current user: public

Query: gi|40548796|ref|NP_395146.2| hypothetical protein (YPCD1.09c) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
1 -40.800PF03693.9; PARD_MYCBO/1-81; Uncharacterised protein family (UPF0156 topsan)  ali follow..  36  1MGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDDGFLGRKRADAS. 80
2 -6.490PF03925.8; A6VMY4_ACTSZ/1-209; SeqA protein  ali follow..  33  3.....IIEVDEELYQFIASHTQSGE--SASDILRRLLNL......................................... 35
3 -5.840PF07704.6; Q1QF44_NITHX/1-84; Rv0623-like transcription factor  ali follow..  1....MALSIKDPETEKLARALAQRTGETITVATRRAIEERLKRTESQARKAALLED........................ 52
5 -5.580PF00439.20; Q8N4B3_HUMAN/134-202; Bromodomain  ali follow..  26  28................IQEKVNEGKYRSYEEFKADAQLLLHN...................................... 53
6 -5.370PF13034.1; B7GJY9_ANOFW/358-435; Protein of unknown function (DUF3895 topsan)  ali follow..  17  1........LDELLQNSIFDYVQSASIISAKELSVYLVDKCNAPNETFSTGRYKI.......................... 46
7 -5.320PF04288.8; B3XGP8_ECOLX/19-243; MukE-like family  ali follow..  15  1MPVKLAQALANPLFPALDSALRSGRHIGLDEL--DNHAFLMDFQEYLEEFYARY.......................... 52
8 -5.300PF01368.15; Q8Y6V6_LISMO/8-153; DHH family  ali follow..  89.KALIKIDHHPNDDAYGDLLWVDTTASSCSEMIVAFWEMFSDELILNETAARLLYAGI...................... 145
9 -5.230PF14028.1; C7QBX6_CATAD/12-335; SpaB C-terminal domain  ali follow..  27  9.ASSTRPLLTECVRPMVDGLVADGNYWLEGPHLR--LRLKPSSMAAVDPVRRRASAAIED.................... 73
10 -5.180PF06514.6; A3YXE0_9SYNE/34-124; Photosystem II 12 kDa extrinsic protein (PsbU)  ali follow..  15  26.......QFPGMYPTLAGKIVIGGPYDEIDDVLALDL------DRQKELFEKYKDS........................ 69

FFAS is supported by the NIH grant R01-GM087218-01
6 0 5 7 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.