current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: gi|40548796|ref|NP_395146.2| hypothetical protein (YPCD1.09c) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst MAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLMEAREQRVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKDTSVLast
1 -38.800[K] COG3609 Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain  ali follow..  34  24MARTMTVDLGDELREFIESLIESGDYRTQSEVIRESLRLLREKESRLQALRELLAEGLNSGEPQAWEKDAFLRKVKTG.. 103
2 -12.000[K] COG0864 Predicted transcriptional regulators containing the CopG/Arc/MetJ DNA-binding domain and a metal-binding domain  ali follow..  30  6..TRIGVSLPKNLLDEFDRIISTRGYSSRSEAIRDAIR.......................................... 41
3 -8.410[R] COG4710 Predicted DNA-binding protein with an HTH domain  ali follow..  22FDMATSIRLSPEMEQRLNYLASHTG-RTKAYYLREIIEHGIEEMEDYYLAADVLERVRHGQEQVHSAADVRKTL...... 94
4 -6.410[K] COG3905 Predicted transcriptional regulator  ali follow..  41IMTAFTVRLPDEVAEKLDQ-LAEKLDRSRSYMAVQAIE-VAREEWQLAEIEAGLAEADRG.................... 100
5 -5.320[S] COG5500 Predicted integral membrane protein  ali follow..  18  1MATVDNLFSILELFAVLGCGLMAGVFFAFSTFVMNALARLQPTQAAMQSINITVINPL...................... 60
6 -5.310[S] COG3140 Uncharacterized protein conserved in bacteria  ali follow..  13  11........................................EQQQKAVERIQELMAQGMSSGQA................. 33
7 -5.310[K] COG1329 Transcriptional regulators, similar to M. xanthus CarD  ali follow..  35  107.................DAKINSGDLISISEVVRDLYRADNQPEQSYSERQ............................. 140
8 -5.040[S] COG3120 Uncharacterized protein conserved in bacteria  ali follow..  20  107LAQRRGKTLSETIVQLIEDAENKEKYANKMSSLKQDLQALLGKE.................................... 150
9 -5.030[A] KOG0344 ATP-dependent RNA helicase  ali follow..  16  245.....SATFAYDVEQWCKLSVSIGARNSAVETVEQELLFVGSETGKLLAMRELVKKGFNP.................... 305
10 -4.850[S] COG3792 Uncharacterized protein conserved in bacteria  ali follow..  13  1MLEKMSEAQYKRIVENNRGLTLIGMFSSFQVCYGDIRDKPEIKEMFLELMTDLMKTGE...................... 58

FFAS is supported by the NIH grant R01-GM087218-01
9 8 9 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.