current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: gi|16082715|ref|NP_395161.1| secreted effector protein (YPCD1.26c) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .
# Score Template Links and tools%idFirst MFINPRNVSNTFLQEPLRHSSNLTEMPVEAENVKSKTEYYNAWSEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNSLTELPELPQSLKSLLVDNNNLKALSDLPPLLEYLGVSNNQLEKLPELQNSSFLKIIDVDNNSLKKLPDLPPSLEFIAAGNNQLEELPELQNLPFLTAIYADNNSLKKLPDLPLSLESIVAGNNILEELPELQNLPFLTTIYADNNLLKTLPDLPPSLEALNVRDNYLTDLPELPQSLTFLDVSENIFSGLSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALPPRLERLIASFNHLAEVPELPQNLKQLHVEYNPLREFPDIPESVEDLRMNSERVVDPYEFAHETTDKLEDDVFELast
1 -75.9001g9u_A mol:protein length:454 OUTER PROTEIN YOPM  ali model follow..  94  1MFINPRNVSNTFLQEPLRHSSNLTEMPVEAENVKSKTEYYNAWSEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNSLTELPELPQSLKSLLVDNNNLKALSDLPPLLEYLGVSNNQLEKLPELQNSSFLKIIDVDNNSLKKLPDLPPSLEFIAAGNNQLEELPELQNLPFLTAIYADNNSLKKLPDLPLSLESIVAGNNILEELPELQNLPFLTTIYADNNLLKTLPDLPPSLEALNVRDNYLTDLPELPQSLTFLDVSENIFSGLSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALPPRLERLIASFNHLAEVPELPQNLKQLHVEYNPLREFPDIPESVEDLRMNSHLAEVPELPQNLKQLHVETNPLR 409
2 -57.3004ow2_A mol:protein length:448 Yop effector YopM  ali model follow..  48  50LSSLPELPP--HLERLVASCNSLTELPELPQSLKSLE----VYENNLKALPDLPPLLVDLRVFN-ELQNLPFLTEIYANNNSLKTLPDLPPSLVDLNVRENYLTALPELPQSLIFLDISDNILSGLSELPPNLSCLDASRNGIRSLCDL--PPSLVYLDVRDNQLIELPALPSGLERLIASFNHLAELPELDLPPSLVDLNVRKNQLIELPALPPDLERLIASFNHLAELPEL--PPNLSYLDASRNEISSLCDLPPSLVDLNVRKNQLIELPALPPDLERLIASFNHLAELPELPPNLSYLDASRNEISSLCDLPPSLVELDVRDNQLIELPALPPHLERLIASLNHLAEVPELPQNLKQLHVEHNALREFPDIPESVEDLRM......................... 447
3 -47.0003g06_A mol:protein length:622 SspH2 (Leucine-rich repeat protein)  ali model follow..  28  1..................................................................................................GPVDPAEYDAVWSAWRRAAPAEESRGRAAVVQNGNAVLNVGESGLTTLPD-CLPAHITTLVIPDNNLTSLPALPPELRTLEVSGNQLTSLPVPPGLLELSIFSNPLTHLPALPS---GLCKLWIFGNQLTSLPV--LPPGLQELSVSDNQLASLPALPSELCKLWAYNNQLTSLPMLPSGLQELSVSDNQLASLPTLPSELYKLWAYNNRLTSLPALPSGLKELIVSGNRLTSLPVLPSELKELMVSGNRLTSLPMLPSGLLSLSVYRNQLTRLPESLIHLSSETTVNLEGNPLSERTLQALREITS.... 309
4 -42.8004u09_A mol:protein length:401 LIC12759  ali model follow..  22  8YKNLAKALQNPDVRNLDLSFQGLKTLPNKIGQLKNLQKLD-LGGNEPTILSKEIWQL-------------KDLQKLNLNNNKLTVLPKEIGNLQELSLHSNELVNLPKEIGQFKNLQKLNLDNNKLTVLPKNLQELSLLSNKLISLPEIEQLKSLKNLDLNHNEFTTVSKEVMTLENLDLRSNKLKTIPEIRQLKSLKVLMLTGNQLTSLPKEIQNLKTLNLGENRFQIFPEILELKNLLELNLYYNQLVEFPKEVGQLKSLKLYHNQITTLPVEVTQLP-----------------DLQELHLSGNKITILPKELKNLEWLSLSNNKLNALPKEIGQLK-----------------KLQRLELGNNQLTTLPKEIEQLKNLQRLELDSNPISPKEPKCEIDFEGGGGE 401
5 -41.7005il7_A mol:protein length:1102 Rab family protein  ali model follow..  20  7IRQIEQELGMEPVDKLKWYSKGY--KLDKDQRVTAIGLYD-CGSDTLDRIIQPLESL-------------KSLSELSLSSNQITDISPLLNSLSMLWLDRNQITDIAPLLNSLSMLWLFGNKISDIAPLEKSLTELQLSSNQITDIAPLASLKSLTELSLSGNNISDIAPLLKSLTELSLSSNQITDIAPLASLKSLTELSLSSNQISDIAPLLKSLTELQLSRNQISDIAPLESLKSLTELQLSSNQITDIAPLLKSLTELQLSRNQISDIAPLLNSLSKLWLNGNQITDIAPLLNSLTELELSSNQITDIAPLLKSLSTLWLSSNQISDIAPLLESLSELSLSSNQISDISPLLNSLTGFDVRRNPIKRLPETITGFD--------EILWNDFSSSGFITFFDNPLE 416
6 -41.7004u08_A mol:protein length:398 LIC11098  ali model follow..  24  9YRNITEALKNPNVRILNLSGSKLTTLPGEIGKLQNLQLLN-LDDNQLIALPKEIGKL-------------QNLQQLHLSKNQLMALPEEIQNLQKLKLYENQLTAIPKEIGQLQNLQELNLAHNQLATLPERLQTLYLGHNQFNSILEIGQLQNLESLGLDHNQLNVLPKEIGNLESLGLDHNQLNVLPEIGQLQNLQILHLRNNQLTTLPKEIGNLQKLLLNKNKLTTLPEIGQLQNLQKLKLYENQLTTLPKEIQNLQELDLDGNQLTTLPENIGQLQ-----------------RLQTLYLGNNQLNFLPKEIRNLESLDLEHNQLNALPKEIGKLQ-----------------KLQTLNLKYNQLATLPEEIKQLKNLKKLYLHNNPLPSEKIARIRKLLP.... 390
7 -38.3004ecn_A mol:protein length:876 Leucine-rich repeat protein  ali model follow..  15  336KGRVPDAIGQLELKVLSFGTHSETVSGRLFGDEELTPDM-SEERKHRIRMHYKKMFLDYDQRLNLSDLLQTKLQIIYFANSPFTYDNIAVDWEDANSDYAKQYENEELSWSNLKDLTDVEYNCPNMTQLPPELQSLNIACNRGISAAQEDTGPKIQIFYMGYNNLEEFPASMVKLGLLDCVHNKVRHLEAFGTNVKLTDLKLDYNQIEEIPEDFDQVEGLGFSHNKLKYIPNAKSVYVMGSVDFSYNKIGSEGRNISNASTVTLSYNEIQKFPTELSPISTIILSNNLMTSIPE-TYLLTTIDLRFNKLTSLSDTLPYLSNMDVSYNCFSSFPTQPPSLIQLQIGSNDIRKVDELTPQLYILDIADNPNISIDTSVCPYIEAGMYVLLYDKTQDIRGCDALGIER.... 876
8 -38.2004eco_A mol:protein length:636 Uncharacterized protein  ali model follow..  17  94SGRVPDAIGQLELEVLALGSHGEKFGPKGISANMSDEQKQKMRSNNITFVSKAVMRLTKLRQFYMGNSPFVAENICEAWEQQYKTEDLKWDNLKDLTYNCPNLTKLPTFLKALPEMQLINVACNRGISGEEKIQIIYIGYNNLKTFPSLQKMKKLGMLECLYNQLEGKLPAFGKLASLNLAYNQITEIPACGFTEQVENLSFAHNKLKYIPNIVSVMSAIDFSYNEIGSVDTPFKGINVSSINLSNNQISKFPKELSPLSSINLMGNMLTEIPK-TYLLTSIDLRFNKLTKLSDTLPYLVGIDLSYNSFSKFPTQPLNSSTLK-GNRTLREWPEGIPSLTQLQIGSNDIRKVNKITPNISVLDIKDNPNISILSYVCPYIEAGMYMLFYDKTQDIRGCDALDIKR.... 636
9 -37.5004puf_A mol:protein length:637 E3 ubiquitin-protein ligase SlrP  ali model follow..  33  7.................................KDAVNYELIWSEWVKEAPAKEAANREEAVQRMRDCLKNNKTELRLKILGLTTIPAIPEQITTLILDNNELKSLPELQGNIKTLYANSNQLTSIPALPDTIQEMELSINRITELPE-RLPSALQSLDLFHNKISCLPELPEELRYLSVYDNSIRTLPA-HLPSEITHLNVQSNSLTALPELPPGLKTLEAGENALTSLPA-SLPPELQVLDVSKNQITVLPTLPPTITTLDVSRNALTNLPELPAALQIMQASRNNLVRLPE-------------SLPHFRGEGPQPTRIIVEYNPFSERT............................................................................ 297
