current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: gi|16082696|ref|NP_395142.1| secretion chaperone (YPCD1.05c) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MYSFEQAITQLFQQLSLSIPDTIEPVIGVKVGEFACHITEHPVGQILMFTLPSLDNNDEKETLLSHNIFSQDILKPILSWDEVGGHPVLWNRQPLNSLDNNSLYTQLEMLVQGAERLQTSSLISPPRSFSLast
1 -60.8001n5b_A mol:protein length:132 YOPE regulator  ali model follow..  98  1MYSFEQAITQLFQQLSLSIPDTIEPVIGVKVGEFACHITEHPVGQILMFTLPSLDNNNEKETLLSHNIFSQDILKPILSWDEVGGHPVLWNRQPLNNLDNNSLYTQLEMLVQGAERLQTSSLISPPRSFS 130
2 -60.2001k6z_A mol:protein length:141 Type III secretion chaperone SycE  ali model follow..  100  6MYSFEQAITQLFQQLSLSIPDTIEPVIGVKVGEFACHITEHPVGQILMFTLPSLDNNDEKETLLSHNIFSQDILKPILSWDEVGGHPVLWNRQPLNSLDNNSLYTQLEMLVQGAERLQTSSLISPPRSFS 135
3 -54.9001l2w_A mol:protein length:123 YopE regulator  ali model follow..  100  3.YSFEQAITQLFQQLSLSIPDTIEPVIGVKVGEFACHITEHPVGQILMFTLPSLDNNDEKETLLSHNIFSQDILKPILSWDEVGGHPVLWNRQPLNSLDNNSLYTQLEMLVQGAERLQTSS......... 122
4 -51.3004jmf_B mol:protein length:116 Probable chaperone  ali model follow..  43  3.PLYRAAIHQLFLALDLPTPNDEESVLSLQVGPHLCHLAEHPTDHLLMFTRLEGQGD---ATANEQNLFSQDPCKPILGRDPESGERLLWNRQPLQLLDRAQIHHQLEQLVAAAEELR............ 116
5 -46.1004gf3_A mol:protein length:141 Putative yopH targeting protein  ali model follow..  16  1MRTYSSLLEEFATELGLEIETNELGHGAVTIDKWVVHLAPINEKELVAFMRAGILTGQSLYDILRKNLFSPLSGVIRCALDKD-DHWLLWSQLNINDTSGTQLASVLTSLVDKAVTLSCEPTMKKEEDDH 132
6 -45.8003epu_A mol:protein length:144 STM2138 Virulence Chaperone  ali model follow..  13  3.SRADRLLRQFSLKLNTDIVFDENRLCSFIIDNYRILLTSTNSEYIMIYGFCGKPPDNNAFEFLNANLWFAENNGPHLCYDNNSQSLLLALNFSLNESSVEKLECEIEVVIRSMENLYHILQDKGITLDT 135
7 -45.1002bho_A mol:protein length:130 CHAPERONE PROTEIN SYCT  ali model follow..  20  3.TTFTELMQQLFLKLGLNHQVNENDVYTFEVDGIQVLIACYHQQWVQLFSELGADL------PTNDNLFGEHW--PAHVQGRLDGKPILWSQQSLVGLDIDEMQAWLERFIDDIEQRKEPQNTKFQPNST 124
8 -44.8002bsj_A mol:protein length:133 CHAPERONE PROTEIN SYCT  ali model follow..  19  6.TTFTELMQQLFLKLGLNHQVNENDVYTFEVDGIQVLIACYHQQWVQLFSELGADL------PTNDNLFGEHW--PAHVQGRLDGKSILWSQQSLVGLDIDEMQAWLERFIDDIEQRKEPQNTKFQPNST 127
9 -44.6001k3e_A mol:protein length:156 CesT  ali model follow..  12  2SSRSELLLEKFAEKIGIGISFNENRLCSFAIDEYYISLSDANDEYMMIYGVCGKFPTNFALEILNANLWFAENGGPYLCYEAGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLEN 136
10 -43.5001jyo_A mol:protein length:130 SicP  ali model follow..  11  1LQAHQDIIANIGEKLGLPLTFDDNNQCLLLLDSDIFTSIEAKDDIWLLNGMIIPLSPVCWRQIMVINGELAANNEGTLAYIDAAETLLL-IHAITDLTNTYHIISQLESFVNQQEALKNILQEYAK.... 129
