current user: public




vfdb.0000004
Query: VFG1643 (gi:11322961) sfaD - SfaD protein [Escherichia coli 536], from VFDB

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# E-value Template Links and tools%idFirst MKISKMAVMLFLLPPAALAGNHWHVMLPGGNMRFQGKIIAEACSLALSDRQMTVDMGQLSSNRFHAAGEYGDPVGFDIHLQDCSTVVSQRVGISFYGVSDIHEPELLSVEEENDASDGIAIALFNESGELVKLNQPPENWVHLTRGDMKLHMQARYKATHYPVAGGKANGQVWFSLTYLLast
1 5.000e-56gi|300916462|ref|ZP_07133199.1| fimbrial protein, partial [Escherichia coli MS 115-1]  clstr ali  55  53MKRKRLFLLASLLPMFALAGNKWNTTLPGGNMQFQGVIIAETCRIEAGDKQMTVNMGQISSNRFHAVGEDSAPVPFVIHLRECSTVVSERVGVAFHGVADGKNPDVLSVGEGPGIATNIGVALFDDEGNLVPINRPPANWKRLYSGSTSLHFIAKYRATGRRVTGGIANAQAWFSLTY. 230
2 3.000e-55gi|91210139|ref|YP_540125.1| S fimbriae minor subunit SfaD [Escherichia coli UTI89]  clstr ali  98  4MKISKMAVMLFLLSPAALAGNHWHVMLPGGNMRFQGKIIAEACSLALSDRQMTVDMGQLSSNRFHAAGEYGDPVGFDIHLQDCSTVVSQRVGISFYGVSDIHEPELLSVEEENDASDGIAIALFNESGELVKLNQPPENWVHLTRGDMKLHMQARYKATHYPVTGGKANGQVWFSLTYL 182
3 4.000e-54gi|283786569|ref|YP_003366434.1| fimbrial subunit FimI [Citrobacter rodentium ICC168]  clstr ali  57  1MQRMKACLLLLLSPACALAGNKWNVTLPGGNMRFQGVIIAESCRIEAGDRQMTVQMGQISSQRFHAPGEDASPVPFDIHLQECSTAVSQRVGIAFHGVADGKNPDVLSVGEGPGIATGVGIALFDKDGDLLPLNHPPVSWTRLYAGPTTLHFVAKYRATGHQVTGGLANAQAWFSLTY. 178
4 2.000e-53gi|188534987|ref|YP_001908784.1| FimI fimbrial protein, FimI [Erwinia tasmaniensis Et1/99]  clstr ali  51  1MLKIRLGLFLMLLAPLSMAGNKWNVTLPGGQMRFQGELIAEACTVDIGDRQLIVHMGQVSSNRFKAVGDDADPVPFTLHLQDCNTNVSERVGIVFHGVADGKNPDVLSVGEGEGTATGVGIALFDDTGKMIPVNSVPQAWKPLVNGARELQFVARYRATGHAVNGGKADAQAWFSLTY. 178
5 6.000e-53gi|395232514|ref|ZP_10410764.1| fimbrial subunit FimI [Enterobacter sp. Ag1]  clstr ali  53  1MRGIKLILLSVLLPSLALAGNRTHVMLPGGNMRFQGTIVAESCRVEAGDRQMTVEMGRISSNRFHAPGEDSDPVPFALHLQDCNTNVSRHVGVAFMGVADGKNPAVLSVGEGPGIAEGVGVALFDAEERQIPLNAPAKAWTRIYAGPNTLHFIAKYRATGHQVTGGLANAQAWFSLTYL 179
6 2.000e-52gi|402841476|ref|ZP_10889926.1| putative type-1 fimbrial protein, A chain [Klebsiella sp. OBRC7]  clstr ali  55  1MHKMRSALFIFLLPTLALAGNRWNVTLPGGNMRFQGEIIAESCRVEAGDRQMVVTMGQIASNRFHATGEDAISVPFDIHLQECNTAVSQHVGVAFTGVADGKNPDVLSVGEGPGIATGIGIALFDKDNSLIPLNQPPRRWMQIYTGPTTLHFVAKYRATGKQVTGGVANAQASFSLTY. 178
7 5.000e-52gi|423122000|ref|ZP_17109684.1| fimbrin-like protein fimI [Klebsiella oxytoca 10-5246]  clstr ali  57  4MQGMKSGLLFFLLSPLALAGNQWNVTLPGGNMRFQGVIIAESCRVEAGDQQLTVNMGQISSNRFHSPGEDTDPVPFDIHLQDCSTAVSQRVGVAFHGVADGKNPDVLSVGEGPGIATGIGVALFDKEDRLIPLNSPPGAWSRLYTGPTTLHFVAKYRATGHQVTGGAANAQAWFSLTY. 181
8 3.000e-50gi|384376605|gb|AFH78431.1| putative fimbrial protein [Klebsiella pneumoniae]  clstr ali  57  1.........MFLLPPLALAGDHWNVMVAGGSLQFHGVIIAESCRVEVGDQQMTVNMGQVSSNRFHSTGEDASPVPFDIHLQDCSTKVSQQVGVSFRGVADGKNPDVLSVGEGPGIATGIGIAFFNKEDQLIPLNGPPSLWQRLYTGPTTLHFVAKYRATGKQVTGGMANAQVWFSLTY. 169
9 8.000e-50gi|295097589|emb|CBK86679.1| P pilus assembly protein, pilin FimA [Enterobacter cloacae subsp. cloacae NCTC 9394]  clstr ali  37  8.........ALLIAGTALFAVLPAAAKDDGSVTFQGQVVNAACSVSMDSQDQIVHMGQVRNSQFIAAGDWAKPVPFFITLEACDTSVSQRAGVLFSGESDSNDPQVFRAGYGPGAATGIGIGLFDAMGNLVKPDTAPPWYRPLQDGENRLSYIARYRATEDSVNAGTANAQVWFIVFY. 176
10 1.000e-48gi|238896400|ref|YP_002921138.1| type 1 pilus biosynthesis fimbrial protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  clstr ali  55  52...................GNHWNVTLPGGSMRFQGLIMASSCRVEAGDRQMTVNLGQISSNRFHAVGEDSNPIPFAIHLQDCSTAVSQHVGVTFHGVADGKNPDVLSVGEGPGIASGIGIALFDSQGQQLPLNRPADRWISLYRGPTTLNFVAKYRATGRQVTGGAANAQAWFSLTY. 210
11 3.000e-48gi|423103777|ref|ZP_17091479.1| fimbrin-like protein fimI [Klebsiella oxytoca 10-5242]  clstr ali  56  1MQRMKSGXXXXXXXXXXXXGNQWDTMLPGGNMRFQGIVIAESCRVEVGDRQMTVKMGQISSNRFHSAGEDTNPVPFDIHLQECSTAVSQRVGVAFHGVADGKNPDVLSVGEGPGIATGIGVALFDNTGSQIPLNAPPGAWTQLHTGPTTLHFVAKYRSTGNQVTGGAANAQAWFSLTY. 178
12 4.000e-48gi|336248646|ref|YP_004592356.1| fimbrial protein BcfF [Enterobacter aerogenes KCTC 2190]  clstr ali  29  5...........LYLCWGLALVASGALAHDGRVYVTGTITDNTCTLSPDSENIQVDMGTVSNRQFYQAGAGAEWQPFSITLQNCGSTASG-VTVSFSGTSDPQDGDLFAVNTGADTASGIGIALYDKNKQQIAPGAQSDVLALTAGASERLQFYARYVADGAPVAPGAADASATFVLSY. 171
13 1.000e-47gi|15833685|ref|NP_312458.1| fimbrial major protein [Escherichia coli O157:H7 str. Sakai]  clstr ali  31  1MEFFMKKVVFALTALALTSGTVFAAESGDGTVKFTGEIVDSPCVLSVDSQNQEVVLGQVQKSVFAAVGDKSPAKPFEIKLEDCDTTTMKKANVSFSGVGDADKSDLISVSTEAGAAKGVGIGIYDNSNTLVALNG-GKASVDLSKGQTVLYFTANYVSTLATVTTGYGNAQVDFNLSY. 177
14 2.000e-47gi|423111566|ref|ZP_17099260.1| hypothetical protein HMPREF9687_04811 [Klebsiella oxytoca 10-5243]  clstr ali  27  1..MNKYAYYACMACCLLTTA---TADAHDGRVYVTGTITDNTCTLSPDSENINVEMGSVSNRQFYQAGDGSAWQPFAIDLQNCGSTVSG-VTVSFSGTANQRNTDLLALIDAADDATGIGIGLYDQDKHLIPPGQTSEVIALSPGQTAHLQFYARYIADGSAVTAGKANASATFILAY. 173
15 7.000e-47gi|212712675|ref|ZP_03320803.1| hypothetical protein PROVALCAL_03772 [Providencia alcalifaciens DSM 30120]  clstr ali  42  1.MRELLAVSLLLFSPFLQAGNKWKVQLPGGGMRFQGELIAEGCTVETSDRNLVVNMGQVRTNAFKAPGQDSAPTAFDLHLRECSNAVSEYVSITFNGVANERNPDIFSIGDGPNTAKGVGVAIFDSKNTLIPVNSAPRKVANLRDGDMTLHFVAKYRSTSENIMGGKANTQALFSLTY. 177
16 8.000e-47gi|366158278|ref|ZP_09458140.1| long polar fimbrial protein LpfA [Escherichia sp. TW09308]  clstr ali  32  1MKK----VIFALSALALTSGSVFAADSGDGTVKFTGEIVDAACVLSVDSQNQEVVLGQVQKSVFKAIGDKSPSKSFEIKLEDCDITTLKKVKVGFSGVGDADKPELISVSTESGAAKGVGIGIYDNSNTLVPMNT-GNTTANLKKGQTVLYFTANYVSTLATVSTGYGNAQVDFDLSY. 173
17 9.000e-47gi|238027858|ref|YP_002912089.1| fimbrial major protein [Burkholderia glumae BGR1]  clstr ali  23  165...........VAGALLALAVSTSAHAFDGTVNFNGNVVDAPCTISTDGKNLQVSMQDISTGAVLDG--SAPKTPFSIKLNNCSTAIKKTVQVTFSGTKAGD--GMLALTSESGAAKNVAIQLY-QDGKALKLDTTSAS-VKLKTGDNDIPFAAQYTSNGGTPVAGKANAIAQFTLSY. 325
18 2.000e-46gi|375258214|ref|YP_005017384.1| hypothetical protein KOX_07075 [Klebsiella oxytoca KCTC 1686]  clstr ali  37  9..KAFSLAGAFLFPALAQAGNHHVVTVKGGDVEFQGAVVNAACAVDAGSEDLTVEMGQVRSNEFHGLGSWTDPQAFTITLKDCDTTVSQQVSVAFRGLTDGKDPGVLAVTDGAQSAQGVGLGIFDNQGNQIIPNTQPMNFTAIQDNTTVLNFVAKYRATSRTVVAGDANAQTWFTLTYL 185
19 3.000e-46gi|417113235|ref|ZP_11965155.1| type-1 fimbrial protein, A chain [Escherichia coli 1.2741]  clstr ali  27  20MKLKHVGMIVVSVLAMSSAAVNAATTVNGGVIHFKGEVVNAACAIDSESMNQTVELGQVRSSRLAKAGDLSSAVGFNIKLNDCDTNVSSNAAVAFLGTTVTSNDDTLALQSSAGSAQNVGIQILDRTGEVLILGATFSAKTDLIDGTNILPFQARYIALGQSV-AGTANADATFKVQYL 206
20 1.000e-45gi|417225663|ref|ZP_12028832.1| fimbrial protein [Escherichia coli 96.154]  clstr ali  39  1MYKKKLCAAVTLWLSVFVDASAHHVVIDGGITHFRGILTAEACTISTDSRSQTVNLGQFRSNQFNGVGSLTSPVGFSIRLTECSTAVSDQVKVAFYGVTDGKDPQVFKAGEGVNAASGIGLALFNELGQIIEPNTHSGFLSRLHEGDNTLRFHARYRATSREVTGGNANAFTWFALTY. 181