10 -37.4004ufr_A mol:protein length:484 LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUP  ali model follow..  21  29LSELPSNLSV-FTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGA---------------LYSLKVLMLQNNQLRHVPT-LRSLQSLRLDANHISYVPPCFSGLHSLRHLWLDDNALTEIPSALQAMTLALNKIHHIPDFGNLSSLVVLHLHNNRIHSLGK-LHSLETLDLNYNNLDEFPTIRTLSNLKELGFHSNNIRSIPE-NPSLITIHFYDNPIQFVGRFQHLPELRTLTLNGASQITEFPDTANLESLTLTGAQISSLPQ-LPNLQVLDLSYNLLEDLPSFCQKLQKIDLRHNEIYEIKV-LLSLRSLNLAWNKIAIIHP-LPSLIKLDLSSNLLSSFPTGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCCAFGV........... 456
11 -37.2003a79_A mol:protein length:580 Toll-like receptor 2, Variable lymphocyte rec  ali model follow..  16  43FTSIPSGL--AAMKSLDLSFNKITYIGHGDLRACANLQVLILKSSRINTIEGDAFY-------------LGSLEHLDLSDNHLSSLSS-LSSLKYLNLMGNPYQTLGV-LTNLQTLRIGNVETFSEIR--TSLNELEIKALSLRNYQSLKSIRDIHHLTLHLSESAFLLEILSSVRYLELRDTNLARFQFILELSEVEFDDCTLNGLGDFNPETVTIRRLHIPQFYLFYDLSYSLLEKVKRITVENSKVFLVPQHLKSLEFLDLSENLMVEEYGAWPSLQTLVLSQNHLRSMQKTGKNLTSLDISRNTFHPMPDSPEKMRFLNLSSTGIRVVKTIPQTLEVLDVSNNNLDSFSLFLPRLQELYISRNKLKTLPDLFPVLLVMKIASNQLKSVPRLTSLQKIWLHTNPWD 536
12 -37.2004li1_B mol:protein length:432 Leucine-rich repeat-containing G-protein coup  ali model follow..  22  28LVTVPDGLSV-FTHSLDLSMNNITKLPEGAFKGFPYLEELRLAGNDLSIIHPMA-------------SGLKELKVLTLQNNQLKTVPS-LVSLQSLRLDANHIVTVPESFEGLVQLRHLWLDDNSLTEVPPSLQALTLALNKISHIPDFSNLSSLVVLHLHNNKIRTLGPHLDNLEALDLNYNNLIDFPDIRSLPNLKELGFHSNSITIIPD-NPLLRTIHLYDNPLSFVGNFQNLSDLHFLIIRGASNVQWFPNTNNLESLTLTGTKIRSIPI-QKMLRTLDLSYNEISALVGFCSSLEEVYLQNNQIQEVQN-LAALRMLDLSRNRIHTIHK-LKALTNLDLSFNDLTAFPAGLHGLNQLKLTGNPNFKET.................................... 430
13 -37.1004kt1_A mol:protein length:504 Leucine-rich repeat-containing G-protein coup  ali model follow..  22  23LTAVPEGLSA-FTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKA---------------LKELKVLTLQNNQLKTVPS-LSALQSLRLDANHITSVPDSFEGLVQLRHLWLDDNSLTEVPPTLQALTLALNKISSIPDFTNLSSLVVLHLHNNKIRSLSQ-LDNLETLDLNYNNLGEFPQIKALPSLKELGFHSNSISVIPD-NPLLRTIHLYDNPLSFVGNFHNLSDLHSLVIRGASMVQQFPNTVHLESLTLTGTKISSIPN-QKMLRTLDLSYNNIRDLPSFCHALEEISLQRNQIYQIKE-LISLRILDLSRNLIHEIHS-LGPITNLDVSFNELTSFPTGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCGCDSYANLNTEDNSLQ 465
14 -36.6004u06_A mol:protein length:344 LIC10831  ali model follow..  25  2YRDLTKALQNPEVRVLDLSRQELKTLPIEIGKLKNLQRLY-LHYNQLTVLPQEIEQL-------------KNLQLLYLRSNRLTTLPKEIENLQVLDLGSNQLTVLPQEIGQLKNL-----------------QLLYLHSNRLTTLSDIEQLQNLKSLDLSNNQLTTLPNEIENLKSLYLSENQFATFPEIGQLQNLKVLFLNNNQITILPNEIKKLQYLYLSDNQLITLPEIEQLKNLQTLDLSYNQLMILPKEVGQLE-----------------NLQTLDLRNNQLKTLPKEIEQLK-----------------NLQTLFLSNNQLTILPQEIGKLK-----------------NLLWLSLVYNQLTTLPNEIEQLKNLQTLYLNNNQFSSQEKKRIRKLLP.... 337
15 -36.6004qxe_A mol:protein length:443 Leucine-rich repeat-containing G-protein coup  ali model follow..  20  6....AAPCSCDGDRRVDCSGKGLTAVPE---GLSAFTQALDISMNNITQLPEGAFK-------------FPFLEELQLAGNDLSFIHP-LKELKVLTLQNNQLKTVPEAIRGLSALQSLRLDANHITSVPEQLRHLWLDDNSLTEVPVLSNLPTLQALTLALNKISSIPD-LSSLVVLHLHNNKIRSLSQFDGLDNLETLDLNYNNLGEFPQALPSLKELGFHSNSISVIPDFDGNPLLRTIHLYDNPLSFVGN-LSDLHSLVIRGASMVQQFPNTVHLESLTLTGTKISSIPN-QKMLRTLDLSYNNIRDLPSFCHALEEISLQRNQIYQIKE-LISLRILDLASNQLKSVPD-LTSLQKIWLHTNPWDCSCPRIDYLSRW........................... 414
16 -36.6005ijb_A mol:protein length:594 Toll-like receptor 4, Variable lymphocyte rec  ali model follow..  14  19LSKVPDDI--SSTKNIDLSFNPLKILKSYFSNFSELQWLDLSRCEIETIEDKAWHGLHHLSNLILTGNPLTSLENLVAVETKLASLES-LITLKKLNVAHNFIHSCKSNLTNLVHVDLSYNYIQTLRENPQVNLSLDMSLNPIDFIQD--CDVTIDEFRLTYTNDFSDDHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPLDLPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGC-TNSLRHLDLSFNGAIIMSANLEELQHLDFQHSTLKRVTEFLEKLLYLDISYTNTKIDFD-LTSLNTLKMAGNSFKDN-ANTTNLTFLDLSKCQLEQISW-LHRLQLLNMSHNNLLFLDS-LYSLKELALDTNQLKSVPDLTSLQKIWLHTNPWD 554
17 -36.3001o6s_A mol:protein length:466 INTERNALIN A  ali model follow..  18  2...........PLGSATITQDTPINQIFTDTALAEKMKTVLGKTNVTDTVS--QTDLDQVTTLQADRLGLNNLTQINFSNNQLTDITPLLTKLVDILMNNNQIADITPLLTNLTGLTLFNNQITDIDPLKTNLNRLELSSNTISDISALSGLTSLQQLSFG-NQVTDLKPLLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLLTNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAPLLTKLTELKLGANQISNISPLLTALTNLELNENQLEDISPILKNLTYLTLYFNNISDISPVLTKLQRLFFYNNKVSDVSSLLTNINWLSAGHNQISDLTPLLTRITQLGLNDQAWTNAPVNYKANVSIPNTVKNVTTISDGGSYTEPDITWNLPS 434
18 -36.2004kng_A mol:protein length:531 Leucine-rich repeat-containing G-protein coup  ali model follow..  22  28LSELPSNLSV-FTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFT-------------LYSLKVLMLQNNQLRHVPTELRSLQSLRLDANHISYVPSCFSGLHSLRHLWLDDNALTEIPSALQAMTLALNKIHHIPDFGNLSSLVVLHLHNNRIHSLGKKLHSLETLDLNYNNLDEFPTIRTLSNLKELGFHSNNIRSIPE-NPSLITIHFYDNPIQFVGRFQHLPELRTLTLNGASQITEFPDTANLESLTLTGAQISSLPQ-LPNLQVLDLSYNLLEDLPSFCQKLQKIDLRHNEIYEIKV-LLSLRSLNLAWNKIAIIHP-LPSLIKLDLSSNLLSSFPTGLHGLTHLKLTGNHALQSLISSENFPELKVIEM...................... 444
