEQQESHDEVVRKAVIAGLESGESSLTLRDIAEQRKRKHNV 83
402 4.000e-19gi|488158549|ref|WP_002229757.1| antitoxin [Yersinia pestis]  clstr ali  100  12MAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLMEAREQRVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKDTSV 91
403 4.000e-19gi|515695685|ref|WP_017128285.1| addiction module antitoxin [Pseudomonas gingeri]  clstr ali  21  7.....TITVTAQQDGWIKAQIDAGHYTNDSEYIRDLIRREQERSAELEAIRSALMEGEASGEPRPFDADEFKRRM..... 76
404 5.000e-19gi|835854615|ref|WP_047685641.1| addiction module antitoxin [Xenorhabdus sp. NBAII XenSa04]  clstr ali  33  3....TSVSLSPYFEEFIRQQIDSGRYNNTSEVIRAGLRALEEQEQKVESLKSAIMAGIQSGEGKEV-KDVFDRLMKKYG. 78
405 5.000e-19gi|493778216|ref|WP_006726659.1| antitoxin [Agrobacterium albertimagni]  clstr ali  23  1MNKPVQVTIAEPYDSFIDAQVESGEFNSAQEVVEAGLRLLKEEKARIEWLRNALIEGENSGPARPVDRDEFKARMREK.. 78
406 5.000e-19JGI.Meta 7028682455 C2429691__gene_130077 putative addiction module antidote protein, CC2985 family [Human Stool microbiome from visit numbe  ali  32  7..RTTSVALGDYFESFIKAKIAQGRYNNASEVIRAGLRLLEENESRTLDLQNAVAEGFDSGIAEGFDPERHLQHLKARRA 84
407 5.000e-19gi|749006855|ref|WP_040066192.1| addiction module antitoxin [Pseudomonas batumici]  clstr ali  24  1MS-TMNISLPDALKSFVDDQVSPRGYSTCSECVRELIRKDQDR----QHLRGLLLAGAESVPTAPVDGDYFESLRARAN. 74
408 5.000e-19 GL0148101 [Complete] locus=scaffold100260_1:2592:2837:+  ali  32  2..KTTSVALGTYFENFIRSTIAQGRYSNASEVVRAGLRLLEEQENNVVALKNAIDEGLNSGIAAGFDPERHLRTLKMQR. 78
409 6.000e-19gi|657923907|ref|WP_029625381.1| addiction module antitoxin [Sphingomonas sp. PAMC 26605]  clstr ali  29  1MA-TMNISLPDQMKAWVEAQAETGQYGNSSDVVRDLIRKAQSREAKVANMQRLVDEARANGLSNRSVEEIWESAVARHEA 79
410 6.000e-19gi|493759203|ref|WP_006707949.1| addiction module antitoxin [Candidatus Regiella insecticola]  clstr ali  33  3....TSVALSPHFEEFIQKQINSGRYNNVSEVIRAGLRELEDQAQKLEALQSAVTRGINSGEGVP-AEEVFKQLRHKY.. 77
411 6.000e-19gi|736826369|ref|WP_034827951.1| CopG family transcriptional regulator [Enterobacter cancerogenus]  clstr ali  26  1MARTMTIDLGDELREFVESLVASGDYRTQSEVVRDSLRLLREKQAKLENLRRLIQEGMGSGEPIPWDVDDFLR-RAKARA 81
412 7.000e-19gi|655390634|ref|WP_028794455.1| CopG family transcriptional regulator [Thalassobaculum salexigens]  clstr ali  25  1MA-TMNVSLPDPMKHWVEAQARSGRYSNASDYVRDLIRRDQERAADIARLQAVIMEGVESGVAEDFSMEDI......... 70
413 7.000e-19gi|929900041|gb|KPG96137.1| addiction module antitoxin [Pseudomonas sp. RIT-PI-r]  clstr ali  20  7.....TITLTEQQGHWIRAQTEAGNYNNDSEYIRDLICREQKPNTELETIRAAISEGESSGTPRPFDPEAFKKRM..... 76
414 7.000e-19gi|1001934790|gb|KXS53115.1| CopG/Arc/MetJ family transcriptional regulator [Marinobacter sp. T13-3]  clstr ali  28  1MA-TMNISLPEPMKHWAEKQAASGRYANASDYMRDLIRRDQDRQRKIAEMQALVDAGIKSGPGNRSMEELRMHARE.... 75
415 7.000e-19gi|494669398|ref|WP_007427341.1| CopG family transcriptional regulator [Oceaniovalibus guishaninsula]  clstr ali  28  1MA-TMNVSLPDPMKDWVEKQSARGRYANSSDYVRDLIRRDQVRAEAVARMQALVDAGLASGEGTRSMAQIKAEARRRAG. 78
416 7.000e-19gi|950508195|ref|WP_057394653.1| antitoxin [Salmonella enterica]  clstr ali  37  1MGKITTVSIGEQLDGFISRMIKTGRYGSASEVMRSALRLLEKQESCDEALRLAVVEGLESGESELTLRDIATERKRKNRV 80
417 7.000e-19gi|654088499|ref|WP_027714415.1| antitoxin [Desulfuromonas sp. TF]  clstr ali  34  1MGKNTSVTLGDHYEKFISRAIEDGRYGSTSEAIRAGLRLLEERETKLGILRRALVQGEQSGTVDYSLDALNRELDEDLG. 79
418 8.000e-19gi|496439028|ref|WP_009147873.1| addiction module antitoxin [Thiorhodovibrio sp. 970]  clstr ali  31  1MARTQNLTLCDHWSDFVASLVESGRYSTASDVVRESLRLLQEREATLENLREALIEGENSAPAGPLDMEAIKHRARR... 79
419 8.000e-19gi|543938170|ref|WP_021031523.1| antitoxin [Salinisphaera shabanensis]  clstr ali  38  1MGRTTSITIGSQMDEFVGKLVASGRYGSTSEVVRSALRLLERQEQATAALRAAVEAGERSGDSDESLRDIAARVKHRHDV 80
420 8.000e-19gi|500029507|ref|WP_011710225.1| antitoxin [Gramella forsetii]  clstr ali  28  1MGKNTSISLGNHFEEFINEELKSGRYNSVSEIIRSALRLLESEERKEKELIKALEAGEQSGFVEDFDSKEHLKELHRQHL 80
421 8.000e-19gi|517697754|ref|WP_018867962.1| MULTISPECIES: hypothetical protein [Thioalkalivibrio]  clstr ali  26  1MA-TMNISLPDPMKSWVEEQAQSGQYSNSSDYVRDLIRRDRERARKIAHLQALTTEGLESGRGERTMEDLKRASRKSAE. 78
422 8.000e-19gi|521995470|ref|WP_020506741.1| hypothetical protein [Lamprocystis purpurea]  clstr ali  21  1MA-TMNLSLPDPVQRWVEAQIKSGQYRNAGDYVLDLIRRDQEYQDRRETLVAALVAGEASGPCERTLVEIWNTVKARHGL 79
423 8.000e-19 FMSKG9S01BK192|FMSKG9S01BK192|metagene|gene_2  ali  35  2..KTTSVALGVYFEDFIKAKIAQGRYNNASEVIRAGLRLLEENESRLTELKAAIREGIDSGVAEGF.............. 65
424 9.000e-19gi|1000234289|gb|KXJ97801.1| Antitoxin ParD1 [Parcubacteria bacterium OLB19]  clstr ali  31  1MSKTTSVNIGNHFESIISKWMQDGRYGSASEAMRAGLRLLEEQETKFELLQRSLVEGVNSGESNKSFSEIVKEAKSEIH. 79
425 9.000e-19gi|917776595|ref|WP_052290536.1| hypothetical protein [Scytonema millei]  clstr ali  26  1MA-TMNVSLPGELKKFVEDRVRSGEYANSSDFVRDLIRRSESNHRKLEALQRAIDDGIASGPSGKSFDQIMDGARAEAK. 78
426 9.000e-19gi|516268344|ref|WP_017672307.1| hypothetical protein [Blastomonas sp. AAP53]  clstr ali  27  1MSRNTSIVLGAPFQEFARSKVESGEFGSTSEVVREAMRRFMAEDLKLQALRAAIQEGIDSGPAEPFDWDEFMDR...... 74
427 9.000e-19gi|674788898|gb|KFL48094.1| hypothetical protein IL54_3522 [Sphingobium sp. ba1]  clstr ali  25  3MAQ-MNISLPDGLKSWIEARVAEGRYSSSSDYVRDLVRREQEAEEKLRILRAAIEEGLASGVSDRTIEDIIADRRKR... 78
428 1.000e-18gi|655493608|ref|WP_028875011.1| addiction module antitoxin [Tepidiphilus margaritifer]  clstr ali  28  1....MNISLPDSLKAFVDQQVEQGRYGTSSEYVRELIRKDQDRQQ----LRDLLLTGAASAPSVVADAQYFDGLRTRVR. 71
429 1.000e-18gi|557029490|gb|ESQ07756.1| hypothetical protein N839_07280 [uncultured Desulfofustis sp. PB-SRB1]  clstr ali  29  1MHKNTSVTLGAHYEKFIADQVSRGHFGTTSEAIRAGLQLLEEREIKKALLRQALVEGEESGKADYCLKAILDTLDKE... 77
430 1.000e-18gi|737561491|ref|WP_035533956.1| hypothetical protein [Hoeflea sp. BAL378]  clstr ali  31  1MGKNTSVVLTEQQEAFVRSQIEAGRYTSVSEAVRAGLATLQEREEMMTALRRDIDAGIASGDAGPLDMDAFLADLRR... 77
431 1.000e-18gi|930001904|ref|WP_054107531.1| antitoxin [Novosphingobium sp. AAP83]  clstr ali  33  1MARNTSVTIGEHFTNFIAAQVSTGRYGSASDVVRAGLRLLEDHEAKVRALELALIEGEETGEPEPFDFDEFLQRMNR... 77
432 1.000e-18gi|983317465|ref|WP_060502660.1| MULTISPECIES: antitoxin [Rhizobium]  clstr ali  18  1MTKSAQIVLDEELGAFVDRQVREGNYASANDVVKAGLRLLREDDAKLETLKAALIEGEESGDPVEFDFEDFLKQMHAKYA 80
433 1.000e-18gi|728824560|ref|WP_033925692.1| addiction module antitoxin [Sphingomonas sp. 35-24ZXX]  clstr ali  21  1MATVRTITLTTQQDDWIAAQVAAGSYTNDSEAIRDLIRQAQARHRETEAIQAALIEGEQSGEPEPFDFGAFKQRKLKQH. 80
434 1.000e-18gi|737494949|ref|WP_035474567.1| antitoxin [Alistipes inops]  clstr ali  29  2..KTTSVALGSYFDDFIKSKIAQGRYNNASEVVRAGLRLLEENENRFMELKTAIEEGIGSGEAVGFDAQEHLKTLKTQR. 78