21 1.000e-45gi|91210138|ref|YP_540124.1| S fimbriae major subunit SfaA [Escherichia coli UTI89]  clstr ali  26  1MKLKFISMAVFSALTLGVATSASAAPVNGGTVHFKGEVVNAACAVNMNSVDQTVLLGQVRTKKLANLDDVSGPVGFNIQLDECDSTTSGSVKILFSGTPVAGKNNALAIQSSSGAATNVGIQILDSSGNPVTLNSDQSAVYTLTDGTNNIPFQARYIATGQS-TAGTANADATFKVQY. 180
22 3.000e-45gi|306812512|ref|ZP_07446705.1| S-fimbrial protein subunit precursor [Escherichia coli NC101]  clstr ali  28  1MKLKFISMAVFSALTLGVATNASAATVNGGTVHFKGEVVNAACAVNMNSVDQTVLLGQVRSATLGSDGKTSGSVGFTIQLDDCDLTTTQSAKIIFSGTPVTGKTNVLALNSASGAATNVGIQILDSKGQPVELNSDAASEYTLTDGTNKIPFQARYYATGQA-TAGIANADATFKVQY. 181
23 5.000e-45gi|157146853|ref|YP_001454172.1| hypothetical protein CKO_02628 [Citrobacter koseri ATCC BAA-895]  clstr ali  28  24MKLKLMSSVIAGLMFAAGAAHADPVSVSGGTVHFEGELVNAACAVSTKSADQTVTLGQYRTASFTAVGDTSAQIPFTIVLNDCDPSVAATAAVAFSGQADGTNDSLLAVVSGDNTAGGVGIEILDNTSSPLKPGATFSTAQALVEGSNTLRFTARYKATAADTTPGQANADATFIMKY. 205
24 5.000e-45gi|365837594|ref|ZP_09378958.1| fimbrial protein [Hafnia alvei ATCC 51873]  clstr ali  27  19.KTCLICVVTGLFCRDVIAGNHHVVTVYGGQLNYKGAVVSAPCSVSIDSQNQLVTMGQVRVKEFDGIGSWSQSQAFTIKLEDCDTDLAPTAGVLLKGITDGKDPQVFATEHSQGSAKGVGIGIFDSQGNLIIPNSAPITFMSLIDGNNTISFSAKYRATENTVLAGSANAAISFEMVY. 195
25 7.000e-45gi|293393805|ref|ZP_06638112.1| fimbrial protein [Serratia odorifera DSM 4582]  clstr ali  25  35MKLNKVMMAAVIAFGATSFAHAAVKDQGHGKVNFIGSIIDAPCSIAPESIDQTVDLGQVSNVALKDGG-TSNPRPFDIKLEQCDTTTLKSVSVTFTGTESTGNKDLLAI---AGTAKGAGIAIS-YDGKPITLGDATPSQNLNNN-NNTLHFAAYLQGEGAAVVPGDFTAVADFTLAY. 208
26 1.000e-44gi|157146562|ref|YP_001453881.1| hypothetical protein CKO_02323 [Citrobacter koseri ATCC BAA-895]  clstr ali  27  1.MMNKVALGLFIAATVGCSASAFAATNGEGQINFTGEIIDSACQVVNGSNPLNVELGRVSKTVFSGAGSTSTPTKFDIQLKDCPEMVT-SAAINFGGTPDTDNSTTLALTPDTETATGVAIQLLDSSEQPVSLYTPSRQYPLTAGSTNDLEFAARYIQTQAAVTAGPANSVSTFTVIY. 178
27 1.000e-44gi|423106821|ref|ZP_17094516.1| hypothetical protein HMPREF9687_00067 [Klebsiella oxytoca 10-5243]  clstr ali  51  18..................AGEYWETMLPGGAMRFQGELLAEACSVEISDRSLTVNMGQIRTNMLHAPGEDADPVEFDIHLRDCNRNVSQYVGVTFNGVADGKNPDVISVGEGPGIAQDIGVAIFDASNTLIPLNSPPRRVASVVNGETILHFVAKYRATGHHVMGGKADAQAWFSLTY. 177
28 2.000e-44gi|386015541|ref|YP_005933822.1| putative FimI fimbrial protein [Pantoea ananatis AJ13355]  clstr ali  40  21MGYRMLVALLSLACFPLMAGQKWNVTLPGGRLSFSGEAIVAACQVDG--VEKTVDMGQISSNRFRYAGEYSPAVPFDIRLVNCSPRASHHVSVAFRGLTDTRMPSALSVGDAEDTASGVAIALADDEGHPVSVNSPLEPVWTLLNGTLSLHFIARYVSTTASVKGGRVDATATFLITYF 197
29 3.000e-44gi|161504842|ref|YP_001571954.1| fimbrial subunit [Salmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980]  clstr ali  28  5...........ILCGIGMLLAASAVQAHDGRVYVSGTITDNTCSLSPGSENINVSMGAVSQRQFYRVGDGSAWQSFAIDLQNCGSTASG-VTVSFSGAADSRNMDLLALTAGESDASGIGIALYDLNKTLIPLGQKSDVTTLSPGQSAHLQFYARYLADGGVVATGDANASATFILAY. 171
30 5.000e-44gi|119351637|gb|ABL63534.1| FimA [Salmonella enterica subsp. enterica serovar Enteritidis]  clstr ali  29  24MKHKLMTSTIASLMFVAGAAVAAPVSVSGGTIHFEGKLVNAACAVSTKSADQTVTLGQYRTASFTAIGNTTAQVPFSIVLNDCDPKVAATAAVAFSGQADNTNPNLLAVSSNSTTATGVGIEILDNTSSPLKPGATFSAKQALVEGTNTLRFTARYKATATATTPGQANADATFIMKY. 207
31 5.000e-44gi|238760595|ref|ZP_04621725.1| hypothetical protein yaldo0001_37720 [Yersinia aldovae ATCC 35236]  clstr ali  30  1MKK------LILAALVAASFSAPVYAAPPGTIRFEGEIVTGACGIDADSLDQTVNLGQVPSHMFKAIGDRSTAVPFEIVLTDCDTTTSKNATVTFTGT---GHAEKSAILGVTGAATHVGIRLQGGSNEYLDLGTVSKP-TLLSNGDNHLKFSAMYESTAANVTAGDADATAQFTVNYL 169
32 6.000e-44gi|261341387|ref|ZP_05969245.1| fimbrial protein [Enterobacter cancerogenus ATCC 35316]  clstr ali  27  1..MNKIALGLFVASVVGCSASAFAATDGEGQINFTGEIIDSACQVVNGSNPLNVTLGKVSKTVFTGAGSTSTATKFDIELKNCPETVT-SASINFGGTPDANNNTTLALTPDADAASGVAIQLLDSSEQPVSLYTPSKEYPLASGTANDLEFGARYIQTQAAVTAGPANSVSTFTVIY. 177
33 7.000e-44gi|238756155|ref|ZP_04617475.1| hypothetical protein yruck0001_26620 [Yersinia ruckeri ATCC 29473]  clstr ali  28  1.MKKVLLTVMIAVSFSAAIQAAPPVSGSPGTIRFEGEIVTGACGIDSDSLDQKVDLGQVPSHLFTAKGDRSTAAKFDIVLTDCDTTTSKNATVTFTGASHSENAALLGI---TGAATHVGIRLQSGSNEYLALGTATKP-ILLSNGDNRLQFAAMYEATDAGVTAGDADSTAQFTVNYL 174
34 8.000e-44gi|268592290|ref|ZP_06126511.1| polar fimbria protein A [Providencia rettgeri DSM 1131]  clstr ali  26  1MKKNLLASLIAATSIFAV----NNALAADGTIDFTGEIIDQACELAAGSDALKVNLGQVSKKALPNAGSTAAATKFTIKLINCPATVT-TASVKFDADSYIGDDEVIKLKEE----TGVGIQITDDTNKIVPLFTASKAYPLQQNVENNLDFRARYIAKSDTVTPGPANATATFTINY. 169
35 9.000e-44Oral.Meta HOMD ctes_c_1_4834 Comamonas testosteroni KF-1 [1338690 - 1339340] Fimbrial protein  ali  24  38.RLKYIHSLAAFALGLLMAGMALPALALDGIATFKGNLINAPCTLRPADEDLKVDLGQIFQNDFYQTG-RSDSKPFTIHLDDCDAGLASSVKVKFSGSENTSLPGLLALDTGGGT-RGVAIAIENAAG-VLPINTQTS-ALPLNAGSNDLHFTAYVQGENKTIVPGPFVATATFTFQY. 216
36 9.000e-44gi|295095355|emb|CBK84445.1| P pilus assembly protein, pilin FimA [Enterobacter cloacae subsp. cloacae NCTC 9394]  clstr ali  26  1..MNGKLFKSALVCSSLLLGWQAHAGNGNGTVHFTGEIIDSTCEVTAPTQTQTVDLGKVNKSAFSGAGSTASVQAFQIDLENCP-DTYKKATARFDGTEDGD--GYLKL--NAGGATGVAVAIYNADNTLLKLYNQSVSADIDADGKATLPFMARYIATSATVTPGVANADSEFTITY. 172
37 1.000e-43gi|238783942|ref|ZP_04627959.1| P pilus assembly protein, pilin FimA [Yersinia bercovieri ATCC 43970]  clstr ali  28  8..LTQKLLPFSLLALFPLATSSWAAEVAGGTINFNGSVVTTACAVSSDSANINVDMGQVRAATLSAAASEAPTKKFSIVLEDCDSSVSQDVAVTFSGTPDNDDPDSLAVNGGTGTAQNVAVRLYSEEGSVVKLGEASG-AVNLRDGINTLNFGAKYYSPKGGATAGDASTVATYTLTY. 185
38 1.000e-43gi|293394631|ref|ZP_06638923.1| FimI fimbrial protein [Serratia odorifera DSM 4582]  clstr ali  38  12...TIISAALMLSSAVALAGNRHHVIIDGGQVKLRGAITAAACSVSTGSEAQIVEMGDVRSNQFSGLGSYSPPVAFSIDLTGCNRAIYHAVGVSFWGVTDGKDPLVLKAGNGAQGGPGIGLALFDDHGDLMVPNAPPSRLAMINDRETRLHFSARYRATSRQVTGGEANSWAWFALTY. 186
39 1.000e-43gi|193061877|ref|ZP_03042974.1| LpfA [Escherichia coli E22]  clstr ali  30  1MKK----VLFALSALALTSTSVFAADAGDGTVKFTGEIVDAACVVSPDTQKQEVVLGQVNKSVFTAMGDKSTATPFKIKLENCDISTFKNVEISFNGVGDADNSKLVSVSTEPGAATGVGIGIYDNTNTLVDLN-TGKSATVLKEGQTVLYFTANYVSTKDAVTTGYGNAEVDFNLTY. 173
40 2.000e-43gi|301049210|ref|ZP_07196185.1| fimbrial protein [Escherichia coli MS 185-1]  clstr ali  26  1MKLKFISMAVFSALTLGVATSASAATVNGGTVHFKGEIVDAACAVSLNSFDQIVSLGQVRTAKLANDADKSAPVGFDIELSDCSTAALSNAAIIFSGSQMSGHNNILAVQGGAGTATNVGVQVTDYTGKPVVFGTTASTDYKLTDGTNKIPFQARYIAVDGQATAGTANADATFKVQY. 180
41 3.000e-43gi|170766832|ref|ZP_02901285.1| long polar fimbria protein A [Escherichia albertii TW07627]  clstr ali  31  1MKK----VVFALSALALTSGSVFAADSGDGTVKFTGEIVDTPCVLSVDSQKQEVVLGQVQKSVFTAAGAKSPSKPFEIKLEDCDTGSGKTVKVGFNCVGDSDNGELVSVSTEAGAATGVGIGIYDNTNTLIKLNS-GEAETTLKDGQTVLYFTANYVSTKDTVTTGYGNAEVDFNLSY. 175
42 3.000e-43gi|212711606|ref|ZP_03319734.1| hypothetical protein PROVALCAL_02681 [Providencia alcalifaciens DSM 30120]  clstr ali  23  1MNRNTFKSLFSIILLF----SSQSAVSVDGNIEFIGEIIDQACEVKTDSKNIQVPLGSIPKANLPNVGSKSTPVLFTITLINCPVTVTR-ASVLFDAIPYPGDNTVLALKADTGVATGVGIQLTDKSNAIITLLTPSNSYALLPNVDNPLNFTANYIAKASPVTPGPANGAATFLIVY. 173