19 -36.0003oja_B mol:protein length:597 Anopheles Plasmodium-responsive Leucine-rich  ali model follow..  20  6............................................................................................RYNVKPRQPEYKCIDSNLQYDCVFYDVHIDMQTQDVYFNNQKIVTFKNSTMRKLPALDSFRQVELLNLNDLQIEEIDT-AHTIQKLYMGFNAIRYLPPFQNVPLLTVLVLERNDLSSLPR-TPKLTTLSMSNNNLERIEDFQATTSLQNLQLSSNRLTHVDSLIPSLFHANVSYNLLSTLAIPI-AVEELDASHNSINVVRPVNVELTILKLQHNNLTDTAWLYPGLVEVDLSYNELEKIMY-MQRLERLYISNNRLVALNLYIPTLKVLDLSHNHLLHVERNQPQFDRLENLYLDHNSIVTLKTLKNLTLSHNDWD 358
20 -36.0004r5c_A mol:protein length:304 Leucine rich repeat protein  ali model follow..  24  3.....................................................................................................................TVSTPIKQIFPDDAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGILPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPEKLTNLTTLNLSNNQLTSLPQFERLASLTTLNLSNNQLTSLPERLTNLTTLNLSNNQLTSLPERLTNLTTLNLSNNQLTSLPQ-LTSLHTLDLSNNGITDISALLDNLHTLDLSNNGITDISALLDNLHTLDLSNNGITDISALLTSLHTLDLSNNGITDISA-----------------LKNLDNLETLDLRNNGI. 304
21 -35.8004bsr_A mol:protein length:539 LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUP  ali model follow..  20  1.............ENLYFQGSGSSPRSGVLLRGCPTHCHCEPDGRMLLRV-----DCSDLGLSELPSNLSVFTSYLDLSMNNISQLLP-LRFLEELRLAGNALTYIPKAFTGLYSLKVLMLQNNQLRHVPRSLQSLRLDANHISYVPPFSGLHSLRHLWLDDNALTEIPV-LSALQAMTLALNKIHHIPDFGNLSSLVVLHLHNNRIHSLGKKLHSLETLDLNYNNLDEFPTIRTLSNLKELGFHSNNIRSIPE-NPSLITIHFYDNPIQFVGR-LPELRTLTLNGASQITEFPDTANLESLTLTGAQISSLPQ-LPNLQVLDLSYNLLEDLPSFCQKLQKIDLRHNEIYEIKV-LLSLRSLNLAWNKIAIIHNAFSTLPSLIKLDLSSNLLSSFPGLTHLKLTGNHAL 443
22 -35.8002z7x_A mol:protein length:549 Toll-like receptor 2, Variable lymphocyte rec  ali model follow..  16  17LNSIPSGL--EAVKSLDLSNNRITYISNSDLQRCVNLQALVLTSNGINTIEEDS-------------SSLGSLEHLDLSYNYLSNLSKPLSSLTFLNLLGNPYKTLGE-LTKLQILRVGNMDTFTKIQ--TFLEELEIDASDLQSYEPLKSIQNVSHLILHMKQHILLLEITSSVECLELRDTDLDTFHEFDDCTLNGVGNFRASDNDRVIDPTLTIRRLHIPRFYLFYDLSYSLTERVKRITVENSKVFLVPQHLKSLEYLDLSENLMVEEYDAWPSLQTLILRQNHLASLEKTGKNLTNIDISKNSFHSMPETPEKMKYLNLSSTRIHSVTGIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLMTLPDLLPMLLVLKISRNQLKSVPDLTSLQKIWLHTNPWD 510
23 -35.6004nkg_A mol:protein length:246 E3 ubiquitin-protein ligase sspH1  ali model follow..  30  2...............................................................................................................................................................................................AEYDAVWSKWERDAPAGESPGLNNGNPVLNVGASGLTTLPD----PHITTLVIPDNNLTSLPELPEGLRELEVGNLQLTSLPSLPQGLQKLWAYNNWLASLPTLPPGLGDLAVSNNQLTSLPEMPPALRELRVSGNNLTSLPALPSGLQKLWAYNNRLTSLPEMSPGLQELDVSHNQLTRLPQSLTGLSSAARVYLDGNPLSVRTLQALRDI...... 224
24 -35.5003a79_B mol:protein length:562 Toll-like receptor 6, Variable lymphocyte rec  ali model follow..  15  43LTHVPKDLPP-RTKALSLSQNSISELRMPDISFLSELRVLRLSHNRIRSLDFHVFL-------------NQDLEYLDVSHNRLQNISCPMASLRHLDLSFNDFDVLPGNLTKLTFLGLSAAKFRQLDLLHLSCILLDLVSYHIKGGEESLQIPNTTVLHLVFHPNSLFSVQVNALGHLQLSNIKLNDENELTRGPTLLNVTLQHIETTWKCSVPRPVEYLNIYNLTITERIDETALKSLMIEHVKNQVFLFSKEAFAEMNIKMLSISDTPFIHPSPSSFTFLNFTQNVFTDSVSTLKRLQTLILQRNGLKNFFKVMSSLETLDVSLNSLNSHAAWAESILVLNLSSNMLTGSVCLPPKVKVLDLHNNRIMSIPKDVTHLQALQELNVASNQLKSVPSLQYIWLHDNPWD 510
25 -34.9003vq1_A mol:protein length:606 Toll-like receptor 4  ali model follow..  16  23LSKVPDDIPS-STKNIDLSFNPLKILKSSFSNFSELQWLDLSRCEIETIEDKAWHGLHHLSNLILTGNPLTSLENLVAVETKLASLESFLITLKKLNVAHNFIHSCKSNLTNLVHVDLSYNYIQTLRENPQVNLSLDMSLNPIDFIQDLQNLAGLHVHRLILGEFKDERNLLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPTLLPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGC-TNSLRHLDLSFNGAIIMSANLEELQHLDFQHSTLKRVTEFLEKLLYLDISYTNTKIDFD-LTSLNTLKMAGNSFKDN-ANTTNLTFLDLSKCQLEQISW-LHRLQLLNMSHNNLLFLDSHYNQLYSLSTLDCSFNRIETPKSLAFFNLTNNSVA 558
26 -34.9005d3i_A mol:protein length:568 Toll-like receptor 2  ali model follow..  17  21FTSIPSGLTA-AMKSLDLSFNKITYIGHGDLRACANLQVLILKSSRINTIEGDAFY-------------LGSLEHLDLSDNHLSSLSS-LSSLKYLNLMGNPYQTLGV-LTNLQTLRIGNVETIDFAGLTS-LNELEIKALSLRNYQSLKSIRDIHHLTLHLSESAFLLDILSSVRYLELRDTNLARFQFILELSEVEFDDCTLNGLGDFNPSTVTIRRLHIPQFYLFYDLSYSLLEKVKRITVENSKVFLVPQHLKSLEFLDLSENLMVEEYGAWPSLQTLVLSQNHLRSMQKTGKNLTSLDISRNTFHPMPDSPEKMRFLNLSSTGIRVVKCIPQTLEVLDVSNNNLDSFSLFLPRLQELYISRNKLKTLPDLFPVLLVMKIRENAVSTFSSFPKLETLEAGDNHFV 514
27 -34.8003oja_A mol:protein length:487 Leucine-rich Immune Molecule 1  ali model follow..  12  1..AIHEIKQNGNYKIEKVTDSSLKQALASLRQSAWNVKELDLSGNPLSQISAAD-------------APFTKLELLNLSSNVLYETLDLLSTLRTLDLNNNYVQELLVGP-SIETLHAANNNISRVSSRGQGKKNIYLANNKITMLRDEGCRSRVQYLDLKLNEIDTVNASSDTLEHLNLQYNFIYDVKGQVVFAKLKTLDLSSNKLAFMGPEAAGVTWISLRNNKLVLIEKLRFSQNLEHFDLRGNGFHCGTPFADRLIALKRKEHALLSGQERLECERENQARQREIDALKE-IDQVTLRKQAKITLEQKKKALDGTLQQAVGQIELQHATEEQSPLQLLRKRYEEMYVEQQSNNAIRDWDMYQHKETQLAEENARLKKLNGEADLALASAN-ATLQELVVREQNLA 483