435 1.000e-18gi|780837084|gb|KJS38935.1| hypothetical protein VR74_03820 [Hyphomonas sp. BRH_c22]  clstr ali  19  1MA-TMNISLPDQMKAWVEAQSADGKYANSSDLIRDLIRREQIKQEKIAALNEKIEEGFASGISDKSLDQIMAEILAE... 76
436 1.000e-18gi|518368520|ref|WP_019538727.1| hypothetical protein [Proteiniphilum acetatigenes]  clstr ali  36  1MAKNTSILLGEYFENFINEQVKSGKYASASEVVRTALRLFEQQENKAKILVNELKAGEKSGIISNFDRE........... 69
437 1.000e-18gi|742749003|gb|KIC59762.1| addiction module antitoxin [Brevundimonas nasdae]  clstr ali  24  9MA-TMNISLPDPMKAWVEEQAKSGRYANTSDVVRDLIRREQVKAEKIAHWQRLIIEADASGVSDQSPREVIEELRAQLR. 86
438 1.000e-18gi|668347195|emb|CDW96526.1| Antitoxin ParD1 [Thiomonas sp. CB2]  clstr ali  34  3....TSVALGTHFEEFVKVQVSSGRYNNVSEVVRDGLRLLQDQEAKLEWLRTELQKGLSSGPVTPLDMAEVRAEGQRLRA 82
439 1.000e-18gi|973775404|gb|KUM54767.1| antitoxin [Rheinheimera sp. EpRS3]  clstr ali  39  1MARNTSVTLGEHFDHFVAERVKQGRYQSVSEVVRAGLRLLEEDEIKLAQLRRKLEAAELSPVIDNFDEQRFVAELQQK.. 78
440 1.000e-18gi|959985403|gb|KSV94480.1| hypothetical protein N184_36615 [Sinorhizobium sp. GL28]  clstr ali  22  21...TMNISLPDYLKSFVDEQVAGRGYGTSSEYIRELIRRDQDRLT----LRSLLLDGASSAQTAPADADYFTGLRDRAR. 92
441 1.000e-18 GL0023571 [Complete] locus=scaffold6868_7:873:1118:+  ali  29  2..KTTSVALGSYFDDFIKSKIAQGRYNNASEVVRAGLRLLEENENRFMELKAAIEEGIGSGEAVGFDTQEHLKTLKTQR. 78
442 1.000e-18gi|494894649|ref|WP_007620694.1| hypothetical protein [Paraglaciecola arctica]  clstr ali  31  1MTQTVSISLGKHFTGFLNQLTENGRYGSASEAIQAALRLLEQEESKIQMLQNALTQGEESGESTKAFSDIVKMAKTEFHA 80
443 1.000e-18gi|398211707|gb|EJM98323.1| putative addiction module antidote protein, CC2985 family [Pantoea sp. YR343]  clstr ali  32  2MARTMTIDLGDELREFVESLVESGDYRTQSEVVRDSLRLLREKESKLEKLRELVREGFESGPGKEWDHEEFLRRAKAR.. 81
444 1.000e-18gi|302193199|gb|ADL00771.1| addiction module antidote protein, CC2985 family [Brevundimonas subvibrioides ATCC 15264]  clstr ali  20  9.....TITLTVQQDAWIAAQIEAGSYTNDSEAIRDLIRREQERTFEIDTLRQALKEGEQSGEPEPFDFAAFKQQKAAQH. 82
445 1.000e-18gi|501096878|ref|WP_012146908.1| addiction module antitoxin [Serratia proteamaculans]  clstr ali  36  3....TSIALSPHFEKFVHEQIDSGRYGNVSEVIRAGLRLLEEHERKIEQLRVAIAQGIESGEGVP-AEEAFARLRTKY.. 77
446 1.000e-18 FOM5TJD02QKSQB|FOM5TJD02QKSQB|metagene|gene_2  ali  32  2..RTTSVALGDYFERFIKAKIAQGRYNNASEVIRAGLRLLEENESRTLDLQNAVAEGFDSGIAEGFDPERHLQHLKARRA 79
447 1.000e-18gi|503026710|ref|WP_013261686.1| CopG family transcriptional regulator [gamma proteobacterium HdN1]  clstr ali  25  1MS-TMNISLPDALKSFVDDQVNQRGYGTSSEYVRELIRKDRDH----QHLRGLLLAGAASAPTAPVDGNYFDALRARVR. 74
448 1.000e-18 [KEGG:K07746]|[COG3609] Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain  ali  32  2..RTTSVALGDYFERFIKAKIAQGRYNNASEVIRAGLRLLEENESRMLDLQNAVAEGFDSGIAEGFDPERHLQHLKARRA 79
449 1.000e-18gi|1006704147|gb|AMQ55948.1| antitoxin [Algoriphagus sp. M8-2]  clstr ali  30  1MGKNTSISLGDHFEDFVEKEVSSGRYSTASEVIRAGLRLLEKEKLKLEILREALAEGEKSGFDPNFDSHSFLESLKKKHA 80
450 1.000e-18gi|504428599|ref|WP_014615701.1| addiction module antitoxin [Ralstonia solanacearum]  clstr ali  42  3....TSVALGNHFETFIREQVQSGRFNNVSEVVRAGLRLLEERELRLEALRAEIAAGRASGPTKP-ADEVFSRLEAKYSA 81
451 1.000e-18gi|518803646|ref|WP_019959600.1| hypothetical protein [Woodsholea maritima]  clstr ali  24  1MA-TMNVSLPQALKDWVETRAETGRFSNASDYVRDLIRRDQDREAKISALQTYVDEALASGISSASVSDIKARFK..... 74
452 1.000e-18gi|763035634|ref|WP_043919728.1| addiction module antitoxin [Jannaschia aquimarina]  clstr ali  27  1MA-TMNVSLPDEMKAFVDEQAEGPDYAGASDYIRDLIRRDRARRQAIAEIRAFVQEGIDSGPAKPFDRETFRARLHAEHV 79
453 2.000e-18gi|492064118|ref|WP_005737146.1| MULTISPECIES: addiction module antitoxin [Pseudomonas syringae group]  clstr ali  18  7.....TITVTDQQDAWIKAQLDVGGYTNDSEYIRDLIRREQARSADIEAIRLALIEGESSGEPRQFDVDEFKQRMLKAN. 80
454 2.000e-18gi|736928173|ref|WP_034925555.1| antitoxin [Gillisia sp. CAL575]  clstr ali  28  1MGKNTSISLSNHFENFINNEINSGKYNSVSEVIRSALRLLEREEIKEQELIKALEVGENSGSIDNFNSSEHLKELHRKNL 80
455 2.000e-18gi|504806498|ref|WP_014993600.1| addiction module antitoxin [Alcanivorax dieselolei]  clstr ali  27  3MHRKT-ITLTEQQDGWVKSRIESGQFGNDSEYIRHLIRQDQQAQERLATLRQALVEGEASGEPKPVDMAAIKAAGRKR.. 79
456 2.000e-18gi|739617932|ref|WP_037474491.1| hypothetical protein [Sphingobium sp. ba1]  clstr ali  20  15...TMNISLPETLKTFVDQQVSGRGFGTSSEYVRELIRKDQDRQN----LRRLLLDGAASAPTQAVDESYFADLRDRAR. 86
457 2.000e-18gi|505057454|ref|WP_015244556.1| addiction module antitoxin [Singulisphaera acidiphila]  clstr ali  20  3...TMNIALPESMKHFVQERVTAGGYSSVSEYVRELIRADQKRKVE-ERLDTLLLEGLESGQPIPVTQEYWDEKKRR... 75
458 2.000e-18gi|563561514|ref|WP_023767082.1| antitoxin [Mesorhizobium sp. LNHC232B00]  clstr ali  32  1MPKNTSVTLGDQYDAFIQRQIANGRFGSASETVRASLRXXXXXXXXXXXXRSAIDEGDMSGGPEPFDFDAFLESKKR... 77
459 2.000e-18gi|496339096|ref|WP_009048274.1| CopG family transcriptional regulator [Pseudomonas chlororaphis]  clstr ali  27  3...TMNISLPEALKAFVDDQVSQRGYSTSSEYVRELIRKDQDR----QHLRGLLLAGAESAPGTPVDDRYFDALRARVR. 74
460 2.000e-18gi|282565946|gb|EFB71481.1| addiction module antidote protein, CC2985 family [Providencia rustigianii DSM 4541]  clstr ali  34  5MARTMTVDLGDELRDFIDSLVNSGDYRTQSEVLRDALRLLKEKQAQVQELKDLLAEGLSSGSPIAWDQTKFLQRMKDK.. 84
461 2.000e-18gi|1011875995|ref|WP_062692921.1| antitoxin [Photobacterium sanguinicancri]  clstr ali  41  1MGRTTSVTIGEPLDSFVAKMIKSGRYGSTSEVMRSALRLLEQQECQTDMLRRALDEGDVSGECLLSLKEIAALKKKSLNV 80
462 2.000e-18gi|917563178|ref|WP_052158568.1| addiction module antitoxin [Escherichia coli]  clstr ali  38  3....TSVSLSPYFETFIREQIESGRYNNTSEVIRAGLRALEEREQKLESLQSAVAAGINSGES-KSAEEVFGRLTHKYK. 78
463 2.000e-18gi|797195573|ref|WP_045856570.1| antitoxin [Alteromonadaceae bacterium Bs12]  clstr ali  36  1....MALTLGEHFDGFISHQIQSGRYGSASEVIRAGLRVLEDKESKLDVLRQMLADGEESGTADYSYDSLMSELDAESH. 75
464 2.000e-18gi|515770359|ref|WP_017202959.1| hypothetical protein [Microbacterium barkeri]  clstr ali  25  1MA-TMNISLPDALKDFVEAQVSERGYSNSSEFVRELIRHEQSREQ----LRSLVIDGMTSGPGSEVDQAYFDRLRDRVHA 75
465 2.000e-18gi|728823561|ref|WP_033925173.1| hypothetical protein [Sphingomonas sp. 35-24ZXX]  clstr ali  25  1MA-TMNVSLPAAMKSWVEGQAQTGRYSNASDYVRDLIRRDQERADKIAAMQRLVDEAEAGGAGSLTVEQIFDEAIGR... 76
466 2.000e-18JGI.Meta 7058290902 C3519439__gene_141853 putative addiction module antidote protein, CC2985 family [Human Stool microbiome from visit numbe  ali  29  8..KTTSVALGSYFDDFIKSKIAQGRYNNASEVVRAGLRLLEENENRFMELKAAIEEGIGSGEAVGFDAQEHLKTLKMQR. 84
467 2.000e-18gi|953017904|gb|ALO47612.1| antitoxin [Pseudohongiella spirulinae]  clstr ali  34  8.AKNISISLGAHFDEFIAQQIQSGRYGSASEVVRTGLRMLEEAEIRRQHLRRLLSEGEKSGFVDYDYNSLMDELDKESH. 85
