current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: gi|40548796|ref|NP_395146.2| hypothetical protein (YPCD1.09c) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
1 -13.900d2hzaa1 a.43.1.3 (A:1-48) Nickel responsive regulator NikR, N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  32  2..QRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEA................................... 44
2 -13.300d2wvfa1 a.43.1.0 (A:9-60) automated matches {Helicobacter pylori [TaxId: 85962]}  ali model 3D-neighbors follow..  30  3..IRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIR.......................................... 38
3 -12.800d2bj7a1 a.43.1.3 (A:1-50) Nickel responsive regulator NikR, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  27  4..IRFSISIPSKLLEKFDQIIEEIGYENRSEAIRDLIR.......................................... 39
4 -5.970d1rp3b_ a.137.11.1 (B:) Anti-sigma factor FlgM {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  10  37........................TLSKIAQELSKNDVEEKDLEKKVKELKEKIEKGEYEVSDEKVVKGLIE........ 84
5 -5.710d3ai2a_ c.2.1.0 (A:) automated matches {Gluconobacter frateurii [TaxId: 38308]}  ali model 3D-neighbors follow..  13  202LTKDNGGDWKGYLQSVADEHAPIKRFASPEELANFFVFLCSERATYSVGSAYFVDGGM...................... 259
6 -5.650d3br0a2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  1..KTNREKFYLYNELSLTTEYYYPLQNAIIEFYTE--KMNKLQNKYIDAYHVIFKEGNLNGEWSINDVNAVS........ 77
7 -5.350d1ui5a2 a.121.1.1 (A:80-212) A-factor receptor homolog CprB {Streptomyces coelicolor [TaxId: 1902]}  ali model 3D-neighbors follow..  19  2..........SSLEALMRLTFGMARLCVQGPVLRAGLRLATAGVP-REIATSRLLDAVRQSD.................. 64
8 -5.250d3d3wa_ c.2.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  194..........PHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGG....................... 240
9 -5.130d1qdla_ d.161.1.1 (A:) Anthranilate synthase aminodeoxyisochorismate synthase/lyase subunit, TrpE {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  11  277LARNDLGKVCVPGTVKVPELMYVEKYSHVQHIVSKVIGTLKKKYNALNVLSATFPAGTVSGAPKPMAMNIIETLEEYKR. 355
10 -5.090d4po5b_ a.1.1.3 (B:) automated matches {Synechocystis sp. [TaxId: 1111708]}  ali model 3D-neighbors follow..  13  1........MQDAITAVINSADVQGKYLDGAAMLKSYFASGELRVRAASVISA............................ 46

FFAS is supported by the NIH grant R01-GM087218-01
9 8 9 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.