28 -34.8004fmz_A mol:protein length:347 Internalin  ali model follow..  17  2........................................................................AATLATLPAPINQIFPDLAEGIRAVLQKASVTDVVTQLESITKLVVAGEKVASIQGIETNLEYLNLNGNQITDISPLSNLVKLTNLYIGTNKITDISALLTNLRELYLNEDNISDISPLANLTKMYSLNLGANHNLSDLSPLSGLNYLTVTESKVKDVTPIANLTDLYSLSLNYNQIEDISPLLTSLHYFTAYVNQITDITPVMTRLNSLKIGNNKITDLSPLLSQLTWLEIGTNQISDINAVLTKLKMLNVGSNQISDISVLLSQLNSLFLNNNQLGNEDGGLTNLTTLFLSQNHITDIRP-----------------LASLSKMDSADFANQVIK 346
29 -34.6004psj_A mol:protein length:271 OR464  ali model follow..  23  1............................................................................................MGTITVSTPIKQIFPD-------------------DAFAETIKANLKKKSVTDAVTQNELNSIDQINANNSDIKSVQGILPNVRQLNLGGNKLHDISALKELTNLGWLNLSSNKIEKLPESLTTLTQLNLSNNQITSLPQFESLASLTQLNLSNNQITSLPQ-LTNLTQLNLSNNQITSLPQ-LTNLTQLNLSNNQITSLPQ-LTSLTQLNLSNNQITSLPESLTNLKQLNLSGNQIQSLPQGLESLTQLTGS................................................................ 259
30 -34.6002z63_A mol:protein length:570 Toll-like receptor 4, Variable lymphocyte rec  ali model follow..  16  19FYKIPDNL--FSTKNLDLSFNPLRHLGSYFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPLSSLQKLVAVETNLASLENFLKTLKELNVAHNLIQSFKSNLTNLEHLDLSSNKIQSLHQMPLLNLSLDLSLNPMNFIQPIQGLAGLEVHRLVLGEFRNEGNLLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGFGTTSLKYLDLSFNGVITMSSNLEQLEHLDFQHSNLKQMSEFLRNLIYLDISHTHTRVAFN-LSSLEVLKMAGNSFQEN-TELRNLTFLDLSQCQLEQLSP-LSSLQVLNMASNQLKSVPD---------------GIFDRLTSLQKIWLHTNPWD 531
31 -34.5004pq8_A mol:protein length:271 DESIGNED PROTEIN OR465  ali model follow..  26  1.................................................................................................MGTITVSTPIKQIFPDDAFA--------------ETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGILPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPEKLTNLTTLNLSNNQLTSLPQFERLASLTTLNLSNNQLTSLPERLTNLTTLNLSNNQLTSLP----------------QGVFERLTNLTTLNLSNNQLTSLPERLTSLTTLNLSNNQLTSLPERLTNLKTLNLSNNQLQSLPTGVEKLTQLTGS............................................ 259
32 -34.5004r6g_A mol:protein length:464 leucine rich repeats DLRR_K  ali model follow..  26  1...................TITVSTPKQIFPDDAFAETIKANLKKKSVTDAVTQNEL-------------NSIDQIIANNSDIKSVQGILPNVRYLALGGNKLHDISAL-KELTNLGWLNLSNNQLETLPQNLTTLNLSNNQLTSLPQFERLASLTTLNLSNNNLANLNDRLTNLTTLNLSNNNLARLWKLKGLTNLTTLNLSNNGFDELPKELTSLTTLNLSNNQLTSLPQFERLTNLTTLNLSNNQLTSLPQ-LTNLTTLNLSNNQLTSLPQ-LTSLTTLNLSNNQLTSLPK-LTNLKTLNLSNNQITKEVKQAASLHELHLSNNNIGEEGAAGSTLETLDLSNCNLTKEAC-ATTLHELHLSNNNIGEEEALLHPGSTLETLDLSNCNLTKEASLHELHLSNNNIG 463
33 -34.1004lxr_A mol:protein length:783 Protein toll  ali model follow..  20  48..........VQIMCNLTDTTDYQQLPKKLRDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMGLKRFRFTTRRLTHIPA-MRNLSHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMPPKLKQLNLWSNQLHNLTKFEGATSVLGIDIHDNGIEQLPH-LTNVTDINLSANLFRSLPQFDHNKHLNEVRLMNNRVSRLFANQPELQILRLRAE-LQSLPGFEHSTQITNISLGDNLLKTLPATLVNLLSLDLSNNRLTHLPD-TTNLTDLRLEDNLLTGISG-LGNLVTLVMSRNRLRTIDS-TNGLRHLHLDHNDIDLQQPLMHGLLTLNLRNNSIIFVYN-MLQLRELDLSYNNISSLGYLSQNRLHVNMTHNKIRRIAYNNNLVHVDLNDNPLV 537
34 -33.9004g8a_A mol:protein length:635 Toll-like receptor 4  ali model follow..  16  43FYKIPDNLPF-STKNLDLSFNPLRHLSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPLSSLQKLVAVETNLASLENFLKTLKELNVAHNLIQSFKSNLTNLEHLDLSSNKIQSLHQMPLLNLSLDLSLNPMNFIQPIQGLAGLEVHRLVLGEFRNEGNLLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSISLKYLDLSFNGVITMSSNLEQLEHLDFQHSNLKQMSEFLRNLIYLDISHTHTRVAFN-LSSLEVLKMAGNSFQEN-TELRNLTFLDLSQCQLEQLSP-LSSLQVLNMSHNNFFSLTFPYKCLNSLQVLDYSLNHIMTSSSLAFLNLTQNDFA 580
35 -33.8004r6j_A mol:protein length:254 Lucine rich repeats DLRR_H  ali model follow..  29  1............................................................................................................................................................TITVSTPIKQIFPDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGILPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQ-LTNLTTLNLSNNQLTSLPQ-LASLTTLNLSNNNLANLND-LTNLTTLNLSNNNLARLWK-LTNLTTLNLSNNGFDEFPK-LTSLTTLNLSNNQLTSLPQ-LTNLKTLNLSNNQLQSLPT................................... 253
36 -33.8004z0c_A mol:protein length:709 Toll-like receptor 13  ali model follow..  21  60...........ALVDLRLEWNSIWKIDEGAFRGLENLTLLNLVENKIQSVNNSFEGLSSLKTLLLSHNQITKLKYLSLSRNNISDFSGILPCLERLDLTNNSIMYLDHSPRSLVSLTHLSFEGNKLRELNPNLTNLSASRNGNKVIQNLKTLPQLKSLNLSGTVIKLENLSLQNLRAMDLSNWELRHGHLLGNLPKLETLVFQKNVTNAEGIKCTRLLFLDLGQNSDLIYSEFNALPSLQKLNLNKCQLSFINN-LQNLTSLDLSHNKFKSFPD-LKHLEFLSLSRNPITELNN-LFALKELNLAACWIVTIDR-FPNLEVLDLGDNNIRTLNH-LKKLQSLILSHNCLKILEP-LTNLRSLDLMYNSLSYFEHLFSGLEKLLILKLGFNKITKLKSLKQLNLEGQRHG 538
37 -33.6004u7l_A mol:protein length:456 Leucine-rich repeats and immunoglobulin-like  ali model follow..  19  14.......................................................DCGGRGLAALPGDLPSSTRSLNLSYNKLSEIDPALPNLQEVYLNNNELTAVPSLGAASSHVVSLFLQHNKIRSVEGSLEVLDLSLNNITEVRNFPHGPPIKELNLAGNRIGTLELLSRSLLTLRLSKNRITQLPRAFKLPRLTQLDLNRNRIRLIEGLLNSLEVLKLQRNNISKLTDFWGLSKMHVLHLEYNSLVEVNS-LTALHQLHLSNNSIARIHR-CQKLHELVLSFNNLTRLDE-LSSLSVLRLSHNSISHIAE-LRSLRVLDLDHNEISGTIEDLDSLSKLTLFGNKIKSVAK-LEGLEHLNLGGNAIRSVQF---------------DAFVKMKNLKELHISSDSFL 404
