current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: gi|16082706|ref|NP_395152.1| hypothetical protein (YPCD1.16c) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MIMTQPKQTKRRFSPEFKLEAIEQVVKYQRSTIEVARALELDPSQLRKWIRQYKEEVSGMTPDNPALTPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIKSLRLast
1 -12.300sp|Q9P215|POGK_HUMAN Pogo transposable element with KRAB domain OS=Homo sapiens GN=POGK PE=1 SV=2 (Range: 151-450)  ali follow..  12  41...QFSRGMRRSYDAGFKLMVVEYA--ESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVKGDPITREAMQLKALEIAQE...... 145
2 -11.700sp|Q6B0B8|TIGD3_HUMAN Tigger transposable element-derived protein 3 OS=Homo sapiens GN=TIGD3 PE=1 SV=1  ali follow..  15  1.MELSSKKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKSGTANRERKRKRESKYSGIDEAIARAKAWDVTGPMLLHKAKELADI...... 112
3 -11.000sp|Q7Z3K3|POGZ_HUMAN Pogo transposable element with ZNF domain OS=Homo sapiens GN=POGZ PE=1 SV=2 (Range: 901-1200)  ali follow..  13  63...GSGGVGKKEQLSVKKLRVVLFALCCN--TEQAAEHFRNPQRRIRRWLRRFQASQGENLEGKYLSFEAEEKLAELTQREQQLPVNEETLFQKATKIGRSLEGGFK 166
4 -10.200sp|B2RD01|CENP1_HUMAN CENPB DNA-binding domain-containing protein 1 OS=Homo sapiens GN=CENPBD1 PE=2 SV=1  ali follow..  13  15.....AKRERKAITLDLKLEVLRRF-EAGEKLSQIAKALDLAISTVATIRDSKEKIKASSQIATPLRASRLTRHRS-DQSQPNATLSAAIVQEKAEFDDLQ...... 123
5 -10.200sp|Q8N3X6|LCORL_HUMAN Ligand-dependent nuclear receptor corepressor-like protein OS=Homo sapiens GN=LCORL PE=2 SV=4 (Range: 451-602)  ali follow..  14  65..PRKKRGRYRQYDHEIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKLRLPDTGL................................... 134
6 -10.200sp|Q17RP2|TIGD6_HUMAN Tigger transposable element-derived protein 6 OS=Homo sapiens GN=TIGD6 PE=2 SV=2  ali follow..  16  1.MANKGNKKRRQFSLEEKMKVVGAV-DSGKRKGDVAKEFGITPSTLSTFLKDRTKEASVGPQRKRMRSALYDDIDKAEIHAKNILVTGSVIRKKALNLANM...... 111
7 -9.640sp|Q8IY51|TIGD4_HUMAN Tigger transposable element-derived protein 4 OS=Homo sapiens GN=TIGD4 PE=1 SV=2  ali follow..  14  12...PVTVKKKKSLSIEEKIDIINAV-ESGKKKAEIAAEYGIKKNSLSSIMKNKDKSLRFDPKRKRLRTAFYTDLEEAIAQCLNVPVNGPMLRLKANDFAQK...... 120
8 -9.600sp|Q96MW7|TIGD1_HUMAN Tigger transposable element-derived protein 1 OS=Homo sapiens GN=TIGD1 PE=2 SV=1  ali follow..  12  8.....ERKSRTSLTLNQKLEMIKLS-EEGMSKAEIGRRLGLLRQTVSQVVNAVKSATPMNTRMIRKRNSLIADMEKVDQTSRNIPLSQSLIQNKALTLFNS...... 115
9 -9.360sp|Q8N3X6|LCORL_HUMAN Ligand-dependent nuclear receptor corepressor-like protein OS=Homo sapiens GN=LCORL PE=2 SV=4 (Range: 301-600)  ali follow..  18  216...RKKRGRYRQYDHEIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKE....................................................... 264
10 -9.350sp|Q53EQ6|TIGD5_HUMAN Tigger transposable element-derived protein 5 OS=Homo sapiens GN=TIGD5 PE=2 SV=2  ali follow..  15  2.......AFRKAYSIKDKLQAIERV-KGGERQASVCRDFGVPGGTLRGWLKDEPKLRWFLEQLGGEVGTQRKKMRLLALRQHGVPLSGPLIQAQAEAFARQ...... 108
11 -9.180sp|Q96JN0|LCOR_HUMAN Ligand-dependent corepressor OS=Homo sapiens GN=LCOR PE=1 SV=2  ali follow..  14  342.....KRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMRSEGP.................................. 409
12 -9.120sp|Q4W5G0|TIGD2_HUMAN Tigger transposable element-derived protein 2 OS=Homo sapiens GN=TIGD2 PE=2 SV=1  ali follow..  12  3.....GKRKRVVLTIKDKLDIIKKL-EEGISFKKLSVVYGIGESTVRDIKKNKERPTSGVSKRKSMKSSTYEELDRVQQKTDGIPVSGTICAKQAKFFFDA...... 112
13 -9.060sp|Q9Y4A0|JERKL_HUMAN Jerky protein homolog-like OS=Homo sapiens GN=JRKL PE=2 SV=2  ali follow..  12  3.....GKRKRVVLTIKDKLDIIKKL-EDGGSSKQLAVIYGIGETTVRDIRKNKEKSTSLLAKRKSMKPSMYEELDRAQQRAKGNPISGPICAKRAEFFFYA...... 112

FFAS is supported by the NIH grant R01-GM087218-01
9 8 9 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.