43 4.000e-43Oral.Meta HOMD NCBIABWM_c_9_75 Enterobacter cancerogenus ATCC 35316 [32956 - 33573] long polar fimbria protein A  ali  27  55........................AFASNGIVHFTGEIIESTCEVSTGTKDQTVDLGKVNKSTFTDVGSTASVQAFQIDLVNCPQT-YKKANARFDGTEDGD--GYLKLNN--GGAAGVAIAIYNADNSLLKLYNQSKTADISAEGSASLPFMARYIATSSTVTAGLANADSEFTISY. 204
44 4.000e-43gi|254245477|ref|ZP_04938798.1| type 1 fimbrial protein precursor [Burkholderia cenocepacia PC184]  clstr ali  30  28MKKSILSAVALAAL------STSAFAAGTGTINFTGEIVAGACGIDSNSVNQTVQLGKVPTNKFKQAGDKSDPVSFDIKLTDCDTSIAQNAYFTFTGTSSAGQPKLLATI---GSATNVGIRLQAASGEYLDNGAEQKAPTLLQNGTNTARFAAMYEATAAGVTPGTADGVANFTVRY. 196
45 4.000e-43gi|423126810|ref|ZP_17114489.1| hypothetical protein HMPREF9694_03501 [Klebsiella oxytoca 10-5250]  clstr ali  21  1MKKN-----LLAVALMATSVFASSAFASDGAVNFTGSITDAACTVDTASQNQDVFLGNIARTAFPVAGSLAAAKKFTLVLKNCPDTVTG-ATVRFDGAQVSGDNSVLALTAGSTTAKGVGVQISDDQNKVVPLYEDSSVYPLVSTADNKLSFSARYISLTDAVTVGDANAVTQFTVVY. 172
46 4.000e-43gi|417514239|ref|ZP_12178090.1| Long polar fimbria protein A precursor [Salmonella enterica subsp. enterica serovar Senftenberg str. A4-543]  clstr ali  28  1MEFLMKKVVFALSALAVVSTSAFAAESGDGTIHFTGEIVDAPCVVSTDSQNQEVVLGQVKKNIFKAIGDKSVSKPFQIKLEDCDITSQTKVNVSFAGVGDADDATLVSVNTEAGAATGVGIGIYDNANKLVEMN-TGKSTTTLAAGQTVLYYTANYVATKDTVTTGYGNAEVDFNLSY. 190
47 6.000e-43Oral.Meta HOMD esak_c_1_7014 Cronobacter sakazakii ATCC BAA-894 [2490628 - 2491188] Fimbrial protein domain-containing protein  ali  24  9.MMKKILLMTTMAALACSSSLTWAATTGEGQVNFTGEILDAACEVNSQSSPLAVDLGKISKTAFTGIGSTTNITSFVLQLKNCPETVTK-ASIKFGGTADTNNVDVLALTGGTGAASGVGIQLVDADGTPLNLYTASADYALTGTATNNLEFGARYIQTGATVTAGVANGSSTFTVTY. 186
48 6.000e-43gi|403051349|ref|ZP_10905833.1| type-1 fimbrial protein subunit A [Acinetobacter bereziniae LMG 1003]  clstr ali  29  1MKLSLLKIALSALAISGSAFAADAVTVNGGTVHFTGELVNAACAVSTESANQTVDLGQYRIARLEAAGDKTTPVPFQIKLVDCDPTVQATAAVAFYGQAETSNPNLLTVSAGSNAATNVGIEISDDTSKILGVGSSFSTPKNLIAGDNTLQFSARYVATGKS-TPGQANADATFVVKY. 181
49 7.000e-43gi|183597717|ref|ZP_02959210.1| hypothetical protein PROSTU_01015 [Providencia stuartii ATCC 25827]  clstr ali  44  15...............LMEAGNKWQVQLPGGGMRFQGELIAEACSVETSDRSLIVNMGQLRTNMLNASGQDTDPVIFDIHLRECSAVASEYVSITFAGIANDKNPAIFAIDNGPNTATGVGLAIFDSKDTLIPINSSPRKIERVSNGDMTLHFVAKYRATSDQITGGKADAQALFSLTY. 177
50 7.000e-43gi|76810250|ref|YP_333455.1| FimA protein [Burkholderia pseudomallei 1710b]  clstr ali  30  41MKK------ALLSAVACAALSTSAFAAGTGTLNFTGEIVAGACGIDAGSVDQTVRLGFVPANTFKAAGDKSTPQNFDIKLVDCDTSVAKNAYFTFTGTSNATQPKLIA---TVGSATNVGIRLQSASGEYLDNGAEQKGPVVLSNGTSVARFAAMYESTAASVTPGTADGVANFTVRY. 209
51 7.000e-43gi|429099833|ref|ZP_19161939.1| Type-1 fimbrial protein, A chain precursor [Cronobacter dublinensis 582]  clstr ali  25  1..MKKFVLTAVLAGAACWATSSFAAANGEGQVNFSGEIIDSACEVNTASSPLQVSMGKIAKSVFSSVGATSTPTLFKIQLKNCPETVT-SASITFGGTPDTNNNNVLALKSETGVASGVGVQILDSSESPLNLLTPSSDYTLSGDVTNDLQFGARYIATSATVTAGKANAVSTFTVVY. 177
52 8.000e-43gi|422023413|ref|ZP_16369918.1| fimbrial subunit FimI [Providencia sneebia DSM 19967]  clstr ali  47  1.MKGLMLGLLLLVSPLMEAGNKWQVQLPGGGMRFQGELIAEACSVEISDRNLTVNMGQLRTNMLNAPGQDTDPVIFDIHLRECSDAVSQYVSITFSGVANDQNPQIFSVGNGPDTATGVGLAIFDSKNTLIPINSAPQKIARTSNGDMTLHFTAKYRATSYQVTGGKADVQALFLLTY. 177
53 9.000e-43gi|146310648|ref|YP_001175722.1| fimbrial protein [Enterobacter sp. 638]  clstr ali  25  1MKFSNIASSVIASLVFVAGAVHAPVSVNGGTVHFKGELVNAACAVNTESADQIVNLGQYRTAKFTKVGDTTSNIPFNIELNDCDPEVAKTASVAFTGQIDPTDKTLLAVTSGDNTAQGVGIEILDSQSSTLTPGATFSAAKALIEGTNTLNFTARYKSTAATTAPGQANADATFVMKY. 186
54 1.000e-42gi|261344644|ref|ZP_05972288.1| type-1 fimbrial protein, A chain [Providencia rustigianii DSM 4541]  clstr ali  48  12............FSPFLQAGNKWKVQLPGGGMRFQGVLIAEACSVETSDRTLTVNMGQLRTNMLHAPGQDTAPVIFDIHLRECTQAVSEYVSITFSGVANDKNPDIFSVGDEPNTAQGVGLAIFDSTNTLIPINSTPRRIDRITNGDMTLHFVAKYRATSYEITGGKANAQALFSLTY. 177
55 1.000e-42gi|197287164|ref|YP_002153036.1| frimbrial protein [Proteus mirabilis HI4320]  clstr ali  29  1..MSKLNKSLCALGVTLSIFSAPAALA-SGTINFTGEITDQACTVDGSSKNLTVDLGKVSSKSLATKGEVAGLKDFTIKLIDCPVDT--TVAVRFGGTRDASDRDILAIDQVSGGATNVGIALFEKDASQIKLYDDSQD-VQITGTEINLDYVARYKAT-DAATPGPANGSAVYSIQY. 172
56 1.000e-42gi|336248645|ref|YP_004592355.1| fimbrial protein BcfE [Enterobacter aerogenes KCTC 2190]  clstr ali  26  1MRLIRYFFLLILLCGSGC-----YADDSGYNLEFTGTIVAQTCDIEISSLSQSIDLGQFSVEDFPSTGTTTKFKPFNINLKNCSRGITGS-KIWFTGTADSDNPALLALSDTGMGASGVGVEILDEDQDAVSINNTSSVVYPLKTGRNTLSFYIRYKSTRPTVTSGNATAVMYFDLQY. 177
57 1.000e-42gi|197286060|ref|YP_002151932.1| fimbrial subunit [Proteus mirabilis HI4320]  clstr ali  23  1MRKSFIAMLIATTSIFV----ANNALAADGTIDFTGEIIDNACELAAGSDALKVNLGKVSKTALPSAGVTAAATKFTIKLINCPATVS-TASVKFDAESYSGDDTVIALKQESGVATGVGIQITDDANTVVPLFTASKTYPLKEGVENNLDFRARYIAKTDSVTAGLANANATFTINY. 173
58 2.000e-42gi|375261350|ref|YP_005020520.1| putative major type 1 subunit fimbrin [Klebsiella oxytoca KCTC 1686]  clstr ali  25  1MKKKI----VIAILAAGSALSMTQAFAAAGTVNFNGNILDAACDIDVASQNQVVVLGDYYKTEFPVAGSRTAATKFDIILKNCPVTVTN-AKVRFDGTPDPDNSNLLAIDSSVGAATGVAINLMTADKADLPLGSNGYSYILSSTADNTLNFYAQYMSTAATVVAGPANSVANFSVVY. 175
59 2.000e-42gi|290473805|ref|YP_003466679.1| fimbrial-like adhesin protein [Xenorhabdus bovienii SS-2004]  clstr ali  25  1MKFKLIISSLFVSSLF-----ATTANATIGTVNFKGEITDKTCEIDAASANQTVNMGKVSVKEFSGENKVAAATKFSIKLTECPTEI-KNALVKFDGSSHESKGKLLALTTDSKNAKGVAIGIYDNSDNLVGLYKDSKSY-AIEKGAAELPFIAKYVATSDNVSAGSANAVARFTVVY. 172
60 2.000e-42gi|402844708|ref|ZP_10893059.1| putative type-1 fimbrial protein, A chain [Klebsiella sp. OBRC7]  clstr ali  24  4...........TMLSACFMLAAANAMAADGTIHFTGSITDQTCKIDTGSQNLPVNLGNVAQTALNGAGMRAAPTQFTINVSECPETVTG-ANVKFDGTSDNNDQSLLALDSGTGIATGVGIQIADKNGTAIPLHSASSDYT-LAEGANALDFVARYVSTGPAVTTGTANGTSEFTIIY. 169
61 2.000e-42gi|333925985|ref|YP_004499564.1| fimbrial protein domain-containing protein [Serratia sp. AS12]  clstr ali  61  15.............SATAQAGNRWHVILPGGNMQFQGEVIEEACSIALENKQMTVSMGQISSNNFHAAGAFSEPVHFDIHLQNCSTSVSQHVGISLHGVADSREPDLLAVNNEQDYSNNIAIAFFDEHERPIKLNHPPKFWKRIVDGPVTLHLLARYKAIQYPVMGGKANGQLWFFLTY. 179
62 2.000e-42gi|311277959|ref|YP_003940190.1| fimbrial protein domain-containing protein [Enterobacter cloacae SCF1]  clstr ali  37  12......LLLSLVAAPSAYAGNHHYVNIHGGDVHFFGQVVNAACSVSADSRNQTVQMGQVRSNQFASLGDWEDPQPFQIALEDCDTAVSQNVGVLFTGESDGKDPLVFRAGYGAGAAHGVGIGIFDGAGNLLVPDTRPPWFAPLQEGETVLSYTARYRATDRRVKAGSASAQVWFNVIY. 183
63 3.000e-42gi|212711613|ref|ZP_03319741.1| hypothetical protein PROVALCAL_02688 [Providencia alcalifaciens DSM 30120]  clstr ali  22  1MKKNLLASLIAASSIFAV----NSALAADGTIDFTGEITDQACELAAGSDALKVNLGKVSKKALPSAGSTAAATKFTIKLINCPTTVT-SASVKFDATSYPGDDSVLKDAGQSGVAKGVGIQITDDVNTVIPLFTASKAYPLKDGVENNLDFRARYIAQTDSVDVGLANANATFTINY. 175