38 -33.3004r6f_A mol:protein length:331 Leucine rich repeat DLRR_I  ali model follow..  27  2..........................................................................TITVSTPIKQIFPDD-AFAETIKANLKKKSVTDA-LNSIDQIIANNSDIKSVQGIQPNVRYLALGGNKLHDISALKELTNLGWLNLSNNQLETLPQ-LTNLTTLNLSNNQLTSLPQFERLASLTTLNLSNNNIANIND-LTNLTTLNLSHNNLARLWKLKGLTNLTTLNLSSNGFDEIPR-LTSLTTLNLSNNNIANIND-LTNLTTLNLSHNNLARLWK-LTNLTTLNLSSNGFDEIPR-LTSLTTLNLSNNQLTSLPQ-LTNLKTLNLSNNQLQS.......................................................... 331
39 -33.3003v47_A mol:protein length:455 Toll-like receptor 5b and variable lymphocyte  ali model follow..  20  13.........................................................................YNAICINRGLHQVPELPAHVNYVDLSLNSIAELNE-LQDLQFLKVEQQTPGLVIR--SSLIILKLDYNQFLQLETFNGLANLEVLTLTQCNLDGAVKPLTSLEMLVLRDNNIKKIQPFLNMRRFHVLDLTFNKVKSICEEDKHFTLLRLSSITLQDMNEPFKNTSITTLDLSGNGFKESMASNSYNMGSSFGHTNFKDPDNFASGVKTCDLSKSKIFALLK-FTDLEQLTLAQNEINKIDD-LTHLLKLNLSQNFLGSIDS-LDKLEVLDLSYNHIRALGD-LPNLKELALDTNQLKSVPD---------------GIFDRLTSLQKIWLHTNPWD 408
40 -33.0004xgo_A mol:protein length:356 Anopheles Plasmodium-responsive Leucine-rich  ali model follow..  22  3.......................................................................................................................................LSYKSMHLTPFALLASFHKVEVLNLNGLQIEEIDT-AHTIQKLYMRFNVIRYLPPFQNVPLLTVLMLDRNDLSSLPP-TPKLTMMSMSNNNLERIEDFQATTALQNLQLSSNRLTHVDALIPSLFHVNVSYNLLSTLAIPI-AVEELDASHNTINVVRPVNVELTILKLQHNNLTDTAWLYPGLVDVDLSYNQLEKITYQMQRLERLYVSNNRLVALDFYIPTLKVLDLSHNHLMWVEHNQAQFDKLQYLYLDHNSIVTFKTLKNLTLSHNDWD 306
41 -32.9005b0n_A mol:protein length:224 E3 ubiquitin-protein ligase ipaH9.8  ali model follow..  38  20......................................................GEERDEAVSRLKECLINNSDELRLDRLNLSSLPDLPAQITLLNVSYNQLTNLPELPVTLKKLYSASNKLSELPVLPPALESLQVQHNELENLPAL--PDSLLTMNISYNEIVSLPSLPQALKNLRATRNFLTELPSEGNNPVVREYFFDRNQISHIPESILNLRNIHISDNPLSSHA-LPALQRLTSSPDYHGPRIYFS............................................................................................................................................................ 221
42 -32.7004qdh_A mol:protein length:438 Variable lymphocyte receptor B, Toll-like rec  ali model follow..  22  15.......................................................................SGTEIRCNSKGLTSVPTIPSSATRLELESNKLQSLPGVFDKLTQLTKLSLSRNNLVTIKPRLQCLSLSHNSIAQAVNFLPLTNLQVLDLSHNKLDLYHW-LPQLQALDLSYNSQPFSMKVTHLSMLQSLSLAHNDIHTRVSSSNSVRFLDFSGNGMGRMWDFQGLSGLLKLDLSQNNLHILRPLPKSLKLLSLRDNYLSFFNSFLPNLEVLDLAGNQLKALTN-GTLLQKLDVSSNSIVSVVP-AVELKEVNLSHNILKTVDRIVMNLKELALDTNQLKSVPD-LTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQSGSGKPVRSIICPTASLV 418
43 -32.6003t6q_A mol:protein length:606 CD180 antigen  ali model follow..  17  24LNEIPGTLPN-STECLEFSFNVLPTIQNTFSRLINLTFLDLTRCQIYWIHEDTFQSQHRLDTLVLTANPPKALKHLFFIQTGISSIDFIQKTLESLYLGSNHISSIKL-TEKLKVLDFQNNAIHYLSK---TNLSLNLNGNDIAGIEKNSTIQSLWLGTFEDMDDEDISPAVMSVESINLQKHYFFNISSFHCFSGLQELDLTATHLSELPSGLSTLKKLVLSANKFENLCQLENLENLRELDLSHDDIETSDRNLSHLQSLNLSYNEPLSLKT-CPQLELLDLAFTRLKVKDA-LHLLKVLNLSHSLLDISSE-LPALQHLNLQGNHFPKGNIQLGRLEILVLSFCDLSSIDQ-LKMMNHVDLSHNRLTSSSIEA-NLASNHISIILPSLLPILSQQRTINLRQNPLD 560
44 -32.5003cig_A mol:protein length:697 Toll-like receptor 3  ali model follow..  17  16LTHIPDDL--SNITVLNLTHNQLRRLPPNFTRYSQLAILDAGFNSISKLEPELCQILPLLKVLNLQHNECTNLTELDLMSNSIHKIKS-QKNLIKLDLSHNGLSSTKL-LENLQELLLAKNKILALRS--SSLRKLDLSSNPLKEFSPFQTIGKLFALLLNNAQLNPHLTENTSIQNLSLANNQLLATSE--KWTNLTQLDLSYNNLHDVGN-LPSLRYLSLEYNNIQRLSPFYGLSNLRYLSLKRAFTKQSVSLLKYLEYLNMDDNNIPSTKS-LVSLKYLSLSKTSLQTLTNETSPLLTLNLTKNHISKIAN-LGQLRILDLGLNEIEQK-RGLRNIFEIYLSYNKYLQLST-VPSLQRLMLRRVALKNVPSPFRPLRNLTILDLSNNNIANINNLEILDFQHNNLA 517
45 -32.3003o53_A mol:protein length:317 Protein LRIM1  ali model follow..  18  10..................................................................................................................................NRYKIEKVTDSSLKQALARQSAWNVKELDLSGNPLSQISAAFTKLELLNLSSNVLYETLDLESLSTLRTLDLNNNYVQELLVGP-SIETLHAANNNISRVSC-SRGQGKKNIYLANNKITMLRDLRSRVQYLDLKLNEIDTVN---------------FAELAASSDTLEHLNLQYNFIYDVKGVFAKLKTLDLSSNKLAFMGPEAAGVTWISLRNNKLVLIEKFSQNLEHFDLRGNGFHCGTLRDFFSKNQRVQTVAKQTVKKLTGQNEEECTVPTLG 289
46 -32.2003rg1_A mol:protein length:612 CD180 molecule  ali model follow..  15  23LREIPDTLPN-TTEVLEFSFNFLPTIQNTFSRLINLIFLDLTRCQINWVHEDTFQSHHQLNTIVLTGNPPKFLKHLFLTQTGISNLEFILENLESLHLGSNHISSINL-TQNLKVLDFQNNAIHYISR---TNLSLNFNGNDIKGIEPNSTLQSLWLGTFEDTDDQYLTSATMSVESINLQKHRFSDLSSFRCFTRVQELDLTAAHLNGLPSGMNSLKKLVLNANSFDQLCQAASFPSLRDLYIKGNMRKL--EKLENLQKLDLSHSDIEASDKNLRHLQYLNLSYNEPLGLED-CPQLELLDVAFTHLHVKAPHLHLLRVLNLSHCLLDTSNQ-LQDLRHLNLQGNSFQDGSQMVGSLEILILSSCNLLSIDQAFHGLRNVNHLDLSHNSLTGDSKGLYLNMASNNIR 535