468 2.000e-18gi|503272604|ref|WP_013507265.1| CopG family transcriptional regulator [Pantoea sp. At-9b]  clstr ali  30  1MARTMTIDLGDELREFVESLVASGDYRTQSEVVRESLRLLREKQAKLEKLRALVKQGLESGEGQEWDREAFLRKVKAR.. 80
469 2.000e-18gi|938288232|gb|KPQ22448.1| toxin-antitoxin system ParD famly antidote component [Halomonas sp. HL-93]  clstr ali  40  6.SRTTSVTIGAPLDDFVGKLIASGRYGSTSEVVRSALRLLERQENQTAALRSAVEAGERSGESDLSLHDIAAQIKQKHDV 84
470 2.000e-18gi|516746885|ref|WP_018079787.1| hypothetical protein [Asticcacaulis benevestitus]  clstr ali  21  1MA-TMNISLPEQMKAWAESQAETGKYSNTSDYVRDLIRRDQERAEKIAAMQAVVTRSIASGISDLSMQDILEKARAHVAA 79
471 2.000e-18gi|800940022|ref|WP_045968305.1| antitoxin [Xenorhabdus doucetiae]  clstr ali  40  1MRKITSVSMSEQLDGFVQRMVESGRYGSISEVMRSALRLLEQQENQNDAIRKAVIDGLESGESSLTLRDIAEQRKRKHNV 80
472 2.000e-18gi|648256443|ref|WP_026037592.1| CopG family transcriptional regulator [Salinibacterium sp. PAMC 21357]  clstr ali  29  1MA-TMNVSLPDALKQFVEEQVSEHGYGTSSEFVRNLIR----HEHARTQLRALVVEGMTSGPGSDLDDAYFHQLRER... 72
473 2.000e-18gi|490959535|ref|WP_004821348.1| hypothetical protein [Acinetobacter guillouiae]  clstr ali  38  1MPRTTSVTIGSQLDEFVTRLIESGRYGSTSEVMRSALRLLEHQENQAMALRRAIEAGDESGESDLNLKDIAAKVKLKHNV 80
474 2.000e-18gi|494351031|ref|WP_007190936.1| CopG family transcriptional regulator [Thiocapsa marina]  clstr ali  26  3...TMNISLPDSLKAFVDEQVSQRGYGTSSEYVRELIRRDQDRLQ----LRNLLLAGASSAPTAPAKDAYFDSLRERVR. 74
475 2.000e-18gi|503730686|ref|WP_013964762.1| antitoxin [Nitrosomonas sp. Is79A3]  clstr ali  34  5..KNTSVTLGEHFEKFLAHQIETRRYGSASEAIRAGLRLLEERETKLGALCHAFIEGEQSGASDYSLQGILDELE..... 77
476 2.000e-18gi|655490196|ref|WP_028871681.1| antitoxin [Psychroserpens burtonensis]  clstr ali  30  1MGKNTSISLGDYFEEFISHEVKSGRYSSVSEVIRSALRLLESEEKKERELIKALEVGEESGFVEDFNP............ 68
477 2.000e-18gi|916732494|ref|WP_051339550.1| hypothetical protein [Caulobacter sp. URHA0033]  clstr ali  31  1MSKNTSIVLSEHFQTFIEGQVADGRYSSASDVVRAGLRLLEYQEARLAALRAALIEGEESGEPTEFEIESFLAERQQ... 77
478 2.000e-18gi|935602474|ref|WP_054466717.1| transcriptional regulator [Planktothricoides sp. SR001]  clstr ali  20  2..KTMNVSVPEPMRDYIEQQVKTGGYGSVSEYIRDLIRQDQKRKAQ-EHLENLLLQGIDSGEATNMSDRDWVEIRQA... 75
479 2.000e-18gi|496231659|ref|WP_008945694.1| antitoxin [Oceanibaculum indicum]  clstr ali  37  1MSRNTSVSLGPHFAAFVDRQVDEGRYGSASDVIRAGLRLLEEREAGLAALRAALMEGEESGVAAPLDIEAFLADRRQ... 77
480 2.000e-18gi|494639427|ref|WP_007397371.1| CopG family transcriptional regulator [Gluconacetobacter sp. SXCC-1]  clstr ali  25  1MA-TMNVSLPDPMKEWVEAQAKTGRYSNASDYVRDLIRRDQEARAAHDEVQAHITAGLRSGVGTRSMKQLLQDARAAAG. 78
481 2.000e-18gi|516075177|ref|WP_017505760.1| hypothetical protein [alpha proteobacterium L41A]  clstr ali  25  1MA-TMNISLPDPMKAWVEEQAKSGRYANTSDVVRDLIRREQVKAEKIANMQRLIDEGRASGISQMTMADIRAEALSRIAA 79
482 2.000e-18 GL0076031 [Complete] locus=C4301198_1:292:537:+  ali  32  2..KTTSVALGGYFEEFIRAKIAEGRYNNASEVIRAGLRLLEENESRLVELKAAIRAGEKSGEAVDFDPEQHLKTLKSKR. 78
483 2.000e-18gi|93452257|gb|EAT02905.1| hypothetical protein MldDRAFT_2864 [delta proteobacterium MLMS-1]  clstr ali  25  36MS-TMNISLPEPLKAFVDEQLSLRGYSTSSEYVRELIRKDQE----CQKLRGLLLAGAASAPGARADGDYFARLRDRIR. 109
484 3.000e-18gi|485665972|ref|WP_001307279.1| transcriptional regulator [Escherichia coli]  clstr ali  36  16MARTMTVDLGDELREFIESLIESGDYRTQSEVIRESLRLLREKESRLQALRDMLAEGLSSGEAQPWEKDAFLRKVKA... 94
485 3.000e-18gi|503603124|ref|WP_013837200.1| CopG family transcriptional regulator [Novosphingobium sp. PP1Y]  clstr ali  25  1MS-TMNISLPEGLKSFVDQQVSTRGYGTSSEYVRELIRKDQD----IQKLRSLLLEGANSASGAPADKGYFDGLRAR... 72
486 3.000e-18gi|516752946|ref|WP_018084068.1| hypothetical protein [Asticcacaulis benevestitus]  clstr ali  22  1MATVRTITITDQQDAWVKSQIENGNYTNDSEIIRDLIRREQERTAEIESIRAALIEAESGGEPQLFDPEAFKRRMQQAH. 80
487 3.000e-18gi|1011132615|ref|WP_062054355.1| addiction module antitoxin [Aquimarina longa]  clstr ali  21  1MATIRTITVTDKQDEWIKSQINNGDFTNESEYIRALIRREQGNNEKFLKLKSEIQKGLDSGISDRTLDDIWAAAEQKHKA 81
488 3.000e-18gi|653129741|ref|WP_027379129.1| antitoxin [Chryseobacterium daeguense]  clstr ali  27  1MAKNTSILLGDYFDNFISQQIKSGKFSSASEVVRAALRMFEYEESKKSELINELKKGEKSGFVENFDRKEFLKLHQKYSA 81
489 3.000e-18gi|941019426|ref|WP_055046181.1| hypothetical protein [Devosia sp. A16]  clstr ali  25  1MA-TMNISLPDKMKQWVEEQTADGRYANASDYVRDLVRRDQARREAISKLQQVVDDALASGISDKSIEEVFAEARVKAMA 79
490 3.000e-18gi|948024379|ref|WP_056683641.1| antitoxin ParD1 [Sphingobium sp. Leaf26]  clstr ali  29  3.SKTTSIALSDHFREFAERKVSEGRYGSTSEVVRAGLRLLEAEEQKLEQLRAALIEGEESGFLSDFDMRAWIDRR..... 76
491 3.000e-18gi|447149682|ref|WP_001226938.1| MULTISPECIES: antitoxin ParD [Escherichia]  clstr ali  41  1MRKITSVSVGEQLDSFITRMVQSGRYGSASEVMRSALRLLEQQESRDEAVRNAVIEGLESGESSMTLRDIAAERKQKHRV 80
492 3.000e-18gi|651326803|ref|WP_026451106.1| addiction module antitoxin [Aequorivita capsosiphonis]  clstr ali  33  1....MNVSLTEKQRKYIDDRVKSGDYQNASEVVRDALRAHELNEQKLQYLRNEIQKGIDSGVSPFTMKDILEQKKRQYN. 75
493 3.000e-18gi|653184107|ref|WP_027420573.1| antitoxin [Crocinitomix catalasitica]  clstr ali  30  1MAKNTSILLGDYFNDFIRKQITTGRYSSASEVVRAALRMFEEEENKKKELIAALKKGENSGFIENFDQEEFLNSLHNKH. 79
494 4.000e-18gi|810849409|ref|WP_046347674.1| hypothetical protein [Sphingomonas changbaiensis]  clstr ali  24  1MAQ-INVSLPDGLKKWVDDQVATGRYSSASDYIREILRADEERAAQLAWLQAEIDKGRASGEGQDY-KEFFAELRAARS. 77
495 4.000e-18gi|652889442|ref|WP_027148991.1| antitoxin [Methylobacter tundripaludum]  clstr ali  28  1MQKNTSVSIGLHFEKFIADIVEEGRFGSKSEVVRAGLRLLEAQEIKLAALRSALIEGEESGIAEYSLTGLIEELDKEDGA 81
496 4.000e-18gi|544832528|ref|WP_021248312.1| hypothetical protein [Thauera terpenica]  clstr ali  34  3....TSVALSPHFETFIRQQVDSGRFNNVSEVVRAGLRLLEEREAKLQALREAIAVGLASGPDIP-ADEVFDRLEAKYLA 81
497 4.000e-18gi|654413853|ref|WP_027885295.1| antitoxin [Mesonia mobilis]  clstr ali  33  1MEKNTSITLGSYFEEFIKEEVNSGRYNSVSEVIRSALRLLEQEERKEKELIKALVVGEQSGFVDDFDP............ 68
498 4.000e-18gi|970476671|ref|WP_058754667.1| hypothetical protein [Sphingomonas endophytica]  clstr ali  27  19MA-TMNISLPDAMKDWVEQQAATGRYSNSSDVVRDLIRREQVRAEKIANMQRLIDEGRASGVSERS.............. 83
499 4.000e-18gi|746351556|ref|WP_039396264.1| hypothetical protein [Novosphingobium sp. MBES04]  clstr ali  22  1MS-TMNISLPDALKAFVDQQVHSRGFGTSSEYMRELIRKDQD----IQRLKDLLLEGAQSAPGAPIDAAYFDGLRTR... 72
500 4.000e-18gi|655455114|ref|WP_028838212.1| CopG family transcriptional regulator [Thermomonas fusca]  clstr ali  28  1MA-TMNISLPDELKQFVDAQVAEHAYGSASEYLRELIRK----QRDVEKLRQMLLDGANSGQATPMEPDFFDQMRKRAHA 75
501 5.000e-18gi|760131488|ref|WP_043812856.1| CopG family transcriptional regulator [Desulfomicrobium baculatum]  clstr ali  32  3...TMNISLPEPLKSFVDEQVASRGYGTSSEYVRELIRKDQDR----QRLRALLLAGVSSPEREPADGAYFEAL...... 69