64 5.000e-42gi|423111949|ref|ZP_17099643.1| hypothetical protein HMPREF9687_05194 [Klebsiella oxytoca 10-5243]  clstr ali  31  5..RKKLCLCVCLYILGTAVTFAENRTQYGGVVHLRGAVTDGTCAVSTESENKQVYMGQVQSSRFEELGAWADPVAFSLVLVDCTVASEKQVGIMFNGVSDGKDPLVFRAGEGANAAQGVGIGIFSASGELIIPNTRPQLLTSLNGETVTLPFTARYRATSRQVIAGDASSNVFFTLYY. 180
65 5.000e-42gi|419761973|ref|ZP_14288223.1| fimbrial protein [Klebsiella pneumoniae subsp. pneumoniae DSM 30104]  clstr ali  24  11.KMKLNKIVMALVLAFSTVSGAQAADQGHGKVTFTGSIIDAPCSITPQSIDQTVDLGQISKEALLSGGK-STPRNFSIGLENCSPATKNKVQVTFTGMESAAKNGLLGI---TGTAKGASVAITQADGQIIKLGVPTKEQV-LQDGNNTLSFAAYLQGDGDSVTEGEFQAVTDFTLAY. 188
66 5.000e-42Oral.Meta HOMD kpne_c_1_12759 Klebsiella pneumoniae NTUH-K2044 [4380427 - 4381152] FimA  ali  26  61MKIKTLAMIVVALSLSSTAALADTTTVNGGTVHFKGEVVNAACAVDAGSIDQTVQLGQVRSAKLATAGSTSSAVGFNIQLDDCDTTVATKASVAFAGTADSSNTTVLALNSAAGSATNVGVQILDNTGTPLALGATFSAATTLNDGPNIIPFQARYYATGAATAG-IANADATFKVQY. 241
67 5.000e-42gi|114048882|ref|YP_739432.1| fimbrial protein [Shewanella sp. MR-7]  clstr ali  25  1.MLNKKISLLALMAGLAIS---YNANASDGQINFTGTITDETCTVNSPSSPLSVTLGSVAKSAFSGVGSTAAATKFTIMLTGCPQSANNSVSVKFDGIADGTNKDVLALTAGEGVAEGVGIQLTEDNGTVLPLFSASSSFT-LADGDNKLNFIARYIATSATVTAGTANAVSNFTIIY. 175
68 6.000e-42gi|331659197|ref|ZP_08360139.1| type-1 fimbrial protein, C chain (Type-1C pilin) [Escherichia coli TA206]  clstr ali  28  1MKLKFISMAVFSALTLGVATNASAATVNGGTVHFKGEVVNAACAVNTNSFDQTVNLGQVRSERLKVDGAKSNPVGFAIELNDCDSQVSAGAGIVFSGPAVTGKTDVLALQSSAGSATNVGVQITDHTGKVVPLDGTASSTFTLTDGTNKIPFQAVYYATGQA-TAGIANADATFKVQY. 179
69 6.000e-42gi|120393|sp|P13421.1|FMA_SERMA RecName: Full=Fimbria A protein; Flags: Precursor  clstr ali  27  1MKLNKI--MLATVLAFGVSSLANAADQGHGKVTFTGSIIDAPCSIAPESADQTVEMGQISNVALKNGGK-SAPRQFDIKLEQCDTSTLKTVTTTFDGKASAANPDLLGII---GTASGASIAITDMASNPIKLGTATAPQT-LNDGNNTLRFAAYLQGDGATVVPGDFTAVADFKLAY. 173
70 6.000e-42Oral.Meta HOMD NCBIABWM_c_5_60 Enterobacter cancerogenus ATCC 35316 [20327 - 20953] type-1 fimbrial protein  ali  26  23MKLSNIATTVIXXXXXXXXXTTTPVSVNGGTVHFKGELVNAACSVNTDSSEQTVKLGQYRTAKFTKVGDTTSNIPFTIELNDCDPQVAKTAAVAFTGQIDATDKTLLAVTSGDNSAKGVGIEILDSKSTTLTPGATFSAAQNLIEGTNILNFTARYKATAAATTPGQANADATFVMKY. 208
71 7.000e-42gi|291085738|ref|ZP_06353904.2| type-1 fimbrial protein, A chain [Citrobacter youngae ATCC 29220]  clstr ali  25  24MKHKLIASSVIASLMLVXXXXXXPVSVSGGTVHFEGELVNAACAVSTQSSDQVVTLGQYRTASFTAVGDTTAQIPFTIVLNDCDPKVAATAAVAFSGQTDITNNNLLAVSSNSTTAGGVGIEILDNTSTALKPGATFSTAQALVEGTNTLRFSARYKATATSATPGQANADATFIMKY. 211
72 7.000e-42gi|157372903|ref|YP_001480892.1| fimbrial protein [Serratia proteamaculans 568]  clstr ali  27  1MKLNKL-MLATVIAFASASVAHAASNQGSGKVTFTGEIIDAPCSVAPESVDQTVPMGQISSRLLAKEGKSSSE-PFSIELKDCSIATMKNVQVTFTGTPDPDNSKLLAL---SGTATGAGIMIYDNHSKDVELGTATDGQG-LTEGNNSLKFAAYLQGSSAAVVPGEFTSVANFTLAYL 176
73 7.000e-42gi|333928873|ref|YP_004502452.1| fimbrial protein domain-containing protein [Serratia sp. AS12]  clstr ali  24  1MKKNLLALAVVSASVFTTS-----AFAADGVVNFKGSITDQSCTVDTTSKNKEVVLGKVSKDAFT-AGKTAGAKQFSLVLKNCPKTVSG-ATVRFDGTKVVGQAGLLTLTEATDAATGVGVQLLDDQNSVINLGVDSRIYTLVSTGDNTLDFMARYYAYAA-VGTGSANATANFTVVY. 170
74 9.000e-42gi|296102728|ref|YP_003612874.1| putative major type 1 subunit fimbrin [Enterobacter cloacae subsp. cloacae ATCC 13047]  clstr ali  25  1MMKNK---MMITLLAVGSALTATHAFAAAGTVNFNGNILDSACDVDVASQNQVVVLGDYYKTEFPTTGARTAATQFNIVLKNCPVTVTN-AKVRFDGTPDATNSSLLAIDSSAGAATGVAINLMSADKADLPLGSNSYSYVLSSTADNTLSFYAQYISTAATVTAGPANSVANFSVVY. 176
75 9.000e-42gi|74314253|ref|YP_312672.1| major fimbrial subunit [Shigella sonnei Ss046]  clstr ali  24  1MKRNIIGGAFTLASLML----AGHALAEDGVVHFVGEIVDTTCEVTSDTADQIVPLGKVSKNAFSGVGSLASPQKFSIKLENCPATYTQ-AAVRFDGTEAPGNPGDFTGTGQAIAATGVGIRIFNSDNSQVKLYNDSAYTAIDAEGKAEMKFIARYVATNATVTAGTANADSQFTVEY. 188
76 9.000e-42gi|354723848|ref|ZP_09038063.1| putative major type 1 subunit fimbrin [Enterobacter mori LMG 25706]  clstr ali  26  1MKKNIIAAAIVATAALSMS----NAFAAAGTVNFNGEILDAACTVDVGSQNQTVELGKYNKSEFAAAGDVTAATKFDIVLKDCPATVT-SASVRFDGTPDATDSTLLAIDSSAGAATGVGINLMTADKAQLPLGSNGYSYALSSTADNTLDFYAQYKSTVDSVTAGPANSVANFSVVY. 175
77 9.000e-42gi|398977138|ref|ZP_10686895.1| P pilus assembly protein, pilin FimA [Pseudomonas sp. GM25]  clstr ali  27  1MKKIVAVTAATVVMGLAFANAASPASGNPGTVRFIGEIVSGACGIDANSLDQTVSLGQVPSNQFKAIGDRSTPTKFDIVLTDCDTATQKNARFTFSGVQDPAVP---ALFATTGLAQNVGIRLQASAGEMLDNGKEQVAPVVLQNGNNTVTFAAMYEATAATVTTGEADSVANFTVAY. 176
78 1.000e-41gi|238892791|ref|YP_002917525.1| fimbrial protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  clstr ali  26  1MKKTITIVCFMLAAGS--------AMAADGTINFTGSITDQTCTVDSGSQNLNVNLGKVAQTALNGAGMKAAPTRFTLSLSDCPDTVTG-ANVKFDGTSDGVNQNLLALDNGTGIATGVGIEIADKNGTAIPLHTASPDYT-LAAGANSLDFIARYVSTGAAVTTGTANGTSQFTINY. 169
79 1.000e-41gi|226328637|ref|ZP_03804155.1| hypothetical protein PROPEN_02532 [Proteus penneri ATCC 35198]  clstr ali  22  1MKKNLLAIFIA----SGSIFAVNNALAEDGTIDFTGEIIDNACELASGSDALKVNLGKVSKTALPTTGSTASATQFTIKLINCPATAS-SAAVKFDADNYSGDNTVIALKNEANVAKGVGIQITDDTNKVIPLFTESKKYPLKTGANNNLDFRARYIAKSDTVTAGLANGNATFTINY. 175
80 1.000e-41gi|401761542|ref|YP_006576549.1| fimbrial protein [Enterobacter cloacae subsp. cloacae ENHKU01]  clstr ali  27  1MKGNTLKSIVVLSSLFF--GAQTHAANGNGTVHFTGEIIDSTCEVSTGTKDQTVDLGKVNKSTFTGVGSMASVQAFQIDLLNCP-DTYKKASARFDGTEDGD--GYLKL--SSGGASGVAIAIYNADNSLLKLYNQSTPAT-ISSGKASLPFMARYIATSATVTAGTANADSEFTITY. 171
81 1.000e-41gi|311280321|ref|YP_003942552.1| fimbrial protein domain-containing protein [Enterobacter cloacae SCF1]  clstr ali  22  1..MKKIVIGALIASSLCGSVSVFAATNGEGQVNFTGEILDSACEVVNNSNPLNVNLGKVSKTAFSGIGSTADTTQFAIQLKNCPETVS-TAAITFGGTPDTDNNNVLALTAGTGVAAGVGIQLLDSSQQPLSLYTASQPYTLSGTATNNLEFAARYIQTQSTISAGPANAVSTFTVVY. 177
82 2.000e-41gi|226330180|ref|ZP_03805698.1| hypothetical protein PROPEN_04093 [Proteus penneri ATCC 35198]  clstr ali  24  1MKLNKI-MIAAITFGMVSIANAAPTDQGHGTVKFEGSIIDAPCSITPDTVDQTVNLGQISNVILKDGGK-SSPKNFYIKLENCDTSLKKSVTVAFSGANSAGNPDLLGI---TGTAKGASIAITDGSGSVIKLGQSSNPQGIL-DINNTLAFSAYLQGTGAVIVPGEFSSIANFTMSY. 178
83 2.000e-41gi|218550690|ref|YP_002384481.1| fimbrial minor structural subunit [Escherichia fergusonii ATCC 35469]  clstr ali  23  4MNILQKFILLIFTSLSMMVISCDALANDTVVVTFTGQLLAKTCDITAGSKDQPVNMGTYDANDFLNVGDVSDSHTFTINLEGCPTTTSTSANVQFTGDADAINTTLLRLTSSADSATGVGIEILDSNDKIIAINSESKELILNNNGDASLTFKLRYKSTQQNVHAGQANALLYFDIDY. 189
84 2.000e-41gi|422007996|ref|ZP_16354981.1| fimbrial protein domain-containing protein [Providencia rettgeri Dmel1]  clstr ali  28  1MKMNKLLLVAITASSFAAINASAAVDQGSGTVTFVGSIIDAPCSISPESSNQTVDLGQVSNALLSKAGS-STPRNFSIDLEKCDTTTKKNVTITFGGSKDSVNDKLLGI---TGSAKGAGVVLTDGSGTQITLDAPSAARNLLA-GNNKLVFSAYLQGNTAEVTPGEFTSVANFTLTY. 177
85 2.000e-41gi|145300598|ref|YP_001143439.1| type I pilus assembly protein FimF [Aeromonas salmonicida subsp. salmonicida A449]  clstr ali  19  1..MFRTFWIGLLLCPSLAVMAAPRAGEDGNTLHLHGRIIDQPCLVSPESADQSVDMGVVDVRELYSAGAGAQ-VPFVIRLTNCKPGIFRMAKVTFSGSADQQMSGALAF--SAGSAKGAGIRLYDATQSPLDLGTPSRGYVLGNSTENELNFFARVEGAARNIKPGDYTAVANFIVAY. 182