47 -32.1003ulu_A mol:protein length:694 Toll-like receptor 3  ali model follow..  17  95LSQLSDKTFCTNLTELHLMSNSIQKIKNNFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQSLKKLELSSNQIKEFSP-IGRLFGLFLNNVQLGPSLT-NTSIRNLSLSNSQLSTTSN--TNLTMLDLSYNNLNVVGNFAWLPQLEYFFLEYNNIQHLFSHLKCLEHLNMEDNDIPGIKSFTGLINLKYLSLSNSSLRTLTNETSPLHILNLTKNKISKIESFSWLGHLEVLDLGLNEIGQELTGLENIFEIYLSYNKYLQLTR-VPSLQRLMLRRVALKNVDSSPRNLTILDLSNNNIANIND-LEKLEILDLQHNNLARLWK-LSHLHILNLESNGFDEIPV-LFELKIIDLGLNNLNTLPA-QVSLKSLNLQKNLITSVEKFRNLTELDMRFNPFD 632
48 -32.0002z7x_B mol:protein length:520 Toll-like receptor 1, Variable lymphocyte rec  ali model follow..  19  1.......................................................................SEFLVDRSKNGLIHVPKLSQKTTILNISQNYISELTSDILSLSKLRILIISHNRIQYLDQELEYLDLSHNKLVKIS-CHPTVNLKHLDLSFNAFDALPGNMSQLKFLGLSTTHLEKSSPIAHLNISKVLLVLGETYGEKEDPHTTVWYFSISNVKLQGQLDFTSLKALSIHQVVSDVFGFPQSYFSNMNIKNFTVSGTRMVHSKISPFLHLDFSNNLLTDTVGHLTELETLILQMNQLKELSKIAKSLQQLDISQNSVSYDESWTKSLLSLNMSSNILTDTICLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVASNQLKRLTSLQKIWLHTNPWD 481
49 -31.8003w3g_A mol:protein length:811 Toll-like receptor 8  ali model follow..  19  104...........NLRELLLEDNQLPQIPSGL--PESLTELSLIQNNIYNITKEGISRLINLKNLYLAWNCLTNLELLSLSFNSLSHVPKLPSSLRKLFLSNTQIKYIEEDFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDAFQNLTQLRYLNLSSTSLRKINAAMPHLKVLDLEFNYLVG---LTMLPRLEILDLSFNYIKGSYSKLLSLRALHLRGYVFQELRELMQLPNLSTINLGINFIKQIDQNFSNLEIIYLSENRISPLVK-YANSSSFQRHIRKRRSTDQCAAYGKALDLSLNSIFFIGP-LPDIACLNLSANSNAQV-SAIPHVKYLDLTNNRLDFDNA-LSDLEVLDLSYNSHYFRIEFIQNFTNLKVLNLSHNNIYTLKSLVELVFSGNRLD 599
50 -31.8002a0z_A mol:protein length:705 Toll-like receptor 3  ali model follow..  17  90LSQLSDKTFCTNLTELHLMSNSIQKIKNNFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQSLKKLELSSNQIKEFSP-IGRLFGLFLNNVQLGPSLT-NTSIRNLSLSNSQLSTTSN--TNLTMLDLSYNNLNVVGNFAWLPQLEYFFLEYNNIQHLFSHLKCLEHLNMEDNDIPGIKSFTGLINLKYLSLSNSSLRTLTNETSPLHILNLTKNKISKIESFSWLGHLEVLDLGLNEIGQE-RGLENIFEIYLSYNKYLQLTR-VPSLQRLMLRRVALKNVDSSPSNLTILDLSNNNIANIND-LEKLEILDLQHNNLARLWK-LSHLHILNLESNGFDEIPV-LFELKIIDLGLNNLNTLPASQVSLKSLNLQKNLITSVEKFRNLTELDMRFNPFD 627
51 -31.5003j0a_A mol:protein length:844 Toll-like receptor 5  ali model follow..  19  16LTQVPQVLN--TTERLLLSFNYIRTVTSSFPFLEQLQLLELGSQYTPLTIKEAFRNLPNLRILDLGSSKLFHLFELRLYFCGLSDAVRNLKALTRLDLSKNQIRSLYGKLNSLKSIDFSSNQIFLVCE-GKTLSFFSLAANSLYSRVSVDARSSVRHLDLSHGFVFSLNSRLKDLKVLNLAYNKINKIADFYGLDNLQVLNLSYNLLGELYSSLPKVAYIDLQKNHIAIIQDFKFLEKLQTLDLRDNALTTIHFI-PSIPDIFLSGNKLVTLPKINLTANLIHLSENRLENLDILYPHLQILILNQNRFSSCSSENPSLEQLFLGENMLQLA-EGLSHLQVLYLNHNYLNSLPP-LTALRGLSLNSNRLTVLSHLPANLEILDISRNQLLAPNPFVSLSVLDITHNKFI 560
52 -31.5003wpf_A mol:protein length:803 Toll-like receptor 9  ali model follow..  20  5LGTLPAFLELKPHGLVDCNWLFLKSVPSAAASCSNITRLSLISNRIHHLHNSDFVHLSNLRQLNLKWNCMRTLEELNLSYNGITTVPRLPSSLVNLSLSHTNILVLANSLAGLYSLRVLFMDGNCYYKNPSQLTHLSLKYNNLTKVPR-QLPPSLEYLLVSYNLIVKLGPELTSLRVLDVGGNCRRC-ETFHHLSHLEGLVLKDSSLHTLNSSLVQLSVLDLSENFLYESNAFQNLTRLRKLNLSFNYRKKVSKNLVSLQELNMNGIFFRLLNKYTPKLHTLHLQMNFINQAQLSIRALRFVDLSDNRISGMDRCKNFKFTMDLSRNNLVTIKPELSRLQCLSLSHNSIAQAVN-LTNLQVLDLSHNKLDLYWKSFSELPQLQALDLSYNSQPHLSMLQSLSLAHNDIH 568
53 -31.4004oqt_A mol:protein length:478 Leucine-rich repeat and immunoglobulin-like d  ali model follow..  20  12.......................................................................QDRAVLCHRKRFVAVPEIPTETRLLDLGKNRIKTLNQ---------------DEFASFPH-LEELELNENIVSAVEPFNNLFNLRTLGLRSNRLKLIPL-LSNLTKLDISENKIVILLDFQDLYNLKSLEVGDNDLVYISH-LNSLEQLTLEKCNLTSIPTLSHLHGLIVLRLRHLNINAIRD-LYRLKVLEISHWPYLDTMT-GLNLTSLSITHCNLTAVPY-LVYLRFLNLSYNPISTIEG-LLRLQEIQLVGGQLAVVEP-LNYLRVLNVSGNQLTTLEHSVGNLETLILDSNPLA....................................... 333
54 -30.7003b2d_A mol:protein length:603 CD180 antigen  ali model follow..  16  21LSEIPDTLPN-TTEFLEFSFNFLPTINRTFSRLMNLTFLDLTRCQINWIHEDTFQSHHQLSTLVLTGNPPKSLKHLFLIQTGISNLEFILENLESLYLGSNHISSIKF-ARNLKVLDFQNNAIHYISR--QSLWLGTFEDIDDEDISS--CEMSVESLNLQEHRFSDISS-FTQLQELDLTATHLKGLPSMKGLNLLKKLVLSVNHFDQLCQIFPSLTHLYIRGNVKKGVGCLEKLGNLQTLDLSHNDIEASDKNLSHLQTLNLSHNEPLGLQS-CPQLELLDLAFTRLHINAPQLHFLQVLNLTYCFLDTSNQ-LPVLRHLNLKGNHFQDGTITVGSLEVLILSSCGLLSIDQ-LGKMSHVDLSHNSLTHLKGIYLNLAANSINIISPRLLPILSQQSTINLSHNPLD 557
55 -30.6004aw4_A mol:protein length:311 INTERNALIN B  ali model follow..  18  1...............................................................................................................GAMETITVPTPIKQIFSDDAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGILPNLTSLNLSNNQITDISPIQYLPNVTKLFLNGNKLTDIKPLLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLLPQLESLYLGNNKITDITVLLTKLDTLSLEDNQISDIVPLLTKLQNLYLSKNHISDLRALLKNLDVLELFSQECLNKPSNLVVPNTVKNTDGSLVTPEIIDGDYEKPNVKWHLPEFTNEV.................................. 284
56 -30.5001xku_A mol:protein length:330 Decorin  ali model follow..  21  32...................................................................................................................................HLRVVQCSDLGLEKVPK-DLPPDTALLDLQNNKITEIKD-LKNLHTLILINNKISKISPFAPLVKLERLYLSKNQLKELPKMPKTLQELRVHENEITKVRKFNGLNQMIVVELGTNPLKS--QGMKKLSYIRIADTNITTIPQLPPSLTELHLDGNKITKVDA-LNNLAKLGLSFNSISAVDN-TPHLRELHLNNNKLVKVPG-HKYIQVVYLHNNNISAIGS-KASYSGVSLFSNPVQY-------------WEIQPSTFRCVYVRAAVQLGNYK.. 330