502 5.000e-18gi|788034865|ref|WP_045776856.1| hypothetical protein [Elstera litoralis]  clstr ali  27  1MA-TMNISLPVPMKEWVEQQSKGGRYSNASDYVRDLIRRDQERAEKIAAMQARVTEGVESGVSDSSMADI.......... 69
503 5.000e-18gi|736961451|ref|WP_034957936.1| hypothetical protein [Erythrobacter longus]  clstr ali  26  1MGKNTSISLSERHQKYLQSKVDSGEFASVSEVVRDAVRRLEERDLRISNLRELIREAEESGPPMPFDWDAFMAEK..... 75
504 5.000e-18gi|751264331|ref|WP_040974042.1| antitoxin [Mesorhizobium sp. ORS3324]  clstr ali  34  1MSKNTSVTLGDQYDAFIRRQIEKGRFGSASEIVRAGLRXXXXXXXXXXXXRAAIDEGDLSGSPEPFDIEAFLKSKK.... 76
505 5.000e-18gi|947524128|ref|WP_056188131.1| hypothetical protein [Pseudorhodoferax sp. Leaf267]  clstr ali  46  3....TSVALGEHFETFVKTQIASGRYNNASEVVRDGLRMLQDREAKLQRLRGDIQAGIDSGPATLLD............. 69
506 5.000e-18gi|505070382|ref|WP_015257484.1| ParD protein (antitoxin to ParE) [Thioalkalivibrio nitratireducens]  clstr ali  29  1MA-TMNVSLPDAMKAWVDQRSRSGRYSNASDYVRDLIRRDQERSAKIAQIQAMVDEALATGEGQRTMDEIEAEALSRIAA 79
507 5.000e-18gi|655874803|ref|WP_028965399.1| hypothetical protein [Sphingomonas phyllosphaerae]  clstr ali  24  1MA-TMNISLPDAMKDWVEQQAATGRYSNSSDVVRDLIRREQVRAEKIANMQRLVDEARASGIDPRSVDEIMADVRAKA.. 77
508 5.000e-18 GL0268016 [Complete] locus=scaffold33990_3:354:617:+  ali  38  3....TSVSLSPYFETFIREQIESGRYNNTSEVIRAGLRALEEREQKLESLQSAVTAGINSGES-KSAEEVFGRLTHKYK. 78
509 5.000e-18gi|575420246|gb|ETX04614.1| hypothetical protein ETSY2_27830 [Candidatus Entotheonella sp. TSY2]  clstr ali  34  1MSTNKSYVLGKHYEEFVATQVAQGRFNNASEVVRAGLRMLEDYETRMKELRMLVDQGDEAVADGKVM............. 67
510 6.000e-18gi|998621670|dbj|BAU57602.1| hypothetical protein HH1059_1292 [Halorhodospira halochloris]  clstr ali  27  3MHRKT-ITLTEQQDGWVKAQIESGQFSNDSEYIRDLIRRDQQAKESLAILRQALAEGESSGAPKPLDISAIKAAGRKR.. 79
511 6.000e-18gi|459644015|gb|AGG71060.1| hypothetical protein SM2011_b20062 [Sinorhizobium meliloti 2011]  clstr ali  34  5.ARSTSISLGDHFAGFIDSQVQTGRYGSASDVVRAGLRLLEEHEAKVRALEAALIEGEESGEPEPFDNEAFKAEMRA... 80
512 6.000e-18gi|671638370|ref|WP_031598951.1| MULTISPECIES: addiction module antitoxin [Ferrovum]  clstr ali  26  3...TMNISLPDTLKSFVDEQVNQRGYGTSSEYVRELIRRDQDR----LHLRGLLLDGAASAPSVPANATYFDALRQRVR. 74
513 6.000e-18gi|972714055|emb|CUW37435.1| putative ParD protein, antitoxin to ParE ###containing the CopG/Arc/MetJ DNA-binding domain and a metal-binding domain&#  clstr ali  26  1MA-TMNVSLPDPMREWVDSQVKGGVYANVSDYIRDLIRHDQQRR---QALEAAIAEGLDSGRSPRKAEDIMAEAKSR... 73
514 6.000e-18JGI.Meta 7059258693 SRS024075_LANL_scaffold_14788__gene_42924 putative addiction module antidote protein, CC2985 family [Human Stool microbi  ali  29  75...........YFEDFIKAKIAQGRYNNASEVIRAGLRLLEENESRLTELKAAIREGIDSGVTEGFDPEEHLKTLKAKR. 142
515 6.000e-18gi|544913604|ref|WP_021323369.1| CopG family transcriptional regulator [Photorhabdus temperata]  clstr ali  40  1MA--TSVALSPHFEGFIREQINSGRYNNVSEVIRAGLRMLEEHEQKLAELRAAVSAGIESGE-GLAAGEVFGELKHKY.. 77
516 6.000e-18 [KEGG:K07746]|[COG3609] Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain  ali  38  3....TSVSLSPYFETFIREQIESGRYNNTSEVIRAGLRALEEREQKLESLQSAVAAGINSGES-KSAEEVFGRLTHKYK. 78
517 7.000e-18gi|639053808|ref|WP_024460058.1| hypothetical protein [Marinimicrobium sp. LS-A18]  clstr ali  23  1MA-TMNVSLPDPMKSWVEQQAKTGKFSNSSDYVRDLIRKDQEKAQKIANLQARVDEGLRSGRSSSDMRAIKKRALEA... 76
518 7.000e-18gi|1004814836|gb|KYC40790.1| addiction module antitoxin [Scytonema hofmanni PCC 7110]  clstr ali  27  4MRKTITI--PDVMEEWVKAQIASGRYGNDSEYFRDLIRRDQDRRQAEQDLFALIQEGLDSGVSTSTVKDIMKRVEDRLK. 80
519 7.000e-18gi|736820871|ref|WP_034822508.1| antitoxin [Enterobacter cancerogenus]  clstr ali  43  1MRKITSVSVGEQLDNFISRMVDSGRYGSASEVMRSALRLLEQQESHDQVVRNAVVEGLESGESPRSLREIAAERKKLHRV 80
520 7.000e-18gi|783327763|gb|KJU85007.1| putative addiction module antidote protein [Candidatus Magnetobacterium bavaricum]  clstr ali  28  27..KIMNISLTPQLEKLVKAKVASGLYGSANEVLCEALRLLEERDRRIEELRVEIKKGLDSGEPTPLDMEAFKVRRRER.. 106
521 7.000e-18gi|502084491|ref|WP_012706289.1| addiction module antitoxin [Sinorhizobium fredii]  clstr ali  23  15...TMNISLPDHLKSFVDEQVAGGGYGSTSEYIRELIRRDQDRLALRRL----LLDGASSAQTEPVDEHYFTSLRDRVH. 86
522 7.000e-18gi|494503320|ref|WP_007292781.1| addiction module antitoxin [delta proteobacterium MLMS-1]  clstr ali  21  4.....TITLTDKQVSWFKAQIDAGRYTNDSEYIRDLIRREQERSAEIESIRTALIEGEASGEPTTFDVVGFKRKMLAAH. 77
523 8.000e-18gi|861966760|gb|KMS50996.1| addiction module antitoxin [Sphingobium czechense LL01]  clstr ali  24  5MATVRTITLTEQQNSWIAAQIDAGSYTNDSEAIRDLIRREQERGLEIESIRQALIEGEQSGEPELFDFAAFKRRKAEQH. 84
524 8.000e-18gi|500241887|gb|AGL84045.1| hypothetical protein PFLCHA0_c22740 [Pseudomonas protegens CHA0]  clstr ali  22  13MS-TMNISLPDALKSFVDDQVSQRGYSTSSEYVCELIRKDQDR----QHLRGLLLAGAQSAPGTAVQGDYFESLRARVH. 86
525 8.000e-18gi|497868817|ref|WP_010182973.1| antitoxin [Aquimarina agarilytica]  clstr ali  25  1MAKNTSILLGEYFDNFISRQIKTGKYSSAGEVVRAALRMFEHEESKKTELIKKLKKGEKSGFVEHFDRNKLLKSLHKKHL 80
526 8.000e-18gi|750189169|ref|WP_040493243.1| addiction module antitoxin [Ilumatobacter nonamiensis]  clstr ali  32  2..TTMNVSLPDELKIFVDERVNHDGYGSTSEYVRDLIRRDRER----GHLRDLVLEGANSGPGVVADPAYFDALRQR... 72
527 9.000e-18gi|928925884|ref|WP_053950811.1| hypothetical protein [Candidatus Thioglobus autotrophica]  clstr ali  32  1MA-TMNVSLPNEMKTWVEFQAQSGRYTNTSDYVRDLIRKDQDTSIKIQQMQAMVTKGLESGVGSRSMEELAKVALK.... 76
528 9.000e-18gi|500246462|ref|WP_011906815.1| CopG family transcriptional regulator [Novosphingobium aromaticivorans]  clstr ali  31  3...TMNISLPEGLKSFVDAQVATRGYGTSSEYVRELIRKDQD----VQRLRQMILDGAASPVIGEADDAYFDDLRK.... 71
529 9.000e-18gi|494878723|ref|WP_007604812.1| antitoxin [Rhizobium sp. PDO1-076]  clstr ali  27  1MNKSVQITLGEPLERFVDAQVESGQFGSAQEVVEAGLRLLKQEQDKLEWLRQALIEGDESGPSRPYDRDALMASVRE... 77
530 9.000e-18gi|517213987|ref|WP_018402805.1| hypothetical protein [Marinobacter lipolyticus]  clstr ali  28  1MA-TMNVSLPELMKEWVETQARSGRYSNTSDYVRDLIQRDQDRAEKVENVQRLISEGLESGEGSQSMDGLRDQAME.... 75
531 1.000e-17gi|504565906|ref|WP_014753008.1| addiction module antitoxin [Tistrella mobilis]  clstr ali  38  4.....SYTLGKHFETFIQAQLASGRYNNASEVIRDALRLMEERERRLAALDAAVMRGLADGAAGRTAEDVFDELEARYMA 80
532 1.000e-17gi|737057775|ref|WP_035052669.1| addiction module antitoxin [Andreprevotia chitinilytica]  clstr ali  38  3....TSVALSPHFESFIQELVQSGRYNNASEVVRAGLRLLEEQQQRQQELRSAIAAGLTSGEGRP-AKEVFARLEAKYR. 80
533 1.000e-17gi|503585892|ref|WP_013819968.1| CopG family transcriptional regulator [Methylomonas methanica]  clstr ali  28  3...TMNISLPDSLKSFVDEQVIQRGYGTSGEYVRELIRKDADR----QRLREALLAGAVSPPTTPVDPDYFAAMRKR... 72
