current user: public

anford Burnham Prebys Medical Discovery Institute

Query: gi|40548796|ref|NP_395146.2| hypothetical protein (YPCD1.09c) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
1 -48.200PF03693.12; PARD1_MYCTU/1-80; Bacterial antitoxin of ParD toxin-antitoxin type II system and RHH  ali follow..  33  1MGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS 80
2 -11.900PF01402.19; Q8ZX60_PYRAE/47-86; Ribbon-helix-helix protein, copG family  ali follow..  32  2....ISVHVPKKMLEELDELVRRGIFPNRSEAIRAALR.......................................... 35
3 -6.370PF15606.4; RHSA_ECOLI/1298-1372; Bacterial toxin 34  ali follow..  15..................NVADTGITDRVNDIINDRFWSDGKKPDRCDVLQELIDCGDISAKDAKSTQKAWNCRHSRQS. 75
4 -6.250PF14028.4; C7QBX6_CATAD/12-341; Lantibiotic biosynthesis dehydratase C-term  ali follow..  27  9.ASSTRPLLTECVRPMVDGLVADGNYWLEGPHLR--LRLKPSSMAAVDPVRRRASAAIED.................... 73
5 -6.010PF05261.9; A6TIF7_KLEP7/3-128; TraM protein, DNA-binding  ali follow..  23  1MAKIVSDEVAEKINAIVEKRKAEGAREKSTMLVELGLRVYEAQMER.................................. 56
6 -5.970PF15919.3; E1VAV2_HALED/3-129; HicB_like antitoxin of bacterial toxin-antitoxin system  ali follow..  28  90.SHKINVTLPELLIKRIDTAVAK-VYQSRSGFLSRA............................................ 126
7 -5.960PF17014.3; L2GNM3_VITCO/15-143; Putative Mad3/BUB1 like region 1 protein  ali follow..  38.HKQISTFYHWIYLELSQHFLKKSQPQIAHFILHEALKNNVYDATRIKEAIEKIPP........................ 92
8 -5.640PF14514.4; A7HP78_PARL1/92-221; Transcriptional regulator, TetR, C-terminal  ali follow..  23..........PYLYRLLAALMRDASDETARDIAQFFAQPL------ARAAQGLMEAGIANGSIRPLDPQLF......... 77
9 -5.580PF15389.4; I3JX15_ORENI/2-111; Domain of unknown function (DUF4612 topsan)  ali follow..  30  77.GKILSIHSSESQQEFLDEKIEKGRYCSEEE................................................. 110
10 -5.410PF06018.12; Q834K5_ENTFA/3-183; CodY GAF-like domain  ali follow..  15  125..RLGTIILARVEKSFNEDDLVLAEYSAT-QILYHQSRTIEAEVRSATAVQMAI.......................... 179

FFAS is supported by the NIH grant R01-GM087218-01
9 4 2 5 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.