57 -30.5003wpb_A mol:protein length:802 Toll-like receptor 9  ali model follow..  19  7..TLPPFLPCQPHGLVNCNWLFLKSVPSAAAPRDNVTSLSLLSNRIHHLHDSDFAQLSNLQKLNLKWNCVPTLEELNLSYNGITTVPALPSSLVSLILSRTNILQLPGALLGLGNLTHLSLKYNNLTTVPPSLEYLLLSYNHIVTLEDLANLTALRVLDVGGNCRRC--SHLSRLEGLVLKDSSLYQLNPFRGLGNLTVLDLSENFLYDC-QGLAQLRRLNLSFNYHKKVPSFGSLLSLQELDMHGIFFRSLSQKLPMLQRLYLQMNFINQAQL-FPGLRYIDLSDNRISGAVEEVDGGKKVWLTSRDLTPMPSCKNLSFTLDLSRNNLVTVQPELSRLQCLRLSHNSISQAVN-LTSLQVLDLSHNKLDLYGRSFTELPRLEALDLSYNSVAQLPTLRYLSLAHNGIH 567
58 -30.5003wpe_A mol:protein length:801 Toll-like receptor 9  ali model follow..  18  43...........NVTSLSLISNRIHHLDSDFVHLSNLRVL-NLKWNCPPAGLSPMHFPCRMTIEPNTFLAVPTLEELNLSYNGITTVPALPSSLVSLSLSHTSILVLPTHFTGLHALRFLYMDGNCYYMNPGNLTHLSLKYNNLTEVPR-RLPPSLDTLLLSYNHIVTLAPELTALRVLDVGGNCRRC-DTFSHLSRLEGLVLKDSSLYKLEK-LGRLQVLDLSENFLYDYTIFNDLTQLRRLNLSFNYHKKVSGSLVSLEKLDMHGIFFRSLTNILPKLQSLHLQLNFINQAQL-FPSLLFVDLSDNRISDFMPSCNLNFTLDLSRNNLVTIQTRLSRLQCLRLSHNSISQA-VPLTSLRVLDLSHNKLDLYGRSFTELPQLEALDLSYNSQPQLPSLRYLSLAHNGIH 566
59 -30.4002ft3_A mol:protein length:332 Biglycan  ali model follow..  20  13.........................................................................................IPDLDSLPPTYSAMCPF-GCHCHLRVVQCSDLGLKAVPKISPDTTLLDLQNNDISELRKFKGLQHLYALVLVNNKISKIHE-------------------AFSPLRKLQKLYISKNHLVEIPNLPSSLVELRIHDNRIRKVPKFSGLRNMNCIEMGGNPLENSGFEPGKLNYLRISEAKLTGIPKLPETLNELHLDHNKIQAIELEDSKLYRLGLGHNQIRMIEN-LPTLRELHLDNNKLSRVPA-LKLLQVVYLHTNNITKVGVKRAYYNGISLFNNPVPY-------------WEVQPATFRCVTDRLAIQFGNYK.. 331
60 -30.0004cil_A mol:protein length:287 YOPM-CAP, INTERNALIN B  ali model follow..  17  2........................................................................................................................................AMGKSKAEYYNAWSEWERNAPPGNGEQRGMAVSRLDRQAHELELNNLGLSSLPGIQYLPNVTKLFLNGNKLTDIKPLLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLLPQLESLYLGNNKITDITVLLTKLDTLSLEDNQISDIVPLLTKLQNLYLSKNHISDLRALLKNLDVLELFSQECLNKPSNLVVPNTVKNTDGSLVTPEIIDGDYEKPNVKWHLPEFTNEV-SFIFYQPVTIGKAKARFHGRVTQPLK....... 286
61 -29.6004bv4_R mol:protein length:446 PROTEIN TOLL, VARIABLE LYMPHOCYTE RECEPTOR B  ali model follow..  18  73.......................................................................................DRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRGLKRFRFTTRRLTHIPALTDMRNLSHLELRAN-IEEMPDDLENLESIEFGSNKLRQMPRFGKMPKLKQLNLWSNQLHNLTK-ATSVLGIDIHDNGIEQLPHFAHLTNVTDINLSANLFRSLPQ-NKHLNEVRLMNNPLATLPSRL-PELQILRLRAELQSLPG-STQITNISLGDNLLKTLPA-QVNLLSLDLSNNRLTHLPD-TTNLTDLRLASNQLKSVPD-LTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSKPVRSIICPTTGENL. 445
62 -29.5002wqx_A mol:protein length:289 INTERNALIN B  ali model follow..  18  1...................................................................................................................................GAMETITVPTPIKQIFSDDAFAETIKDNLKKKSVTDAVTQLNSIDQIIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLLPQLESLYLGNNKITDITVLLTKLDTLSLEDNQIRRIVPLLTKLQNLYLSKNHISDLRALLKNLDVLELFSQEALNKPSNLVVPNTVKNTDGSLVTPEIIDGDYEKPNVKWHLPEFTNEV.................................. 262
63 -29.4001h6u_A mol:protein length:308 INTERNALIN H  ali model follow..  16  2...................................................................................................................SITQPTAINVIFPDPANAIKIAAGKSNVTDTVTQADLDGITTLSAFGTGVTTIEGVLNNLIGLELKDNQITDLAPLKNLTKITELELSGNPLKNVSAILQSIKTLDLTSTQITDVTPLAGLSNLQVLYLDLNQITNISPLLTNLQYLSIGNAQVSDLTPLLSKLTTLKADDNKISDISPLLPNLIEVHLKNNQISDVSPLTSNLFIVTLTNQTITNQPVFNNLVVPNVVKGPSGAPIAPANGTYASPNLTWNLTSFINNV.................................. 281
64 -29.2005a5c_A mol:protein length:357 LRRTM  ali model follow..  22  12...........................................................................................EKLLFYCDSQGFHSVPN-------------------GLPSQLLGLSLRHNQLQSLPNFDKLTQLTWLHLDHNQLQSLPN-LTKLTELILSSNQLQSLPNFDKLTNLQNLDLSFNQLQSLPN-LTNLQTLHLRSNQLQSLPNFDKLTSLTFLDLSTNQLQSLPN-LTNLRELHLEHNQLQSLP----------------NGVFDKLTSLTTLFLQWNQLQSLPN-LTNLEKLDLTGNQLQSLPN-LTNLKILLLDNNQLQSLPDKLKSLTTVGLSGNLWECSPRVCALASWLGSFQGRWEHSDHTQGEDILDAVHGFQL 330
65 -29.0004r58_A mol:protein length:220 Leucine Rich Repeat protein  ali model follow..  24  2.......................................................................................................................................TITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQLNSIDQIIANNSDIKSVQGIQYLPNLKTLKLSNNKITDISALLNNLGWLDLSNNGITDISALKNLASLHTLDLSNNGITDISALLDNLHTLDLSNNGITDISALLDNLHTLDLSNNGITDISALLTSLHTLDLSNNGITDISALLDNLETLDLRNNGITDKSAL-KNLNNL................................................................... 219
66 -29.0003v44_A mol:protein length:407 Toll-like receptor 5b and variable lymphocyte  ali model follow..  17  13.........................................................................YNAICINRGLHQVPELPAHVNYVDLSLNSIAELNE-LQDLQFLKVEQQTPGLVIR--SSLIILKLDYNQFLQLETFNGLANLEVLTLTQCNLDGA-KPLTSLEMLVLRDNNIKKIQPFLNMRRFHVLDLTFNKVKSICE-FQGKHFTLLRLSSITLQGNPFKNTSITTLDLSGNGFKESMAKAIAGTKIQSLILSNS-------YNMGSSFGHTNFKDPDNFTSGVKTCDLSKSKIFALLK-FTDLEQLTLAQNEINKIDD-LTHLKELALDTNQLKSVPD-LTSLQKIWLHTNPWD....................................... 360