86 2.000e-41gi|253989886|ref|YP_003041242.1| similar to fimbrial subunit type 1 [Photorhabdus asymbiotica]  clstr ali  24  1MKAKLIISSLLASSVFISV-----ANAADGKINFTGNIIANACKIDTNSANQNVNMGTISSSAFNGVDSTAAATPFSIKLSDCPPE-YSNAQVKFDGQTDGKNSNLLALSNDKGVADGVAIGIYEEDSTLIPLIKASKFQAFTDQKTAELKFIAKYIATAQTISPGSGDAVANFTIVY. 175
87 3.000e-41gi|110640499|ref|YP_668227.1| S-fimbrial protein subunit [Escherichia coli 536]  clstr ali  28  1MKLKFISMAVFSALTLGVATNASAVTVNGGTVHFKGEVVDAACAVNTNSANQTVLLGQVRSAKLANDGEKSSPVGFSIELNDCSSATAGHASIIFAGNVIATHNDVLSLNSAAGSATNVGIQILDHTGTAVQFGVTASTQFTLTDGTNKIPFQAVYYATGKS-TPGIANADATFKVQY. 180
88 3.000e-41gi|197285328|ref|YP_002151200.1| fimbrial subunit [Proteus mirabilis HI4320]  clstr ali  26  4.KKMLVKALFTVSVLSLSGVASAATIVNGGKINFTGEIVNAACVVSTKSIDQTVNIGQYRTAQFDSVGKTVGNTDFYINLEACDTTVAQNASVSFSGVSDSNDKTVLAVSNGAGAATGVGIEITDHTGKVLPPGSVFSTAKQLIDGSNTLNFVARYKSTLDTVTPGHADADVTFKMQY. 185
89 4.000e-41gi|270260823|ref|ZP_06189096.1| fimbria A protein [Serratia odorifera 4Rx13]  clstr ali  23  1MKLNKI--MLAAVMTLGTISMANAANQGSGTVTFKGSIIDAPCSIEPGSLDQTVKLGDIASAQLKNGGK-STPQDILIKLVGCDVQTAKDVTTTFSGTESEAAPGLLAMK---GTARGASIAINDLDGKLLPLTKASKAQ-KIEDGQATLRFSAHLQGDGAAITPGEFNSVADFTLAY. 173
90 4.000e-41gi|227357954|ref|ZP_03842297.1| major mannose-resistant/Proteus family fimbrial protein [Proteus mirabilis ATCC 29906]  clstr ali  25  30MKLNKLALVLGL-GLSVVAGSALAADQGHGTVKFVGSIIDAPCSITPDTENQTVPLGQISTAALKDGG-RSNSRDFKISLENCTTETYKTVQTTFTGSEATEV--LEGSLGIEGIAKNAAVVITDAGGKQIKLGTPSAAQ-NLRDGNNDLNFAAYLQGSASAAVPGDFTAIATFALTY. 203
91 5.000e-41gi|386823920|ref|ZP_10111060.1| fimbrial protein domain-containing protein [Serratia plymuthica PRI-2C]  clstr ali  24  1MKKNLLAVAVLTASAFTAS-----VFAADGTVNFKGSITDKSCTVDTASQNQDVILGAISKTAFTGAGSSAGGKEFSLVLKDCPNTVTK-ATVRFDGTRVPGPVGLLALTDVADKANGVGVQLLDDSNNAINLGNDSREYALVSTGANTLKFFARYYAFG-TVSVGKADATTNFTIVY. 172
92 6.000e-41gi|334123086|ref|ZP_08497116.1| fimbrial protein [Enterobacter hormaechei ATCC 49162]  clstr ali  21  1..MRNGMRCLAVALFALCPHAYAETALGEINIQLYGNIVDFTCVAEGDDSNKTVTLGTWPTKQLRTTGSRTQPVPFTLKLTGCPPGA---ASVTFTGKVDGHDNSLLALNDAS-AASNVAVEILDRDKTRLALQQASQTVSVDAQGNAELSFYANYIATADNPQPGRADADATFMINY. 172
93 6.000e-41gi|401678667|ref|ZP_10810626.1| P pilus assembly protein, pilin FimA [Enterobacter sp. SST3]  clstr ali  21  1...MKPFLRLFFFCIILMHLGSASTMAHDGTVYIVGTVKSKTCIISPDSENLIVRMSDVATGQFTNQKNNTPWEHFAINLENCGAGL-NNISTHFEGTPNQGNADLLSLTGGPGYASGVAIGIYNPDKTLIPLGDESQLFTLSNNQTATLDFYARYLADGCAVSPGTANAAATFILTY. 175
94 6.000e-41gi|268591887|ref|ZP_06126108.1| fimbrial protein [Providencia rettgeri DSM 1131]  clstr ali  25  1.MKKIIATAIFAALCVG-----QVANAKDGTVKFVGDIVTAPCEVAQNSWDQTVQMAQVKTATFADAGAKSADKKFQISLLTCDVTQFKNVSVSFAGQTNGDDATLLALDGGQGAAENVGIAIYDSKGKKLALGTATAD-TALQVGSNTLYFSAAYVSTKKDVKAGSANATADFNLTY. 171
95 8.000e-41gi|170767819|ref|ZP_02902272.1| type-1 fimbrial protein, A chain [Escherichia albertii TW07627]  clstr ali  22  1..MKSVFISSIIAVTLFATANTYAATTNGGVIHFEGELVNAACAVNTESADQVVSLGQYRTDLFNAVGATSASIPFTIELNDCDVSIAATAAVAFSGQADGNNDDLLAIVSGTNTATGVGIEILDNTSKTLKPGSVFSEAQSLITGTNVLHFSARYMGTGLSATAGQANADATFIMQY. 179
96 9.000e-41gi|421142985|ref|ZP_15602950.1| type 1 fimbriae major subunit FimA [Pseudomonas fluorescens BBc6R8]  clstr ali  28  8.KINLINSVIAVSLLAVGVAHADDVTVNGGTIHFQGEVVNAACAVDTGSADQTVQLGQVRTAALSAAGQTSSAVGFNIQLNDCDTKVSTQASVAFTGVTDPTNTEALALSSAAGAATNVGVQVLDRVGTPLTFGATFSEPLTLNDGTNTLPFQARYIATG................... 168
97 9.000e-41gi|283832637|ref|ZP_06352378.1| type I pilus biogensis protein FimA [Citrobacter youngae ATCC 29220]  clstr ali  25  1..MEKRILAVATAAVLFSALSCGIANAADGQIKFTGSLTADACKVDTTSADQTVSMGKVAISAFTGQGTKASPTKFSLKLTDCPDTVTSAV-VKFDGNADASNTDLLALDSDSDAA-GVGIEIADNTGAAIPIHQASTAY-PLAVGDNTLEFVARYVSDTATVTAGAANATSDFTINY. 174
98 9.000e-41gi|365848429|ref|ZP_09388905.1| type-1 fimbrial protein, A chain [Yokenella regensburgei ATCC 43003]  clstr ali  29  15MKLKTIASLVATLGLVATAANADAVSVNGGTVHFKGELVNAACAVSTASSNQTVELGQYRTATFTKTGDTSAKIPFSIVLNDCDPTVAATAAVAFTGQIDAQDKTLLAIASGDNTAGGVGIEILDASGTLTPNGSVFSAAQNLIQGTNTLHFSARYKATADTTAPGQANADATFVMKY. 196
99 9.000e-41gi|161503711|ref|YP_001570823.1| hypothetical protein SARI_01795 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980]  clstr ali  27  1MMKGKFAVVAFAALLGVSSTAMADNKDGDGKIEFFGNIIDAGCQIDTGASNLSVKLGDVAKTTFTAAGDTAATTKFVLTLKDCPDTLNSKVTIKYSGTPDTTDNDYLQLTQETGVAKGVAIQLLNSDASPLPLGSASTQTVTVASNKAELDFFARYIATAAAIEAGKANGSVNFTMTY. 181
100 9.000e-41gi|420333681|ref|ZP_14835316.1| type-1 fimbrial protein, A chain [Shigella flexneri K-1770]  clstr ali  26  1MKRNIIGGAFTLASLML----AGHALAEDGVVNFVGEIVDTTCEVTSDTADQIVPLGKVSKNAFSGVGSLASPQKFSIKLENCPATYTQ-AAVRFDGT------------GQAIAATGVGIRIFNSDNSQVKLYNDSDYTAIDAEGKAEMKFIARYVATNATVTAGTANADSQFTVEY. 162
101 1.000e-40gi|206580338|ref|YP_002238467.1| fimbrial protein [Klebsiella pneumoniae 342]  clstr ali  27  1MKKSLILVALTATAALSTS----HAFAAAGTVNFVGNILDTACEVDVASQNQQVNLGNFYKSEFPNSGTKAAAKDFNIVLKNCPTTVTST-KVRFDGTPDLTNPNLLAIDTASSAASGVAINLMTADKVDLPLGENSYNYVLSSTQDNTLKFYAQYISTTASVTPGTANSVANFSIVY. 175
102 1.000e-40gi|296101647|ref|YP_003611793.1| putative fimbrial protein [Enterobacter cloacae subsp. cloacae ATCC 13047]  clstr ali  20  1..MGNWKWPFAALALTMCQANAWSATAGEINIQMYGNIVDFTCVAEGSDSDKTVTLGTWPTKQLSTTGSRTQPMPFTLKLTGCPPG---SASITFSGKTDGSDSGLLALNDAS-TANNVAVEIRDADKTRLALQQASQPVAVDAQGNAVLSFYANYIATADNPRPGRADADATFMINY. 173
103 1.000e-40gi|422014791|ref|ZP_16361400.1| minor F1C fimbrial subunit [Providencia burhodogranariea DSM 19968]  clstr ali  36  1.MYKLISLIVVLCSASVLAGDKHHVIIDGGMVHLRGGLVEAGCSVSTEDEQNIINMGKLRTNQFKGAGSYTEPVTFKIKLTDCSTAISEKVSISVFGSINDRDPQIFKLEQSDAAAKGVGIALFDTNGEIILPNMLPTKWISFHEGESILSFNARYRATDMQVIGGKANASLWFNLIY. 179
104 1.000e-40gi|16759018|ref|NP_454635.1| fimbrial subunit [Salmonella enterica subsp. enterica serovar Typhi str. CT18]  clstr ali  23  1..MNRSHCALFVMGLILCPQINASADDLAYNLEFTGTIVAQTCDIDISSLSQSIDLGQFAVGDFPSTGTTTKFKPFNINLKNCSRGITG-AKIWFTGEPDPDNPALLAITDTGMGASGVGVEILNDDQDTISINNADSVVYPLKAGRNTLSFYIRYKSTRPTVTSGNATAVMYFDMQY. 180
105 1.000e-40gi|365848434|ref|ZP_09388910.1| fimbrial protein [Yokenella regensburgei ATCC 43003]  clstr ali  20  1.MTNRFAWFAGCWLLSAGVVQAE-TPLGEINIELRGNVVDFTCVAEAGDSDKTVPLGTWATKQLRPTGSTTSQVPFSLKLTGCPPG---SASITFSGKPDPKDSTLLALNGNSQ-ASNVAVEIRDKDRSRLPLDQASQEVVVDAQGNVTLQFFANYIATAEDPQPGVADADATFMINY. 172
106 1.000e-40gi|354722399|ref|ZP_09036614.1| fimbrial-like adhesin protein SfmF [Enterobacter mori LMG 25706]  clstr ali  20  8........IAAGVLMMLHAGAQAATALGEINIEMSGNIVDFTCVAEGNDSDKVVTLGTWPTKQLRTTGSRTQPMPFTLKLTGCPPGA---ASITFSGKADGSDSGLLALNDGS-TAGQVAVEIRDADKTRLDLQQASQPVTVDAEGNAVLSFYANYIATADNPQPGRADADATFMINY. 173