534 1.000e-17gi|515903227|ref|WP_017333810.1| CopG family transcriptional regulator [Burkholderia pyrrocinia]  clstr ali  22  3...TMNISLPDSLKEYVDEQVGECGYGTSSEYVRELIRKDQGRK----RLRTMILQGATSGLVDPADADYFESLRARVR. 74
535 1.000e-17gi|730197636|gb|KHJ39009.1| antitoxin ParD1 [Pedobacter glucosidilyticus]  clstr ali  29  7..KNASIFLGDYFDQFVNSQVTAGRYKNISEVIIAGLRLLEDEETKTAALKNAIQQGLNSSRIENFDFDEHLAKLK.... 80
536 1.000e-17gi|495535515|ref|WP_008260094.1| MULTISPECIES: CopG family transcriptional regulator [Brevundimonas]  clstr ali  27  1MA-TMNISLPDPMKAWVEEQAKSGRYANASDVVRDLIRREQVKAEKIAHMQRLVDEARAGGISEKTPREIFEEVRAE... 76
537 1.000e-17gi|891174249|ref|WP_048917188.1| antitoxin [bacteria symbiont BFo1 of Frankliniella occidentalis]  clstr ali  38  1MARTTSVTIGAQLTEFVNRMIENGRYGSTSEVMRTALRLLEQKELEMEALRQAIEQGELSGESALSLHDIAAQNKREIDA 80
538 1.000e-17gi|648265181|ref|WP_026046330.1| addiction module antitoxin [Sphingomonas sp. PAMC 26621]  clstr ali  21  1MAQ-MNVSLPEGLKSWAEARVAEGRYSSTSDYVRDLVRRDQDDALKLNALRAAIDDGLASGLSERDPFDYLETLRAELR. 78
539 1.000e-17gi|357597740|gb|EHJ59483.1| CopG/Arc/MetJ family transcriptional regulator [Novosphingobium pentaromativorans US6-1]  clstr ali  22  5MA-TMNISLPDPMKQWVEAQADTGRYSNASDYVRDLIRRDQERADKIAAMQRLVDDARAGGLSDETMADIRARAINQAGL 83
540 1.000e-17gi|1011387549|ref|WP_062300298.1| CopG family transcriptional regulator [Lysinimicrobium aestuarii]  clstr ali  29  1MA-TMNVSLPDSLKDFVESQVAHGGYGTSSEFVRELIRREQDR----LRLRAAVLDGMSSGEGSVLDSAYFEALRDRAR. 74
541 1.000e-17gi|653034441|ref|WP_027286150.1| addiction module antitoxin [Rubritepida flocculans]  clstr ali  28  3...TMNVSLPDALKAFVDQQVESGGYSTSSEYVRELIRKDQER----QRLRGLLLAGATSRPGSVADDAYFDGLRR.... 71
542 1.000e-17gi|428259661|gb|AFZ25611.1| putative addiction module antidote protein, CC2985 family [Cylindrospermum stagnale PCC 7417]  clstr ali  18  23..KSMNISLPDAMRTYIEEKVASGGYSSVSEYFRELVRQDQKRQAA-ERLETMLLEGLNSGNATEMTPDDWEDIRQAVR. 98
543 1.000e-17gi|36787551|emb|CAE16655.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1]  clstr ali  35  1MTMPTSVALSPYFEAFIRNQIDSGRYNNTSEVIRAGLRALEEREQKVESLKSAIMAGIQSGES-RDAGDVFDRLTQKYK. 80
544 1.000e-17JGI.Meta 7021695411 C4702857__gene_274759 putative addiction module antidote protein, CC2985 family [Human Supragingival plaque microbiome f  ali  30  3...TMNISLSDALKNFVDEQVSQGGYVSSSEYVRDLLRREQDRLQ----LRSMLLDGINSGPAGVADDAYFDDLKQKVR. 74
545 1.000e-17gi|383702697|dbj|GAB59655.1| hypothetical protein RNAN_2661 [Rheinheimera nanhaiensis E407-8]  clstr ali  29  15.....TITLTEQQGEWVKTRIATGDFTNDSEYFRDLIRRDQARNAELEVIRAALVEGEQSGVSTRSVEDILQAARARLK. 88
546 1.000e-17gi|947617733|ref|WP_056280761.1| hypothetical protein [Methylobacterium sp. Leaf108]  clstr ali  24  1MA-TMNVSLPDPMKDWVEARARTGRYSTASDYVRDLIRRDQERADGIADLQTLVSEGLESGESGRSRDDIARLSRDMAAA 79
547 1.000e-17gi|910253674|ref|WP_050058175.1| hypothetical protein [Silvibacterium bohemicum]  clstr ali  21  3...TMNISLPDVLKNFVEEQVSSGKYSSASEYVRELVRA-EQKNHEREKIELKLLEGLHSGEPVELNPDMWDGLRRRLR. 77
548 1.000e-17gi|817443834|ref|WP_046557527.1| addiction module antitoxin [Arsukibacterium ikkense]  clstr ali  33  7.....TITLTEQQGEWVKTRIASGDFTNDSEYFRDLIRRDQARNEQLEAVRAALIEGEQSGISTRSADDILRAARKRLKA 81
549 1.000e-17gi|655328588|ref|WP_028736823.1| antitoxin [Rhizobium selenitireducens]  clstr ali  21  1MNKPVHVTIGEPFDSFIDSQVESGRFSSAEAVVEAGLRLLEEEQAKIERLREALIESENCGPARDFDRDAFMESMREA.. 78
550 1.000e-17gi|930006947|ref|WP_054111997.1| hypothetical protein [Brevundimonas sp. AAP58]  clstr ali  22  1MA-TMNISLPDPMKSWVESQTDGVRYANSSDYIRDLIRRDQERSAKIAHWQRLIDEARASGISDLTMEDIRQKAL..... 74
551 2.000e-17gi|753783271|ref|WP_041538914.1| CopG family transcriptional regulator [Caulobacter sp. K31]  clstr ali  26  1MA-TMNVSLPDAMKDWVEGRAETGRYSNASDYVRDLIRRDQERADKIAAMQRLIDEAEDSGVSASGMDDV.......... 69
552 2.000e-17gi|545090680|ref|WP_021460206.1| CopG family transcriptional regulator [Legionella pneumophila]  clstr ali  31  1MARTMTVDLGSELRDYVQFLVDSGDYRSNSEVLRESLRLLREKESKLEQLRHLIDEGEGSGDPLMWNAEEFLERMKK... 79
553 2.000e-17gi|660522550|gb|KEO52457.1| hypothetical protein SMB34_07400 [Thalassospira permensis NBRC 106175]  clstr ali  23  5MA-TMNVSLPDLMKDWVEAQAETGKYSNASDYVRDLIRRDQERAEKRALMQKMIREGIESGVVENFSMDALQA....... 76
554 2.000e-17gi|506300543|ref|WP_015820318.1| CopG family transcriptional regulator [Teredinibacter turnerae]  clstr ali  24  1MADTITFRPTDEQGGFIEGLIKSGDFASQSEVIRAGIRLLQEQQAKLAELRKLLQEGEDSPVVENWSADEFIERMKKKH. 81
555 2.000e-17gi|947872570|ref|WP_056533102.1| hypothetical protein [Methylobacterium sp. Leaf361]  clstr ali  22  1....MNVSLPEAMKAWVEAQADTDRYANASDYVRDLIRRDQERLAKLGDLQRLIDEGLASGVSDRSEQDIRQLGRTRLAA 76
556 2.000e-17gi|517213996|ref|WP_018402814.1| addiction module antitoxin [Marinobacter lipolyticus]  clstr ali  27  3MHRKT-ITLTEQQNGWVKGQIESGQFGNDSEYIRYLIRRDQQAQVRLTTLRQALSEGESSGIPKPLDISAIKTAGRKR.. 79
557 2.000e-17gi|738417294|ref|WP_036368801.1| antitoxin [Mycobacterium austroafricanum]  clstr ali  33  5..RQTSFSLDEHCSAFIEQAVSAGRYRPASDVVRTALRLLEDREMRLRALREALVDGERCGESTPFDFDEFVARKR.... 78
558 2.000e-17gi|501315742|ref|WP_012347377.1| addiction module antitoxin [Leptothrix cholodnii]  clstr ali  36  3....TSVALGSHFEEFVKSQVMSGRYNNASEVVREGLRLLEDRRVKLDKLRAGLKEGLDSG-AGALADDVFASLEAKY.. 79
559 2.000e-17gi|1011370839|ref|WP_062283696.1| MULTISPECIES: hypothetical protein [Rhizobium]  clstr ali  21  1MAK-LNIGLPDNMQKYVDEQTNSGRFADSDCYIHDLIRQDQDRQLKIAAMQTLVDEGIASGESDESMQDILRSLKEKRS. 78
560 2.000e-17gi|495335147|ref|WP_008059884.1| CopG family transcriptional regulator [Methyloversatilis universalis]  clstr ali  23  3...TMNISLPDTLKAFVDEQVSQRGYGTSSEYVRELIRKDQDRLQ----LRSLLISGAESPPAAVADGNYFEGLRDKVR. 74
561 2.000e-17gi|947514194|ref|WP_056178214.1| addiction module antitoxin [Pseudorhodoferax sp. Leaf267]  clstr ali  29  4.....SYVIGDHFEAFVKQQVQQGRYASASEVIRDGLRVLEEQEAKLEALRAAIQQGSDSGPGIP-AEEVFADVRARIR. 80
562 2.000e-17gi|817632488|ref|WP_046603843.1| transcriptional regulator [Neorhizobium galegae]  clstr ali  29  1MA-TITISLPDTLKDFVELQMATKGYGNISEYFRTLLRDAQQREND-ERLRALLLEGLSSGEGHIATPEFWSDLKAEAAL 78
563 2.000e-17gi|748600963|ref|WP_039859143.1| addiction module antitoxin [Halomonas titanicae]  clstr ali  27  3MHRKT-ITLTEQQDDWVRGQIESGHFGNDSEYIRHLIRRDQQAQERLTRLRNALVEGEMSGKPKPLDMSTIKAAGRKR.. 79
564 2.000e-17gi|966517471|ref|WP_058533965.1| CopG family transcriptional regulator [Legionella sp. LH-SWC]  clstr ali  27  1MARTMTVDLGNELRRYVESLVDSGDYRSNSEVLRESLRLLREKQAKLEQLRHLIEEGESSGDPLTWDAHNFLKRMNKKS. 81