11 -42.7001s28_A mol:protein length:132 ORF1  ali model follow..  17  5.NSFDRLIDGLAKDYGMPEKKHEHEVYCFEFKEVSIRIYQDKFKWVYFLSDIGVIDSNACQSLLRLNEFNLRTPFFTVGLNEK-KDGVVHTRIPLLNLDNVEMRRVFEALLNLSGEVKKTFG........ 130
12 -42.4004g6t_A mol:protein length:128 Type III chaperone protein ShcA  ali model follow..  13  7.LFYKTLLDDFSRSLEMQLVFDDHGTCNMIIDNFALTLSCDYAERLLLIGLLEPHKDIPQQCLLAGALNPLLNAGPGLGLDEKSGLYHAYQSIPREKLSVPTLKREMAGLLEWMRGWREA.......... 128
13 -38.1001xkp_C mol:protein length:143 Chaperone protein yscB  ali model follow..  14  1...MQNLLKNLAASLGRKFVADKQGVYRLTIDKHLVMLAP-HGSELVLRTPINNVNVTLLRSLMQQALAWAKRYPQTLVLDDC-GQLVLEARLRLQELDTHGLQEVINKQLALLEHLIPQLTPFSVASRV 134
14 -37.0003kxy_A mol:protein length:133 Exoenzyme S synthesis protein C  ali model follow..  13  4TSKVNRLLAEFAGRIGLPLSLDEEGMASLLFDEVGVTLLLLAEERLLLEADVVGIDEGIFRQLASFNRHWHRF-DLHFGFDELTGKVQLYAQILAAQLTLECFEATLANLLDHAEFWQRLLPCAS..... 133
15 -20.1001xkp_B mol:protein length:124 Chaperone protein sycN  ali model follow..  16  1MSWIEPIISHFCQDLGVPTSSPLSPLIQLEMAQSGTLQLEQHGATLTLWLARSLACEDAMVKALTLTAAQKSGALPLRAGWLGESQLVLFVSLDERSLTLPLLHQAFEQLLRLQQEVLA........... 122
16 -17.1001k3s_A mol:protein length:113 SigE  ali model follow..  15  1...MESLLNRLYDALGLDAPEDEP---LLIIDDGIQVYFNESDHTLEMCCPFMPLPDDTLQHFLRLNY----TSAVTIGADADNTALVALYRLPQTS-TEEEALTGFELFISNVKQLKEHYA........ 113
17 -15.8002plg_A mol:protein length:163 Tll0839 protein  ali model follow..  25VEIIETVISSLHQGDAPLVGQTDSGIWMFRYGSAEVFVQHTEEDFLTIWSPVLPLPVADYRKLLTLNW--LTTFEAHFAIA--EEQVQVVASRTLGGITAGEISRLITIVATLADDYDDALRAE...... 152
18 -10.3001ry9_A mol:protein length:145 Surface presentation of antigens protein spaK  ali model follow..  11..NLVQLVRDSLFTIGCP-DLDSHSAITISLDSMPAINIALVNEQVMLWANFDAPSDVKLQNILNLMLMNFSSINELVELHRSDEYLQLRVVIKDDYVDGIVFAEILHEFYQRMEILNGVL......... 139
19 -10.2002fm8_A mol:protein length:135 Surface presentation of antigens protein spaK  ali model follow..  10  5..DIAELVRSALEVSGCD-GIDSHSTIVLDLFALPSICISVKDDDVWIWAQLGADSMVVLQEILMTIMEGCHARGGQLLLGEQNGELTLKALVHPDFLDGEKFSTALNGFYNYLEVFSRSL......... 133
20 -10.1002xga_A mol:protein length:153 SURFACE PRESENTATION OF ANTIGENS PROTEIN SPAK  ali model follow..  19..NLVQLVRDSLFTIGCP-DLDSHSAITISLDSMPAINIALVNEQVMLWANFDAPSDVKLQNILNLMLMNFSSINELVELHRSDEYLQLRVVIKDDYVDGIVFAEILHEFYQRMEILNGVL......... 147

FFAS is supported by the NIH grant R01-GM087218-01
1 0 9 0 4 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.