107 1.000e-40gi|37524427|ref|NP_927771.1| hypothetical protein plu0418 [Photorhabdus luminescens subsp. laumondii TTO1]  clstr ali  26  1MKLNKLVMVLGLGATLAAGSVNAATNQGHGKVTFEGSIIDAPCSIHPGDDDQTVKLGQISNKALAGGGK-STPVPFNIRLLDCDANGKRTVTATFSGTPSAVNKDLLAIV---GSASGAAIGITNDNAKLIKLGQPSSPTIITDDSDSTMRFAAFLQGDGATIVPGDFTAVANFTLTY. 187
108 1.000e-40gi|161524785|ref|YP_001579797.1| fimbrial protein [Burkholderia multivorans ATCC 17616]  clstr ali  26  1..MKKTLLTAAALAVLSTSAFAAGANSGTGTINFTGEIVAGACGIDSGSDNQTVNLGKVPTNVFKQAGDKSTATNFDIKLTDCDTSVAQNAFFTFTGTSSAGQPKLFATI---GSAQNVGIRLQSASGEYLDNGVEQKAPTVLQNGTNIARFAAMYEAVAADVKPGTADGVANFTVRY. 173
109 1.000e-40gi|345298199|ref|YP_004827557.1| fimbrial protein domain-containing protein [Enterobacter asburiae LF7a]  clstr ali  21  1..MRRLSKALLLVALVHANAHATTALGE-INIELYGNIVDFTCVAEGSDSDKIVTLGTWPTKQLSTTGSRTQPVPFTLKLTGCPPGA---ASITFSGKEDGSDSGLLALNDSSQ-ASNVAVEIRDRDKTRLALQQASQTVAVDTQGNAELSFYANYIATADNPQPGRADADATFMINY. 171
110 2.000e-40gi|183597718|ref|ZP_02959211.1| hypothetical protein PROSTU_01016 [Providencia stuartii ATCC 25827]  clstr ali  26  1MKVKSLALVIVALSLSSVAAVAETTTVNGGTVHFKGELVNAACAVDANSVEQTVRLGQFRTAKLAQAGDTSSPVGFNIQLNDCDTTVATSAKVAFRGAANAANPTVLAVSGSAGSATNVGIQILDSKSVPLELGATFSSAITLNDGNNVLPFQARYYALGAT-TAGIANADATFAVQY. 181
111 2.000e-40gi|293394632|ref|ZP_06638924.1| type 1 fimbrial subunit [Serratia odorifera DSM 4582]  clstr ali  29  1MYKNLSRILIGTALLTTGASALAATATTGGNIHFVGRIVNAACAVSADSTDQTVNLGQYRTAKFAAAGDYSGKVPFTIKLEDCDTAVSTKASVAFNGAADKTDNTVLGVSNXXXXXXXXXIEIRDHDNVLIPNGASYSAPFTLADGKNILHFTARYKATAKAVTPGEADADATFTMQY. 184
112 2.000e-40gi|157145473|ref|YP_001452793.1| hypothetical protein CKO_01216 [Citrobacter koseri ATCC BAA-895]  clstr ali  27  2MKKNMIAMALSAAAILSIS----HAIAYDGTVKFVGQVLDTACTVDIGANNMTVDMGSVYKTAFTNAGDEASTTKFTLRLINCPSSVT-SARVKFDGVNHSGNTDLLALSADPGSASGVAIRLMTADRAPLGLNQNGYSYSLLDMVDNQLDFYAAYVATSVPVVPGVVNAVANFTVNY. 176
113 2.000e-40gi|222156240|ref|YP_002556379.1| fimbrial-like protein ydes [Escherichia coli LF82]  clstr ali  23  1MKYNNIIFLGLCLGLTTYS-----ALSADSVIKISGRVLDYGCTVSSDSLNFTVDLQKNSARQFPTTGSTSPVVPFQITLSECSKGTTE-VRVAFNGIEDAENNTLLKLDEGSNMASGLGIEILDGNMRPVKLNDAGMQWIPLPDQNNILPYSARLKSTQKSVNPGLVSASATFTLE.. 174
114 3.000e-40gi|146310653|ref|YP_001175727.1| fimbrial protein [Enterobacter sp. 638]  clstr ali  23  1.MRKTMLIAVMTLLGAPMQGSLAATPLGEINIELYGNIIDFTCVAEGSDSNKSVTLGTWPTKQLSTTGSRTQAMPFTLKLTGCPPGA---ASITFTGKIDTHDPQLLALNDASQ-ASNVAIEIRDQDKMRLPLQQASQEVVVDVQGNAVLAFYANYIATANNPQPGRADADATFMINY. 173
115 3.000e-40gi|377576542|ref|ZP_09805526.1| putative fimbrial-like protein [Escherichia hermannii NBRC 105704]  clstr ali  27  5.........LTLAVVLAAMSMSASVLAADGTVNFTGTITDKACTVDTGSKNQTVDMGTVATTAFGAKGDTAAAKSFTIKLTTCPTDVTTNAAVRFDGMAKDGDPSVLALDAAS-VATDVGIQIKDNANKVVKLFENSSVYT-LVQGDNNLNFTARYISTADTVGAGTANSSAQFTIIY. 172
116 3.000e-40gi|157372957|ref|YP_001480946.1| fimbrial protein [Serratia proteamaculans 568]  clstr ali  26  1MKLNKIMMAAVLAFGATSMMAQAAVNQGSGTVTFKGAIIDAPCSITPETEDQTVSLGQISNVALKDGGQ-STPKNFQIKLENCELSAGNAVSITFSGASSVDDNNLLGI---TGTAKGAGIAITDGSGKLIELGKASSAQT-LQNGNNTLSFAAYLQASGAVVTPGEFQSVADFTLAY. 186
117 3.000e-40gi|395235919|ref|ZP_10414119.1| fimbrial protein FimI [Enterobacter sp. Ag1]  clstr ali  32  1..MIRKILLLAMLAAVNPVQAKRIVVIHGGEVHMQGELVNGACAVAPESQEMTVQMGQYPSNVFKDVGSYAPPIPFTLRLTDCRPEVYDHVGIAFQGSTPAEDPLVFLATSGNDASSGIGLALFDQQQQLIIPNSEPASYSEITTQEMSFHFTARYRAVSKHMSPGNIRSDVWFTLVY. 180
118 3.000e-40gi|429085625|ref|ZP_19148595.1| Type-1 fimbrial protein, A chain precursor [Cronobacter condimenti 1330]  clstr ali  26  1..MKNVLLSTLLTGMACCAGSAFAASTGEGQINFTGEILDSACEVVNSAASLSVTLGKVSKSSFSTVGATSAPTTFDIELKNCPESITST-SITFGGTADANNNDVLALKAETGAATGIGVQLLDASSQPLSLYTASADYTLSSGATNKLTFGARYIATAPTVTAGLANAISTFTVVY. 177
119 3.000e-40gi|402566564|ref|YP_006615909.1| fimbrial protein [Burkholderia cepacia GG4]  clstr ali  28  15....................STSAFAAGTGTINFQGEIVAGACGIDSGSVNQTVQLGKVPTHTFTKAGDKSTPVKFNIVLTDCDTKVAKNAYFTFTGTSNSAQPKLLATI---GSASNVGVRVQSASGEDIDNGVEQAAATQLQNGNNVVTFGARYEATAADVTPGTADAVANFTVRY. 169
120 3.000e-40gi|167588766|ref|ZP_02381154.1| fimbrial protein [Burkholderia ubonensis Bu]  clstr ali  30  1...........MLAALVAAFGSTSALAADGTVNFHGKIVATTCKV--NNANIQVPLGAIGVEQLAEAGRESRRVPFQIELNECNDQLSG-VRAQFEGVSHNDDPTLLAIGSGKDDAKGVGIQLMDEGGAQIGINSETDT-FQLTPGSNVLSFNANYVSTSNDVEAGAANGTASFTLNY. 163
121 3.000e-40gi|261341124|ref|ZP_05968982.1| putative fimbrial protein [Enterobacter cancerogenus ATCC 35316]  clstr ali  21  1.MRSVTRYAAAAALLMFHASAGANTALGEINIQLYGNIVDFTCVAEGSDSDKTVPLGTWPTKQLRTTGSRTQPMPFTLKLTGCPPGA---ASITFSGKADGSDNSLLGLNEASD-ATHVAVEIRDRDKTRLALEQASQPVTVDALGNAELAFYANYIATADNPQPGRADADATFMINY. 173
122 4.000e-40gi|403053230|ref|ZP_10907714.1| type-1 fimbrial protein subunit A [Acinetobacter bereziniae LMG 1003]  clstr ali  25  1MKK-----LGLLAAACVMSSASFAAPVNGGTVHFVGELVNAACAVSTDTADQTVDLGQHRTARLAVAGDKSGPVPFNIQLVDCDASVTNGVSFAFNGQTVSTNNKLLAVNGGGGAATNVGIEITDYASKILAVGSDFSTEKAIIDGTNTFPFTARYVATGAS-TPGKANADATFVVNY. 177
123 4.000e-40gi|402843310|ref|ZP_10891710.1| putative type-1 fimbrial protein, A chain [Klebsiella sp. OBRC7]  clstr ali  23  16MKKAFMVKSVVLAMVMAAATSGSSSTVNGGTVEFKGSVVDAACAVTADTTNQVVNMGQVRLAAFTGKDSVANKTPFTIKLADCDTTIASQASVTFDGNAAAGEAGVLDNTSGAGNAAGVGIQIYDKDGSALDLGTASQAVTLI-DGDNTLNFSADYYQTADTATAGSVDTTATFNVTY. 200
124 4.000e-40Oral.Meta HOMD ehor_c_5_445 Enterobacter hormaechei ATCC 49162 [147414 - 148025] S-fimbrial adhesin protein SfaG  ali  23  33.....MSVTIRFLPLILLMFITVPVRGYDVLVSVTGNVIGNTCIVSEDSKEQNVPLGTLGIKQFSEAGAVSNKTPFTITLEACGPTFAG-VKIRFSGTPDDENPQLLKV--ADGGATGVAVQILDKDSVLIPLDTQTAAYGAAGDESVKMTFYARLAATGAPVTAGDVSAVATWTTEY. 203
125 4.000e-40gi|294635365|ref|ZP_06713859.1| type-1 fimbrial protein subunit [Edwardsiella tarda ATCC 23685]  clstr ali  21  1..MKKILLPVMALSASVMSGQVSAA---NGTVNFTGEIINSTCQVSGDSKNIDVYLGKYPTSAFKAIGDKSASKAFQINLEQCEPGTY---TVRFDGNTVAGHPDLLAVDGSTAAAQGLGIEITDINGKHFAIANKATTVKVVGDKKAVFNLQARYRSYADTVTAGLANATSPFTIEY. 176
126 5.000e-40gi|213027076|ref|ZP_03341523.1| probable fimbrial protein [Salmonella enterica subsp. enterica serovar Typhi str. 404ty]  clstr ali  23  48MRNKIILAMAAAGMMYGASVYATAGPFGSGKITFTGTITNSPCDIAPGDDAITVPFGQISYRKLNTADATTDSKPFTIHLQNCSAGKMSKVTVSFSGGANVAK----KAYTTSGSAQHVGVQLLKSDNTAIEPNTPEDDAQQLQAGNNELNFYARLIALDNGVTPGDFTASVTYTLKYL 240
127 5.000e-40gi|422022561|ref|ZP_16369068.1| frimbrial protein [Providencia sneebia DSM 19967]  clstr ali  25  1..MRTLKKSLIAVEVVLVLTTAPAAFA-SGTIKFTGEITDVACTVDSKSKNLNVELGKVSSKSLAAKGEVAGLKDFTIKLIDCPAT--SKVTVRFGGTRDLIDRDILAINQGTSAATNVGIALFEKDTTPIKLYEDTKE-VEFKGATVDLDYVARYKATG-TATAGPANSSAVYSIQY. 172
128 5.000e-40gi|423111567|ref|ZP_17099261.1| hypothetical protein HMPREF9687_04812 [Klebsiella oxytoca 10-5243]  clstr ali  27  6..........GLFLALLCGSPFCQAGDTGNNLEFTGTIVAQTCDVEISSVSQSIDLGQFSVEDFPATGTTTKFKPFNINLKNCSRGITGT-KIWFTGTADSDDPSLLALTDTGMGASGIGVELLDEDQDDVSMNNSESVVYPLKAGRNTLSFYIRYKSTRPVVTSGNATAVMYFDLQY. 177