565 2.000e-17gi|764992155|ref|WP_044558411.1| hypothetical protein [Azospirillum sp. B4]  clstr ali  35  1MGKNTSVSLGEHFTQFVETQVAESRYSNASDVMRAGLRLLEEHEAKLAALRAALDEGDASGVSDRNVLDIWAMVEAEADA 80
566 2.000e-17gi|506314903|ref|WP_015834678.1| CopG family transcriptional regulator [Photorhabdus asymbiotica]  clstr ali  30  7.SRTMTVDTGEKLRGFVESLVKSGYYKTNNEVVREGLRLLQEKESKLEALRQLIDEGDNSGDVVAWDLNIFLTRMK.... 83
567 2.000e-17gi|739665121|ref|WP_037520419.1| CopG family transcriptional regulator [Sphingomonas sp. LH128]  clstr ali  26  2..TTMNISLTEPLKQFVDRQVSGGGYDSSSEYVRDLIRKEQDRQS----LRDLLLDGARSAPGATADDAYFQDLRSRVR. 74
568 2.000e-17gi|947731966|ref|WP_056394140.1| MULTISPECIES: addiction module antitoxin [Sphingomonas]  clstr ali  28  1MATVRTITLTEQQNAWIVAQITAGHYTNDSEAIRDLIRREQERGQVIEQVRQALIEGEASGAPERFDFAAFKERKAA... 78
569 2.000e-17gi|648660174|ref|WP_026351921.1| addiction module antitoxin [Kushneria aurantia]  clstr ali  24  1MATIRTITLTEQQDAWITAQIETGRYTNDSEAIRDLIRHEQEHDARREALRLALYEGEQSGEPESFDFAAFKQRQIEQH. 80
570 2.000e-17gi|517045599|ref|WP_018234417.1| hypothetical protein [Thioalkalivibrio thiocyanodenitrificans]  clstr ali  21  2..RTLNISLPDRLKSFVDDQVRERGYGTSSEYVRELIRRDQDRQT----LRGLLLAGGASAPTQPADKAYFQGLREQVH. 74
571 3.000e-17gi|750380398|ref|WP_040662310.1| CopG family transcriptional regulator [Nitrococcus mobilis]  clstr ali  26  3...TMNVFLPDSLKSFVDEQVIQGGYSSSSEYIRELIRQDQER----TRLRSLLLQGAASPFSGPADEAYFHRLRDRIR. 74
572 3.000e-17gi|759535546|ref|WP_043255560.1| addiction module antitoxin [Pseudomonas knackmussii]  clstr ali  27  3...TMNISLPETLKVFVDEQVNQRGFGTSSEYVRELIRKDQDR----QRLRNLLLAGAESAPTQPADEGYFESLRKR... 72
573 3.000e-17gi|889794205|ref|WP_048848967.1| hypothetical protein [Tanticharoenia sakaeratensis]  clstr ali  23  3...TMNISLPETMKSFVDEQVVGRGFGTSSEYVRELIRRDQDR----QHLRALLIEGASSPATVPADTGYFDRLRERAR. 74
574 3.000e-17gi|746288351|ref|WP_039335715.1| CopG family transcriptional regulator [Novosphingobium subterraneum]  clstr ali  26  4....MNISLPDALKSFVDAQVASRGFGTNSEYVRELIRKDQD----VQRLRGMILDGAASPIAGEVDEAYFDGLRKLAR. 74
575 3.000e-17gi|775284578|dbj|GAN87831.1| hypothetical protein Gain_0098_003 [Komagataeibacter intermedius TF2]  clstr ali  23  1MA-TMNVSLPGPMKKWVEDQTRTGRYSNASDYVRDLIRRDQEARAVHSELQGHVVSGLRSGPGIRSMEQLRKDARAAAE. 78
576 3.000e-17gi|503558191|ref|WP_013792267.1| CopG family transcriptional regulator [Pseudomonas fulva]  clstr ali  20  3...TMNISLPENMKRFVDDQVSERGYSTSSEYVRELIRKDQDRQQ----LRGLLLEGAASAPAVPADTDYFESLRERVR. 74
577 3.000e-17gi|502799276|ref|WP_013034252.1| CopG family transcriptional regulator [Nitrosococcus halophilus]  clstr ali  33  1....MNVSLTPELEAFVKDRVQSGRYYSASEVIREGLRLLEEQEKRLEELRKEIQKGLDSGPAEPMDEEIITEARRELA. 80
578 3.000e-17gi|930039332|ref|WP_054142885.1| addiction module antitoxin [Bosea sp. AAP35]  clstr ali  22  1MA-TMTISLPDPMKEWIEAQIKQGEYASTSDYVRDLVRRDRERELTLADLQRIVAESRASGISDKTLPEILAQAKHAAEV 83
579 3.000e-17gi|746301879|ref|WP_039348931.1| antitoxin [Chryseobacterium jeonii]  clstr ali  33  1MGKNTSILLGDYFENFVNEKITSGKFSSVSEVIRNALRLMENEENKTKTLINELKIGEKSGIVKDFDR............ 68
580 3.000e-17gi|655226181|ref|WP_028640148.1| addiction module antitoxin [Novosphingobium acidiphilum]  clstr ali  25  1MATVRTITLTEQQDAWIAAQIAAGHYTNDSEAIRDLIRREQERSFEIETIRQALIEGEQSGEPESFDFAAFRQRK..... 76
581 4.000e-17gi|739560585|ref|WP_037418753.1| antitoxin [Sinorhizobium sp. CCBAU 05631]  clstr ali  24  1MA-TMNVSLPDAMEDWVEVQTRTGRYANASDDVRDLIRRDQERNDKMAAMQRLVDDGLKSGAGNCSHRTSFSRRR..... 74
582 4.000e-17gi|860493922|ref|WP_048441548.1| addiction module antitoxin [Caenimonas sp. SL110]  clstr ali  22  2..TTMNISLPDAMKSFVDEQVSERGYGTSSEYVRELIRKDQERRQ----LRELILAGGASEPGPAADANYFKSLRSRVGA 75
583 4.000e-17gi|496167834|ref|WP_008892341.1| CopG family transcriptional regulator [Thalassospira profundimaris]  clstr ali  26  1MA-TMNVSLPDLMREWVESQIEQGEYASSSDYIRDLIRQDQRRQK---LLKAALNEGLNSGRSPRSVDDIMREVMDE... 73
584 4.000e-17gi|930053506|ref|WP_054156535.1| antitoxin [Rhizobium sp. AAP43]  clstr ali  21  1MNKPVQVTIAEPFDSFIDAQLESGHFKSAQEVVEAGLQLLKEEQARIEWLRNALIEGEDSGPSVPFDPEDLMTSVRER.. 78
585 4.000e-17gi|947605992|ref|WP_056269158.1| MULTISPECIES: hypothetical protein [Pelomonas]  clstr ali  26  3...TMNISLPEPMRAFVEERVSEKGYGSSSEYVRDLIRRDQERE----ALRALLLDGAQSPPAAEMTPAFFASLRQRVQA 75
586 4.000e-17gi|353588088|gb|EHC47223.1| putative transcriptional regulator [Salmonella enterica subsp. enterica serovar Inverness str. R8-3668]  clstr ali  35  3MARTMTVDLGDELREFIESLIESGDYRTQSEVIRESLRLLREKESRLQALRDLLAEGLSSGEPVEWEKDAFLKKVKA... 81
587 4.000e-17gi|941923142|gb|ALK92633.1| Antitoxin ParD1 [Limnohabitans sp. 103DPR2]  clstr ali  32  3....TSVALSPHFESFIRDQVESGRYNNVSEVVRAGLRLLEDTERQLQALKAELEAGKVSGPAQNAAP-VFDRLKSKYA. 80
588 4.000e-17gi|671538411|ref|WP_031522118.1| hypothetical protein [Siccibacter colletis]  clstr ali  34  1MARTMTVDLGEELRGFVESLIATGDYRTQSEVIRDSLRLLREQQAQLQQLRALINEGVNSGAPQEWKQDAFLQNLKAR.. 80
589 4.000e-17gi|924025160|emb|CRX69674.1| unnamed protein product [Stenotrophomonas maltophilia]  clstr ali  20  1MA-TMNISLTDPLKQFVDEEVREGGYSSTSDYVRDLIRQRQQRSKAEELLKQLIAEGLASGPGVPVTADTFERMRRE... 77
590 4.000e-17gi|433301049|gb|AGB26868.1| putative transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain (plasmid) [Mycobacterium sp. JS623] :  clstr ali  30  4.GKNTRLSLNEHYSAFIDGEVAAGRYRSASAVVQSALRLLEDRGTRLRAVREALDAGESSGISIPFDFDEFVERKR.... 78
591 4.000e-17gi|488794058|ref|WP_002706464.1| addiction module antitoxin [Thiothrix nivea]  clstr ali  25  5.....TISLPDPMSHYIDLQVSSGQYGNVSEYIRDLIRKDQEQKQAINELRNLLDKAEASGISQMSMGEIRERARKRAGL 80
592 4.000e-17gi|665889829|ref|WP_031257035.1| hypothetical protein [Mesorhizobium sp. L48C026A00]  clstr ali  27  3...TINISLPDNLKTFVDQQVSERGYGTSSEYVRELIRRDRDREQ----LRDLLMDGASSPPTEPIDDRYFENLRDRRS. 74
593 4.000e-17gi|544802541|ref|WP_021219710.1| CopG family transcriptional regulator [Pseudomonas alcaligenes]  clstr ali  26  3...TMNISLPEALKNFVDEQVSQRGYGTSSEYVRELIRKDQDR----QRLRGLLLEGATSAPEAPADEHYFEALRNRVR. 74
594 4.000e-17gi|515419497|gb|EPJ48057.1| putative addiction module antidote protein [Osedax symbiont Rs1]  clstr ali  30  2.......TLGDHFDGFIAHQIEIGRYSSASEVVRAGLRVLEDKESKLNVLRQMLTDGEQSGKADYSYATLMDELDAE... 71
595 4.000e-17gi|966788967|ref|WP_058555943.1| CopG family transcriptional regulator [Thiohalocapsa sp. ML1]  clstr ali  35  4....TSLSPGEHWETFIKREVASGRYGSASDVIRDALRHMEERNSKLAALRAHLAEGEAQALNGEIVEDYSIEAV..... 74
596 5.000e-17gi|429554046|gb|AGA08995.1| putative addiction module antidote protein, CC2985 family (plasmid) [Sinorhizobium meliloti GR4]  clstr ali  22  34...TMNISLPDHLKSFVDEQVAGRGYGTSSEYIRELIRRDQDRLALRRL----LLDGASSAPTEPVDADYFTSLRDRVR. 105