67 -29.0003bz5_A mol:protein length:457 Internalin-J  ali model follow..  16  1.............NTLKAGQTQSFNDWFPDDNFASEVAAAFEMQA----------------TDTISEEQLATLTSLDCHNSSITDMTGILTGLTKLICTSNNITTLDSQNTNLTYLACDSNKLTNLD---TKLTYLNCDTNKLTKL-DVSQNPLLTYLNCARNTLTEIDSHNTQLTELDCHLNKKITKLDVTPQTQLTTLDCSFNKITELDSQNKLLNRLNCDTNNITKL-DLNQNIQLTFLDCSSNKLTEIDTPLTQLTYFDCSVNPLTELDSTLSKLTTLHCIQTDLLEIDTHNTQLIYFQAEGRKIKELDTHNTQLYLLDCQAAGITELDSQNPKLVYLYLNNTELTELDSHNTKLKSLSCVNAHIQDFSNFEAEGQTITMPKETLTSLTIAVSPDLLDQFGNPMN 403
68 -28.8001wwl_A mol:protein length:312 Monocyte differentiation antigen CD14  ali model follow..  18  2.........................................................................................DPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKVRAARIPSRILFGALRVLSGLQELTLENLEVTGTALEATGPDLNILNLRNVSWATRDALKPGLKVLSIAQAHSLNFSQVRVFPALSTLDLSDNPELGERGLFPTLQVLALRNAGMETPSGVCSALA-------------AARVQLQGLDLSHNSLRDAAGAPSQLNSLNLSFTGLKQVPKLPAKLSVLDLSYNRLDRNPSPLPQVGNLSLKGNPFLD...................................... 310
69 -28.7003cvr_A mol:protein length:571 Invasion plasmid antigen  ali model follow..  37  16............NSFYNTISGTYADYFSAWDKWEKQ---------------ALPGENRNEAVSLLKECLINQFSELQLNRLNLSSLPDLPPQITVLEITQNALISLPELPASLEYLDACDNRLSTLPELPASLKHLDVDNNQLTMLPEL--PALLEYINADNNQLTMLPELPTSLEVLSVRNNQLTFLPEL--PESLEALDVSTNLLESLPAVPVRNHHFRCRENRITHIPEILSLDPTCTIILEDNPLSSRI............................................................................................................................................................ 246
70 -27.9002wqw_A mol:protein length:286 INTERNALIN B  ali model follow..  15  1..........................................................................ETITVPTPIKQIFSDFAETIKDNLKKKSVTDAVTQLNSIDQIIANNSDIKSVQGIQPNVTKLFLNGNKLTDIKPLANLKNLGWLFLDENKVKDLSSLLKKLKSLSLEHNGISDINGLVHLPQLESLYLGNNKITDITVLLTKLDTLSLEDNQISDIVPLACLTKLQNLYLSKNHISDLRALLKNLDVLELFSQEALNKPSNLVVPNTVKNTDGSLVTPEIISDDYEKPNVKWHLPEFTNEVIFYQPVTIGKAKARFHG............................................................................. 278
71 -27.9001otm_A mol:protein length:236 internalin B  ali model follow..  20  2...........................................................................................................................................GSSSSGLVPRGSHMASETITVS-TPIKQIFPDFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGILPNVTKLFLNGNKLTDIKPLTNLKNLGWLFLDENKIKDLSSLLKKLKSLSLEHNGISDINGLLPQLESLYLGNNKITDITVLLTKLDTLSLEDNQISDIVPLLTKLQNLYLSKNHISDLRALLKNLDVLELFSQECLNKP........................................................ 228
72 -27.8004uip_B mol:protein length:251 REPEBODY (RAC1)  ali model follow..  21  1............................................................................................METITVSTPIKQIFP-------------------DDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQQYLPNVRYLALGGNKLHDISALKELTNLTYLMLHYNQLQILPDKLTNLKELYLSENQLQSLPDFDKLTNLTELDLARNQLQSLPDKLTQLKDLRLYQNQLKSVPDRLTSLQYIWLHDN.......................................................................................................................... 192
73 -27.8005ftt_B mol:protein length:339 LEUCINE-RICH REPEAT TRANSMEMBRANE PROTEIN FLR  ali model follow..  22  11...........................................................................................DRNFVYCNERSLTSVP-------------------LGIPEGVTVLYLHNNQINNAGELHNVQSVHTVYLYGNQLDEFPNLPKNVRVLHLQENNIQTISRLAQLLKLEELHLDDNSISTVGREAISLKLLFLSKNHLSSVPV-GLPVDLQELRVDENRIAVISD-LTSLERLIVDGNLLTNKGIAEGTFSHL--------------TKLKEFSIVRNSLSHPPPDLTHLIRLYLQDNQINHIPL-LRKLERLDISNNQLRMLTQ-LSNLKQLTARNNPWF....................................... 281
74 -27.8004qxf_A mol:protein length:301 Leucine-rich repeat-containing G-protein coup  ali model follow..  25  3...............................................................................................................................................PLCAAPCSCDGDRRVDCSGKGLTAVPELSAFTQALDISMNNITQLPEFKNFPFLEELQLAGNDLSFIHP-LKELKVLTLQNNQLKTVPSIRGLSALQSLRLDANHITSVPE-LVQLRHLWLDDNSLTEVPV-LPTLQALTLALNKISSIPD-LSSLVVLHLHNNKIRSLSQ-LDNLETLDLNYNNLGEFPQALPSLKELALDTNQLKSVPD-LTSLQKIWLHTNPWD....................................... 261
75 -27.7004b8c_D mol:protein length:727 GLUCOSE-REPRESSIBLE ALCOHOL DEHYDROGENASE TRA  ali model follow..  14  1MNASTAAVNSIHLDDPSLLNNPIWKLQLHLAAVSAQQPNIYARQNAMKKYLATQQAQQAQQQAQQQAQQQAAPPALQPTDFQQSHIAEASKSLVDQALMEMADTLTDSKTAKKQQPTGDSTPSGTATNSAPKIELFANGKDEANQALQHKKLSQYSIDEDDDIENMVMPKDSKYDDQLDLSNLQIFNISNIFKYDFLTRLYLNGNSLTELPAEIKNLSNLDLSHNRLTSLPELGSCFQLKYFYFFDNMVTTLPWEFGNLCNLQVEGNPLEKQFLKIKSVTGLIFYLRDNRPEIPLPHERRFIEIN-TDGEPQREYDSLQQSTEHLATDLAKRTFTVLSLCQHYATPKMYRYTPSWALSWDYRNKLKEQILSYDSDLLCLQEVE.......................... 448

FFAS is supported by the NIH grant R01-GM087218-01
1 0 1 6 1 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.