129 5.000e-40Oral.Meta HOMD kpne_c_1_12772 Klebsiella pneumoniae NTUH-K2044 [4385119 - 4385745] type 1 fimbrial minor component  ali  25  41............LLGALFTLGAPAAFAADSTITISGYVRDNACAVAGESKDFTVDLQDNAAKQFYAVGATTPPVPFRIVLSPCGTSVT-AVKVGFTGVADSVNTSLLKLDAGTSAAAGMGVEILDQQQSRLPVNAPSSTTTLTPGQTNILNFYARLMATQVPVTAGHVNATATFTLE.. 207
130 6.000e-40gi|375258219|ref|YP_005017389.1| fimbrial protein BcfE [Klebsiella oxytoca KCTC 1686]  clstr ali  26  1MKPATLFFPLLMTFAGVHSASADDIDSGQVELDMTGTIVAESCDIDTASQNQTIHIGDFSAGIFQSVGDTSEWKQFDIKLNNCTSAISQS-TVAFSGTSDGSDPSLLALSDTSGGASGVAIELLDSSMNTIAINSTDNGY-PITQGNNDLTFRLRYKATAVPVTPGNASSVLYFDVSY. 179
131 6.000e-40gi|296103269|ref|YP_003613415.1| hypothetical protein ECL_02930 [Enterobacter cloacae subsp. cloacae ATCC 13047]  clstr ali  22  1..MKKKMIIAGIAAGMACASVSVFASSGEGQINFTGEIIDSACTVVNGSNPLNVSLGKVSKSAFTGSGSTTSTTRFSIQLKDCPETVT-SASVTFGGTPDSNNKDILAVTSGTGSASGVGVQLLDKTENPLSLYTASAAYTLTPTTTNDLQFGARYIQTGGTVSAGLANAASTFTIVY. 177
132 6.000e-40gi|22125488|ref|NP_668911.1| fimbrial A protein precursor [Yersinia pestis KIM10+]  clstr ali  24  1.MSNFKKSVLVAAVLSLSAFAANAADQGKGKVTFTGSIIEAPCSITSEAADQVVELGQISTTSLANMGS-SEPRSFSIGLEKCDVATMKNVSVTFDGTPDGVDAEMLKLI---GLADGAGIVITDEAGATIKRGVAS-VGKTLDQGSNSLKFSAYLKGTSASVVPGEFSSVANFTLAY. 175
133 6.000e-40gi|212711138|ref|ZP_03319266.1| hypothetical protein PROVALCAL_02210 [Providencia alcalifaciens DSM 30120]  clstr ali  25  1MKFNKTFMAIAATTLIGFGANAAPVNHGNGKVTFTGSIITAPCSIDPSSVDQTVDLGQVGDVVLKNGGTSSSPVMFDIKLIDCTLETEETVNITFSGAAATNDPKSL--LAITGTAAGAGIQIVDSNNAPIVLNEQTKSIHKLQGTTNTLQFAAYIKGLGSQIVAGEFQAVTDFVLSY. 187
134 6.000e-40gi|365848430|ref|ZP_09388906.1| fimbrial protein [Yokenella regensburgei ATCC 43003]  clstr ali  28  1..MIRKFCWIGVFCLVAIPASAHRVVVDGGSVHMRGQLVNGACAVSPESENMRIDMGQYRTNSFSGVGNFSTTVPFSIRLVDCHTDVSRLVGVAFQGLTPAEDPQVFVASTRVGGASGLGLGLFDQRQQLIEPNAPPLNYEPINSSEMTLHFSARYRVISLPLIPGNIHSDVWFTLVY. 180
135 7.000e-40gi|261344487|ref|ZP_05972131.1| fimbrial protein [Providencia rustigianii DSM 4541]  clstr ali  22  1MKKYTFTVLIAGITFL----PNSLTFAADGTIEFIGDIIDQACEIKTESKNIQVQLGRIPKANLPNVGSKSIPVKFTITLVNCPVSI-NSATVSFDATSFPGDNSVIALKAIPNAASGVGVQLTDNKSAVITLLTPSNEYPILPTVENSLDFTANYIAKAIPVVAGSANASATFLISY. 173
136 8.000e-40Oral.Meta HOMD ecol_c_1_1136 Escherichia coli BW2952 [465118 - 465825] FimF homolog  ali  23  69.......VLFSCFCGLLWSSSGWAVDLGTININLHGNVVDFSCTVNTADIDKTVDLGRWPTTQLLNAGDTTALVPFSLRLEGCPPG---SVAILFTGTP-ASDTNLLALDDPA-MAQTVAIELRNSDRSRLALGEASPTEEVDANGNVTLNFFANYRALASGVRPGVAKADAIFMINY. 235
137 8.000e-40gi|366159644|ref|ZP_09459506.1| minor component of type 1 fimbriae [Escherichia sp. TW09308]  clstr ali  33  8............LLCAFLWLVVSHALAADSTITIRGYVRDNGCSVAVESTNFTVDLLENAAKQFNNIGATTPVVPFRILLSPCGNAVS-AVKIGFTGVADSHNSNLLALEKTVSAAAGLGIQLLNEQQNQIPLNAPSSAWTTLTPGKNTLNFYARLMATQVPVTAGHINATATFTLEY. 175
138 9.000e-40gi|238796268|ref|ZP_04639778.1| P pilus assembly protein, pilin FimA [Yersinia mollaretii ATCC 43969]  clstr ali  33  1MYKHYILAGVFVVLSLPGAFASGHVTLPGGELNFIGDVIDAACLVDIDSRKQEIRLDQVNNAQFTASGSSVSAAPFSIQLNNCSVTTSQSVGISFIGVADERDPTILATITERNMANGVGIALFDADNNLLPINAPPKDFSLLSRGTNTLHFFAKYRSTLPVVTSGSSNAAANFMVTY. 182
139 9.000e-40gi|197284163|ref|YP_002150035.1| fimbrial protein [Proteus mirabilis HI4320]  clstr ali  25  1MKLKKLHLVLG-LGLSIIAGSALAADQGHGTVEFYGSIIDAPCSIDPDSGAQRIPLGQVSSSALKDGG-RSASKMFKIKLLQCSTETYKTVKTTFTGAEAPDV--LEGALGIEGIAKNAAVVITNAGGEQIKLGQASAAQT-LNDGNNDLNFAAYLQSSSKAAIPGDFTAIATFALSY. 174
140 1.000e-39gi|423139591|ref|ZP_17127229.1| fimbrial protein [Salmonella enterica subsp. houtenae str. ATCC BAA-1581]  clstr ali  24  1MKRKIT---AAIAVFFTTISIASSVFAHDGTVNFTGKIIEAGCKIDGSTTDKDVELGEISRTAFTTSGDTAATTPFSLVLTECPASLGKSVNVKYEGTPDNINNDYLQLTGDSGVAKGVAIELLNADLSSLPLGTESNAGTEDAPAETNLNFFARYVSTEASVTAGTANATVNFTLTY. 183
141 1.000e-39gi|401762615|ref|YP_006577622.1| fimbrial-like adhesin protein SfmF [Enterobacter cloacae subsp. cloacae ENHKU01]  clstr ali  20  1..MRNGIRFITVALFALCTQAQAETALGEINIQLYGNIVDFTCVAEGNDSDKTVTLGTWPTKQLSTTGSRTQPMPFTLKLTGCPPGA---ASITFSGKADGSNNGLLALNDAS-TASRVAVEIRDADKSRLDLQQASQPVTVDAQGNATLSFYANYIATADNPQPGKADADATFMINY. 172
142 1.000e-39gi|365850215|ref|ZP_09390681.1| fimbrial protein [Yokenella regensburgei ATCC 43003]  clstr ali  28  6........MILVALATGAVLTAVNANAADGTVNFTGEIIDQACTVDIGSNNMTVDLGRVARTAFQNTGDESDSTKFTIKLINCPSTVT-SAQVKFDGANDSNNSDLLAITSGSAAAGGVAIKLMTADKSLLGLNQNSYSYPLVTTADNNLDFYAAYKSTAASVSAGTANAVANFTVNY. 176
143 1.000e-39gi|401678672|ref|ZP_10810631.1| P pilus assembly protein, pilin FimA [Enterobacter sp. SST3]  clstr ali  30  1..MRQVTRQSVLFFSVLLCVALPASAIDDGSVHFQGQVVNTGCSVSAESQDQIVRMGQIRNNEFAATGDWAAPTAFQITLEDCDTSVSQRAGVLFSGESDAKDPQIFRAGYGAGAAQGIGVGIFDATGHLLIPDTAPPCYAPLQNGANVLRFMAKYRSTQPHVQAGTADAQVWFNVVY. 176
144 1.000e-39gi|253988206|ref|YP_003039562.1| f15 p-fimbriae major subunit precursor [Photorhabdus asymbiotica]  clstr ali  25  33MKLNKLVMALGLVVLAVGSVNAANPSQGHGTVTFTGSIIDAPCSITPETVDQVVPMGAISNAALKNGG-RSSSRSFKISLENCTTDTISTVTTTFVGAKSNIVGGD-GLLGIEGTAKGAGIAITDAGGNKIKLGTPS-PAVALHDGNNDLNFAAYLQGTPDAVVPGEFTGIANFQLAY. 210
145 1.000e-39gi|410085463|ref|ZP_11282182.1| Fimbrial protein [Morganella morganii SC01]  clstr ali  31  1..MHKLISTVFLLCGISAGAYATHTIIDGGMVHLRGGLVEAGCTLSTNSENDVIDMGEFRTNQFKGTGSYSGNIPFKLVITNCSTAVSSKVGLSVFGYINEKDPQIIKLEDSDEAAKGVGIAILDSDGDIIIPDNIPSKWINFHEGENVLHFNARYRATDMQVTGGKANASVWFHLTY. 179
146 1.000e-39gi|386743975|ref|YP_006217154.1| fimbrial protein [Providencia stuartii MRSN 2154]  clstr ali  22  1MKK----LFLLALVSSAMSTSVLAADMGHGKVNFKGSIIDAPCSISPDSIDQTVELGQISNVALVGGGKSSPRT-FDIALENCDTGFDKGVQLTFSGAAASFDNTN-KTLGIVGTGAGAGVQITNGSGNIITLGEP-TPFQNIQDGNNTLRFSAYLVGNGDTITPGEFSSVADFTLSY. 175
147 1.000e-39gi|423124627|ref|ZP_17112306.1| fimbrial subunit type 1 [Klebsiella oxytoca 10-5250]  clstr ali  28  1MNKLAVIVFXXXXXXXXXXXXXDPVTVNGGTVHFKGEVVNAACAVDAGSLDQTVQLGQVRSAKLAAAGNTSAPVGFNIQLNDCDITVSEKAAIAFAGTANSTNPTVLALQGSAGGATNVGVQILDRTGTPLALGATFGAQTTLSNGTNVIPFQARYFATG-VATAGTANADATFKVQY. 180
148 1.000e-39gi|365849836|ref|ZP_09390304.1| putative PRS fimbrial major pilin protein [Yokenella regensburgei ATCC 43003]  clstr ali  26  1MQLTKLVWVFGM-GAAVLAGQAQASDQGHGTVKFTGSIIDAPCSITPETIEQTVDLGEISNKSLLNGGK-SNPRPFDIKLESCDLSTDKTVTITFTGPESSAQPGYLAIVGSS--ASGAAIGITNDEGTNIPLGTASS-ATKTQQGDNTLTYSAYLKGNGGTVVPGSFTSVANFTLAY. 177
149 1.000e-39gi|423123351|ref|ZP_17111030.1| hypothetical protein HMPREF9694_00042 [Klebsiella oxytoca 10-5250]  clstr ali  25  1MKKTIVIAMLAA----GSALSMTQAFAAAGVINFTGKILDKACDVDVASQNQTIDLGSYNKSEFPTSGTRTAAKEVKIVLKNCPDTV-NGAQVRFDGTPDLTNSSLLAIDSSTGAASGVAINLMTADKADLPLGSNSYNYPLSSTADNTLMFYAQYISTAANVVPGQANSVTNFSVIY. 175