597 5.000e-17gi|496402535|ref|WP_009111525.1| addiction module antitoxin [Brenneria sp. EniD312]  clstr ali  28  1MARTITIDLGDELRHYVESLVESGDYRTQSEVIREAIRMLREKQAELQKLRNLIADGLNSGEPQEWNRDEFLQKVRDK.. 80
598 5.000e-17gi|766669458|ref|WP_044829288.1| CopG family transcriptional regulator [Thalassospira sp. HJ]  clstr ali  24  1MA-TMNVSLPDLMREWVESQIEQGEYASSSDYIRDLIRQDQRRQK---LLKAALNEGLGSGRSPRTAEDILQETRKK... 73
599 5.000e-17gi|914716498|ref|WP_050686647.1| antitoxin [Nautella italica]  clstr ali  34  12...................QIVTGRYGSASDVVRAGLRLLEEHETKVKALQDALIAGEQSGEPQPFDFEEFKARKRA... 69
600 5.000e-17gi|695786340|ref|WP_032703290.1| addiction module antitoxin [Pseudomonas syringae]  clstr ali  20  7.....NIVISDAQDRWIKTQIESGRYASYSECIRALIHRDQERSDVTEAIRSALIAGEESGEPIRFDPDAFNQYM..... 76
601 5.000e-17gi|503577988|ref|WP_013812064.1| MULTISPECIES: CopG family transcriptional regulator [Serratia]  clstr ali  27  1MGRTLTVDLGEELRSFVEDLVASGDYRTPSEVIRESVRTLRERTAKLEELRRLIAEGENSGDAVEWDRDVFMERIR.... 78
602 5.000e-17gi|49613080|emb|CAG76531.1| conserved hypothetical protein [Pectobacterium atrosepticum SCRI1043]  clstr ali  28  2MARTMTIDLGDELRHYVESLVESGDYRTQSEVIREALRMLREKQAELQTLRQLVAEGINSGEPQEWNKDEFLQKIRNR.. 81
603 5.000e-17gi|738234894|ref|WP_036190259.1| antitoxin [Marinobacter lipolyticus]  clstr ali  29  1MA-TMNVSLPEPMKEWVESQAKSGRYSNTSDYVRDLIRKDQDRADKIAKMQKLISEGI...................... 57
604 5.000e-17gi|497924486|ref|WP_010238642.1| MULTISPECIES: addiction module antitoxin [Citromicrobium]  clstr ali  26  1MATIRTITLSDTQDAWIKRQIAEGGFTNDSEYIRDLVRRDQEGQEKLSGLRQAIAEGLDSGVSDRSLDDIW......... 72
605 5.000e-17gi|766755343|ref|WP_044836260.1| CopG family transcriptional regulator [Thalassomonas actiniarum]  clstr ali  44  1MA-TTSLSLGEHWEAFIKDEIASGRYGSASEVVRDALRTMEERKTKLAALRAHLATGAQQAASGDFVDD........... 68
606 5.000e-17gi|805457693|ref|WP_046109648.1| hypothetical protein [Devosia geojensis]  clstr ali  30  1MA-TMTISLPEPMKAWIEEQVQKGNYASASDYIRDAVRHDRERLDTLEELRDMIAEGEASGISSKTLEEIFEEAQR.... 80
607 5.000e-17gi|759571139|ref|WP_043290469.1| addiction module antitoxin [Pseudoxanthomonas spadix]  clstr ali  27  1MS-TMNISLPETLKTFVDEQVSQRGYGTSSEYVRELIRKDQDR----LHLRGLLLAGASSLPTAPADASYFEGLRNRVR. 74
608 5.000e-17gi|868629591|ref|WP_048498265.1| antitoxin [Chryseobacterium koreense]  clstr ali  31  1MAKNTSILLGDYFDNFINSQIKTGKYSSASEVVRTALRMFEHEETKKKEIIKELKKGEKSGFSTDFNRETFKELHKKYSA 81
609 5.000e-17gi|738340721|ref|WP_036293343.1| antitoxin [Methylobacter whittenburyi]  clstr ali  35  1MQKNTSVSLGEHFEGFIAGKIREGRFGSASEAIRAGLRLLEEQELKLEALRSALIAGEQSGAAYDFDVEEFLTEIKKSH. 79
610 6.000e-17gi|1004707209|gb|KYC29361.1| addiction module antitoxin [Sterolibacterium denitrificans]  clstr ali  37  3....TSVALGHYFETFVRNQVQSGRFNNASEVVRAGLRLLEESEQELEALRAEIAAGQASG-PGKSADTIFDRLEAKYA. 80
611 6.000e-17gi|806814288|ref|WP_046173116.1| hypothetical protein [Devosia psychrophila]  clstr ali  24  1MA-TMNISLPDAMKQWVEDQVQTGRYGNSSDYVRDLVRKDQKRAEAREKLQQMVDEALASGIVEMSRDELLARMRLKAK. 78
612 6.000e-17gi|518392114|ref|WP_019562321.1| hypothetical protein [Caldimonas manganoxidans]  clstr ali  36  3....TSVALSPHFEAFIKEQVASGRYNNASEVVRAGLRLLEEQAQRLEELRAAITAGRSSGPEQP-AEEVFDRLETKYR. 80
613 6.000e-17gi|946851375|ref|WP_055774387.1| addiction module antitoxin [Sphingomonas sp. Leaf357]  clstr ali  21  1MAQ-MNISIPDQLKSWAEARVAEGRYSSTSDYVRDLVRRDQEHAEKHRALVAAIDEGLASGVSERTIEDII......... 70
614 6.000e-17gi|550925781|ref|WP_022674247.1| CopG family transcriptional regulator [Sphingopyxis baekryungensis]  clstr ali  22  1MAQ-MNISVTDQLKSWAESRVAEGRYSSTSDYVRDLLRRDQDEEAKRRNLMAEIAIGLASPISNETADDVFERVQARH.. 77
615 6.000e-17gi|524054700|emb|CCY34915.1| putative addiction module antidote protein CC2985 family [Alistipes sp. CAG:831]  clstr ali  32  2..KTTSVALGQHFDNFIRTSIEEGRYSNASEMVRAGLRLLEEDECRLDALKTAIKSGLDSGIARGFDPVRHLAELKA... 76
616 7.000e-17gi|769265524|ref|WP_045002714.1| MULTISPECIES: transcriptional regulator [Bradyrhizobium]  clstr ali  31  2...NMNVSLTDELHEFVKAKVESGRYTSASEVVREALRIMEQDEARLAYLRRAWAEGEAGGDAGPADFASIKAKGRE... 76
617 7.000e-17gi|503926557|ref|WP_014160551.1| addiction module antitoxin [Pseudoxanthomonas spadix]  clstr ali  40  3....TSVALCSHFETFVREQLQSGRFNNASEVVRAGLRLLEEHEAELQALRADIAAGKASGTPKP-ADEGFARLEAKYS. 80
618 7.000e-17gi|836672202|ref|WP_047820116.1| hypothetical protein [Croceicoccus naphthovorans]  clstr ali  22  1MS-TMNISLPDALKSFVDLQVSCRGYGTSSEYVRELIRKDQD----TQRLRGLLLDGAASPSTTPADTAWFDGLRDRAR. 74
619 7.000e-17gi|502961274|ref|WP_013196250.1| MULTISPECIES: addiction module antitoxin [Pantoea]  clstr ali  38  3....TSVALTPYFEAFIREQIESGRYNNTSEVIRAGLRALEEREQKLDALQKAVNAGINSGESKN-AEEVFGRLSQKYR. 78
620 7.000e-17gi|737542452|ref|WP_035515717.1| antitoxin [Pseudohaliea rubra]  clstr ali  26  1MA-TMNVSLPDAMKAWVDECSRSGRYSNASDYVRDLIRRDQERAGRIAELQGLIDEALAGGDGVRTMDSLQAEATARLA. 78
621 7.000e-17gi|654881222|ref|WP_028333037.1| MULTISPECIES: transcriptional regulator [Bradyrhizobium]  clstr ali  32  2...NMNVSLTDELSEFVKTKVASGRYTSASEVVREALRIMEQEEARLAFLRNAWAAGQASGDAGPADFAEIKAQGRAR.. 77
622 7.000e-17gi|953251916|emb|CUS35468.1| conserved hypothetical protein [Candidatus Nitrospira nitrosa]  clstr ali  21  1MGTTRTITVTEQQDQWIKAQIECGKFTNDSEYIRDLIRRDQD-SATFQTLKDAIQEGLDSGISDRTVPQIMEDVEARLR. 79
623 7.000e-17gi|406877714|gb|EKD26854.1| hypothetical protein ACD_79C00988G0008 [uncultured bacterium]  clstr ali  30  1....MNVSLTPTLEEFVHQKVASGLYNSASEVVRDGLRLLEEREKKREELRRDIQKGFDSLDRGEPLDTVFEELERKYNL 82
624 8.000e-17gi|984375024|gb|KWV95322.1| addiction module antitoxin [Erythrobacter sp. AP23]  clstr ali  21  7.....TITLSDKQDAWIKRQIARGAFTNDSEYIRDLVRRDQEGQAKLAGLKQAIAEGLESGVSDQSLDAIWAEAETRAGA 81
625 8.000e-17gi|504992591|ref|WP_015179693.1| addiction module antidote protein [Oscillatoria nigro-viridis]  clstr ali  34  1....MNVSLTPELEQYVQEKVSSGLYYSASEVIREGLRLLKERETRLQELRQEIQVGLDSGEATPLD............. 67
626 8.000e-17gi|734855340|ref|WP_034105419.1| addiction module antitoxin [Pseudomonas fluorescens]  clstr ali  25  7.....TITVTDQQDTWIKGQIEAGHYTNDSEYIRDLIRREQERTAEVDAIRAALLEGEASGKPRAFNAEAF......... 72
627 8.000e-17gi|780804520|gb|KJS09914.1| hypothetical protein VR78_15230 [Hoeflea sp. BRH_c9]  clstr ali  29  1MAS-MNVSLPAPMKGWVEEKANSGQYSNTSDYVRDLIRKDQERDARIAQMQALVDEARESGISTSSMQDIREEARR.... 75
628 8.000e-17gi|496009733|ref|WP_008734312.1| addiction module antitoxin [Alcanivorax pacificus]  clstr ali  29  3MHRKT-ITLTEQQDDWVKGQIESGHFGNDSEYIRDLIRRDQLAKERLAMLRQALAAGESSGEPRPLDISAIKAAGRKR.. 79
629 9.000e-17gi|947592043|ref|WP_056255366.1| hypothetical protein [Devosia sp. Root436]  clstr ali  24  1MA-TMNVSLPDKMKQWVEDQVQTGRYGNASDYVRDLVRRDQERAEAREKLQQMVDEALASGRVEMTREQLLDRVM..... 74
630 9.000e-17gi|491062888|ref|WP_004924521.1| addiction module antitoxin [Providencia stuartii]  clstr ali  32  3....TSVALSPYFEEFIQSQIKSGRYNNTSEVIRAGLRALEEQENKLAALQTAIVDGINSGESKD-ASAVFSRLSSKYA. 78
631 9.000e-17gi|499973631|ref|WP_011654349.1| CopG family transcriptional regulator [Rhizobium leguminosarum]  clstr ali  25  3...TMNISLPDNLKQFVDQQVAGRGYGTSSEYVRELIRHDKDR----QHLRSLLLEGASFETTEPVDAAYFDSLRARAS. 74
632 9.000e-17gi|639294300|ref|WP_024587961.1| addiction module antitoxin [Aliihoeflea sp. 2WW]  clstr ali  36  3....ISAELGPHLEQFVAKLVTSGRYNSKSEVLRDGLRLLEERQAKLEALDKMIAEGLASLDRGEPADEVFDRLEAKYR. 79
633 9.000e-17gi|575423878|gb|ETX07503.1| CopG family transcripitonal regulator [Candidatus Entotheonella sp. TSY2]  clstr ali  39  1MA-NTSLTLGEHWEKFIKNEIASGRYGSASEVVRDGLRALEERKSKLDALRSHLAQGATQAEKGEFVEDY.......... 69
634 9.000e-17gi|1011596645|ref|WP_062462644.1| MULTISPECIES: antitoxin [Rhizobium]  clstr ali  26  2MGELRSIRVDEKLAAFVEKQVEDGRYGSASEVIEDALRLLQESDAALEAIRAAIQEGEDSGEPQPFDFDEFIEQKRARRL 82
635 1.000e-16gi|755641791|ref|WP_042546510.1| CopG family transcriptional regulator [Yersinia aldovae]  clstr ali  32  1MARTMTVDVGEELRDFIDSLVSAGDYRTQSEVLRDALRLLREKQAELQSLRDLLAEGVSSGTPETWSKDVFIQRIKER.. 80
636 1.000e-16gi|550957091|ref|WP_022705457.1| addiction module antitoxin [Pseudorhodobacter ferrugineus]  clstr ali  29  1...MISADLGSQLEGFVAKLVETGRYNSKSEVLREGIRLIQEREARLALLDHALAKGIADAEAGRTNPDVFARLEAKYEA 79
637 1.000e-16gi|161785420|emb|CAP54968.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus PA1 5]  clstr ali  24  9MAS-MNVSVPDPMRDWVQRRIDSGQYASVSDYVRDLIRRDQTQAEERQALVEVLVQGEQSGVSKRTIPDILAAMKTAHDA 87
638 1.000e-16gi|736848569|ref|WP_034848762.1| addiction module antitoxin [Inquilinus limosus]  clstr ali  27  3...TMNISLPESLKSFVDEQVSQRGYGTSSEYVRELIRKDQDR----QRLRSFLLAGAESPLTPPIDAAYFEGLRDRIR. 74
639 1.000e-16gi|499717594|ref|WP_011398328.1| CopG family transcriptional regulator [Hahella chejuensis]  clstr ali  27  1MPRTITFQPSAELESFISSMIETGSYNNQSEVIRAGLRLLQEQMAKLQELRSLIDEGEASGELKNWDVNEFLARMKK... 79
640 1.000e-16gi|518389663|ref|WP_019559870.1| hypothetical protein [Caldimonas manganoxidans]  clstr ali  23  3...TMNSSLPGTLKSFVDEQVRQRGYGTSSEYVRELIRKDQDRHP----LRNLLLAGVASAPAAPADTGYFDGLRDRVR. 74
641 1.000e-16gi|1016916676|gb|AMY09108.1| Antitoxin ParD4 [Acidobacteria bacterium DSM 100886]  clstr ali  22  29...TMNISLPEGLKDFVDQQVAERGYATSSEYVRELIRRDQDR----LHLRGLLVAGAVSRPTRPVDAAYFERLRARVR. 100
642 1.000e-16gi|648221337|ref|WP_026002486.1| CopG family transcriptional regulator [Sphingobium xenophagum]  clstr ali  25  4....MNISLPETLKSFVDQQVSGRGYGTSSEYVRELIRKDQDR----QRLRQILLDGAASEPTGAVDDAYFDTLRERAG. 74
643 1.000e-16gi|500246139|ref|WP_011906492.1| CopG family transcriptional regulator [Enterobacter sp. 638]  clstr ali  31  1MARTMTVDVGDELREFIDALVKAGDYRTQSEVMRDALRLLREKESRLQTLRDLLAEGISSGEAKPWNKDAFLKNVRARVA 82
644 1.000e-16gi|494946545|ref|WP_007672573.1| CopG family transcriptional regulator [alpha proteobacterium BAL199]  clstr ali  22  1MA-TMNVSLPDPMKHWVEAQARTGRYSNASDYVRDLIRRDQERAAQHAQLQAAITEGLESGVADDFSMEAVQSELDRR.. 77
645 1.000e-16gi|517729773|ref|WP_018899981.1| hypothetical protein [Rhizobium sp. 2MFCol3.1]  clstr ali  22  3...TVTVTVSDEMKVWLEKQASAGSYADASDYVRDLVRRDQERATKIANMQALVDEGLASGVSDETMDDILRSL...... 73
646 1.000e-16gi|558561798|ref|WP_023492371.1| hypothetical protein [Serratia sp. DD3]  clstr ali  33  1MAKTINVTLDEQFDALINRLIDRGRYGSANEVMCSALRLLEQQDANHETVRPAVIAGLTSGESPLSLREIAAQRKLKQGV 80
647 1.000e-16gi|947524094|ref|WP_056188097.1| addiction module antitoxin [Pseudorhodoferax sp. Leaf267]  clstr ali  25  3...TMNISLPDTLKSFVDEQVSARGYGTSSEYVRELIRRDQDRLQ----LRGLLLAGAASAPAGVADEAYFQSLRDRIR. 74
648 1.000e-16gi|518015871|ref|WP_019186079.1| addiction module antitoxin [Stenotrophomonas maltophilia]  clstr ali  23  1MA-TMNISLTDPLKQFVDEEVSQGGYSSTSDYVRDLIRQRQRQKAE-ELLRRLIAEGLASGPSAPVTSATFERMRRDLA. 77
649 1.000e-16gi|938981885|ref|WP_054759692.1| addiction module antitoxin [Methylomonas koyamae]  clstr ali  40  3....TSVALSPHLEAFIREQISSGRYNNTSEVVRAALRLMEEQQQRLEALKAEIAAGKASGPGIPADS-VFARLEQ.... 77
650 1.000e-16gi|916280410|ref|WP_051015456.1| CopG family transcriptional regulator [Alcanivorax dieselolei]  clstr ali  43  1MA-TTSLTLGSHWERFVKEEVASGRYGSVSEVIRDGLRTLEMRQTKLATLRAHLLEGEAQAARGEYVD............ 67
651 1.000e-16gi|501427858|ref|WP_012452528.1| transcriptional regulator [Methylobacterium populi]  clstr ali  40  4.....SYTLGQHYERFVKELVESGRYASASEVVRDGLRLMEEREAKLDALRREIQDGIDSGPAEPLDMDAIK........ 74
652 1.000e-16gi|639295949|ref|WP_024588593.1| hypothetical protein [Aliihoeflea sp. 2WW]  clstr ali  31  1MSRNTSISLGDHFAGFVEKQVGDGRYATASEVVRAGXXXXXXXXXXXXXXXSAIAAGEASGPPEAFDIDEFLAGKRKER. 79
653 1.000e-16gi|506317917|ref|WP_015837692.1| antitoxin [Geobacter sp. M21]  clstr ali  35  1MRKNTSVTLGAHYEKFISQQFIQGRFGSASEAIRAGLRLLEERETKLSLLRRALIEGEESGAADY............... 65
654 1.000e-16gi|557836144|ref|WP_023460878.1| hypothetical protein [Asticcacaulis sp. YBE204]  clstr ali  36  4.....SYSLGAHFENFVQGQLKTGRYNNASEVLRDALRLMEDRERRLAALDQALEEGLRSAEAGESAEDVFDELEAELA. 79
655 1.000e-16gi|787939625|gb|AKA36100.1| addiction module antitoxin [Muricauda lutaonensis]  clstr ali  29  6..KKMNISFTKKQEEYIAKQVASGEYQNNSEVIRDALRLHEYREKVIADLRAEIEKGLNSGISKRSVKDIIDTKRKSRK. 83
656 1.000e-16gi|167734466|emb|CAP52676.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris]  clstr ali  25  31MA-TMNISLPDELKEFVDQQVLEHAYGSSSEYLRELIRM--QRDA--QSLRALLLDGAESGPAVAMEADFFDSMRARAH. 104
657 1.000e-16gi|737003569|ref|WP_034999413.1| hypothetical protein [Corynebacterium sp. GD7]  clstr ali  42  1MAKNTSVVLGERYDTFIARLIQDGRYASASEVLREGLRLVEERELKFDALTLAVEKGE---LGAEFDAEQFIAEVR.... 73
658 1.000e-16gi|737552415|ref|WP_035525169.1| addiction module antidote protein [Hoeflea sp. BAL378]  clstr ali  29  1MTRAKSFVVGDRYEQFIARQVEEGRFNNASEVIRAGLRMLEDYETRLGALRQEIAKGDSDIEAGRVADDLFQDIIKD... 83
659 1.000e-16gi|765312139|ref|WP_044639571.1| antitoxin [Siansivirga zeaxanthinifaciens]  clstr ali  35  1MGKNTSISLGNHFEDFIRKEINSGRYSSASEVIRSALRLLEREEKKERELIKALEVGENSGFVENFDP............ 68
660 2.000e-16gi|821565837|gb|KKZ84066.1| hypothetical protein RPHASCH2410_PD03960 (plasmid) [Rhizobium phaseoli Ch24-10]  clstr ali  29  9.SRIISADLGKQLETYIQQLVDTGRYGSKSEVLREGVRLVQDRETRLAALDASILRGIADAEAGRTKPDVFDRLEAKYSA 89
661 2.000e-16gi|558562164|ref|WP_023492668.1| hypothetical protein [Serratia sp. DD3]  clstr ali  37  3....TSVALSPYFEAFIREQIASGRYNNTSEVIRAGLRALEEREQKLESLQKAVSAGINSGESKEAEP-VFNRLTRKYR. 78
662 2.000e-16gi|521996781|ref|WP_020508052.1| hypothetical protein [Lamprocystis purpure