150 2.000e-39gi|212711622|ref|ZP_03319750.1| hypothetical protein PROVALCAL_02697 [Providencia alcalifaciens DSM 30120]  clstr ali  24  1MKKHVIASLIATSTLLI----SANGFAKDGDINFTGEIIDNACQLATGSDAIQVNLGKVSKTALPSTGSTAAATKFTIQLEKCPAAVT-SATVKFDGVAYDGNNNVLQVTNTSGVATGVGIQIQDVKGVTVPLYSISNPYTLQETVVNNLDFTARYIAMSDTVTAGQANSTATFTINY. 175
151 2.000e-39gi|375261250|ref|YP_005020420.1| fimbrial protein [Klebsiella oxytoca KCTC 1686]  clstr ali  28  1..MNKSLIAVGLLAGVMSAS----AFADDGRIEFYGSITDSACTVINHMTNLTVMMGNVSSKAFNGAGSTASATKFIIELKDCPKSA-KSATVKFDGTADSSVGTILALTQQPGVAKGVGIQLMDNKNVVVPLYTASSAY-PLQPGGNSLAFVARYYATSNTVNAGFANSTSTFTLNY. 171
152 2.000e-39gi|423211130|ref|ZP_17197683.1| hypothetical protein HMPREF1169_03201 [Aeromonas veronii AER397]  clstr ali  19  1.MLRTLWIGLVLYPLLGVTAAPRASNDLGNTVHLHGRIIDQPCVVSPESLDQEVEMGVVDVKELYANG-VAELVPFSIRLTNCKPGIFRMAKVTFTGSQDTELSGGLAFT--AGIAKGAGIRLYDVAQSPLNLGSASRGYLLGGAADNELQFFARVEGTAKNIQPGDYSAVANFIVAY. 182
153 3.000e-39gi|38201758|ref|NP_938125.1| SefA [Serratia entomophila]  clstr ali  25  1MKINKIASVLLLASGLT-AFGANAADQGSGRVTFTGSIIEAACSVNPESSDQEVDLGQIAASQLADGGS-STPRNFEILLENCDADKANTVTVTFGGSAADSSNQLLGI---TGTASGAGVAVTDGSGNLITLGQATGARELI-EGSNTLNFSAYLQGISTEISTGEFQSVADFTLAY. 174
154 3.000e-39gi|415839421|ref|ZP_11521163.1| hypothetical protein ECRN5871_2934 [Escherichia coli RN587/1]  clstr ali  23  28..KKTLLSMFATALLSGVAFNALADDQGSGKITFKGEVIDAPCSIAPGDEDQTINLGEVADTVLKS-GQKSLPVDVTIHLQDCGTNTVDKVKITFSSASDATDSNLLKNTGNIGGATDVGVRLVKSDNTNVTLGTPITINFPTTNSYQELNFKARMESLGRTATPGNVQAQANYVLDY. 211
155 4.000e-39gi|311280577|ref|YP_003942808.1| fimbrial protein domain-containing protein [Enterobacter cloacae SCF1]  clstr ali  22  6.........IALLMGIAIALPALATPLGQVNIELTGNVVDFTCVAEGSDSDKSVSLGRWPAKQLRQAGSTTTAVPFTLRLTGCPPGA---ASITFAGKADGADPSLLALNASS-SASRVAVEIRDNDRRRLPLQQASRDVAVDAQGNVMLQFYANYIATADDPQAGSADADATFMINY. 171
156 4.000e-39gi|377577350|ref|ZP_09806332.1| putative fimbrial-like protein [Escherichia hermannii NBRC 105704]  clstr ali  23  4.........VVALFISLTSLFIMPCFASDGVINFSGKITDQSCEIDTQASTLNVNLGSYSISQFGGVGVTSLPIPFTIKLKNCPNTEEIRFNVALSGVSEPTNPDYLKI--NDGGAQGVAIVIKDKDGAVVPINKTSPTVYDIPDVEMELKFTAYYISTSSLVKPGDANSTTDITLVY. 172
157 4.000e-39gi|291085737|ref|ZP_06353903.2| fimbrial protein internal segment [Citrobacter youngae ATCC 29220]  clstr ali  28  1MRQMIGKGVALAGMLCVMPALANTVILESGRLHLRGQLVNGACTVATDSQNLRVQMGQYRSNAFSGTGSATTSVPFSLRLTSCSSDVYDHVGIAFAGVTPAEDPQVFLASGDASAASGIGLALFDERQRQIIPNALPLHYAPIITQEMTFHFTARYRAVSENITPGILRSDVWFTLVY. 179
158 4.000e-39gi|212709331|ref|ZP_03317459.1| hypothetical protein PROVALCAL_00366 [Providencia alcalifaciens DSM 30120]  clstr ali  27  6MKLKLIAIALPISLALSHTAFATPVTVGGGIVNFAGAIVNTPCVIDNDDASQTVNLGQYRQDAFTGKSSVSSPVGFDIKLTGCATETFKNASLTFAGITVPDEEKILAPVASQGTATGVGIQILQNSKLVNVDGLKATDVVKLNEGDSTLRFQAQYIALADEVTAGSANASADFTITY. 197
159 5.000e-39gi|197287247|ref|YP_002153119.1| fimbrial subunit [Proteus mirabilis HI4320]  clstr ali  23  1MKLNYLKLFVISALSVGSVFAVSAVTVNGGEIFFKGELVNAACAVDSSSDGQIVKLGQVRTAKLAKAGDFSENTNFTIQLNDCDSKVASTAKVAFTGVSAAGQDDVLAVSSSSGGAKNVGIQILDSKSAPMSFGAGFGNATKLHDGKNIIPFQARYYALGAT-EPGIANANATFAVQY. 187
160 5.000e-39gi|157147905|ref|YP_001455224.1| hypothetical protein CKO_03712 [Citrobacter koseri ATCC BAA-895]  clstr ali  24  1MMMKKPLYFLGAVLTLACV----NVFAADSTITISGYVRDNACAVAGESKDFTVDLMNNAAKQFNAVGATTPLVPFRIVLSPCGNSVT-AVKVGFTGTEDSSNTCLLKIDSGASAAAGMGVQILNNQQTMLPLNAASSSTTLTPGQTNILNFYARLMATQIPVTAGHVNATATFTLE.. 175
161 6.000e-39Oral.Meta HOMD NCBIABWM_c_9_1065 Enterobacter cancerogenus ATCC 35316 [135003 - 134392] S-fimbrial adhesin protein SfaG  ali  22  33.....MPVAFRLASIALLMAFTVPVRGYDVLVSVTGNLIGNTCVVAADSLEKNVPLGTIGIKQFSKAGAVSNIKPFTLTLEECGPTFAG-VKIRFSGTPDDDDPQLIKI--AQGGATGVAVQILDNESALIPLNTQTTAYGAAGDDSVNMTFYARLAATGAPVSAGEVSAVATWTTEY. 203
162 6.000e-39gi|386015008|ref|YP_005933285.1| fimbrial protein [Pantoea ananatis AJ13355]  clstr ali  24  1MKLNK-AVKSFGLCAMMVAFGATAADQGHGEINFKGSIVDAPCSITAESANQTVDLGEVTNAALKNGGK-STPKAFTVKLEQCDTATSESVTATFTGAASAGNKDLLGI---TGTASGASIAITNGAGQIIKLGEES-PAQSIQDGTNSLAFSAYLQGDVATIVPGDFTSVANFTLAY. 179
163 6.000e-39gi|238754307|ref|ZP_04615664.1| hypothetical protein yruck0001_22560 [Yersinia ruckeri ATCC 29473]  clstr ali  27  3MKLNKLKMVLGMIVVMAAAANAAPKDQGHGTVTFNGSIIDSPCSITPDTIDQTVNLGQVSNVALKDGGK-SKPKNFQIKLENCDXXXXXXXXXXXXGATSTGNPDLLGI---TGTARGASIAITNGSGDVLKLGESGKPQT-IQDGNNSLAFSAYLQGDGASATPGEFQSIANFSLAY. 178
164 6.000e-39gi|15830281|ref|NP_309054.1| fimbrial-like protein [Escherichia coli O157:H7 str. Sakai]  clstr ali  32  17.MLKRIIWILFLLGLTGGCEL----FAHDGTVNISGSFRRNTCVLAQDSKQINVQLGDVSLTRFSH-GNYGPEKSFIINLQDCGTDVS-TVDVTFSGTPDGVQSEMLSIESGTDAASGLAIAILDDAKILIPLNQASKDY-SLHSGKVPLTFYAQLRPVNSDVQSGKVNASATFVLHY. 186
165 6.000e-39gi|383191585|ref|YP_005201713.1| P pilus assembly protein, pilin FimA [Rahnella aquatilis CIP 78.65 = ATCC 33071]  clstr ali  25  6........SFILLLGTMLCFSHSVAHAADGTINFTGQIVATTCDVNGGTTDINVDLGTVAATSFTAAGATSSPTAFTISLTNCP-TTFTAAAVKFDGTADAVDNQLLEV---TGGATGVGIEIADNQGTPIPLYTASRFYPIDATAEVDMNFIARYKSTAATVGEGAANATSQFTINY. 173
166 9.000e-39gi|261342534|ref|ZP_05970392.1| Sfm fimbrial protein, A chain [Enterobacter cancerogenus ATCC 35316]  clstr ali  25  1..MKTVLLKALTLFALIHSLAVYADDGAVYNLRVTGTIISESCEVDTSSQEQSVSLGEFDSSDFPSVGATSAWVPVNITLKNCSKAINGT-KIWFSGLADTDNPNLLALSTESTLAAGLGVEIMDASQVIVPINNSESSTYPLQTGNNELTFNLRYKSTRQDVTPGDATAVMYFDLLY. 180
167 9.000e-39gi|290475372|ref|YP_003468260.1| fimbrial-like adhesin protein [Xenorhabdus bovienii SS-2004]  clstr ali  26  1MKTNLIISSLFLSSALV-----SAAYAADGQIKFTGDITATACKIDPSSANQTVNMGTISSSSFNGVNSTSAATRFSIILTDCP-TEANYAQVKFDGNPDSRNNNLLALSNDNSAAGGVALGLYEADSTLISLAQSSITQKLTNKSKQELNFIAKYIATNSTVNPGSGDAVANFTIVY. 176
168 9.000e-39gi|423116111|ref|ZP_17103802.1| hypothetical protein HMPREF9689_03859 [Klebsiella oxytoca 10-5245]  clstr ali  23  1MMRKNLYLLGAILSLVSFS-----TPAADSTITISGYVRDNTCAVAGESKDFTVDLMNNAAKQFNAVGTTTPLVPFRIVLSPCGGSVT-AVKVGFTGIADSDNTSLLKLDSGVSAASGIGVQILNGSRAPLVLNAPSSNTTLKPGQTNTLNFYARLMAARVPITAGHVNATATFTLE.. 174
169 1.000e-38gi|336247055|ref|YP_004590765.1| fimbrial subunit [Enterobacter aerogenes KCTC 2190]  clstr ali  27  7...........TMIICFLCFQALLGHAADTRIYVNGNLIGNTCTVSSQSKNMTIKMGNIGSKDFSSDGLWAAELPFSIDLTDCQ-TESIGVKVHFLGTPDTNNKELLRTLDN--GAKGLAIRLMDENKNPIAINQSSKVYVINPELDNKLNFYARYVLTQDNLTPGPANAVSTFMLEYL 175
170 1.000e-38gi|157146848|ref|YP_001454167.1| putative fimbrial protein [Citrobacter koseri ATCC BAA-895]  clstr ali  20  3........LLLAIFCSVLLSPLCRADTALGEINIRGNVVDFTCTAVTGDSNKTVELGTWPTKQLKTSGDTTQPVPFSIKLEGCPPGA---ASMTFSGTPAAG-TSLLALDDAV-MAQKVAIEIRDSDRSRLPLEQASQSVSVDENGNATLTFYANYIALADGVQPGVAKADATFMINY. 169
171 1.000e-38gi|329297469|ref|ZP_08254805.1| major mannose-resistant fimbrial protein [Plautia stali symbiont]  clstr ali  25  1MNMNKIVVALGL-SMSLVAGSAMAAGEGNGTVTFKGAIVDAPCSIELGSVDQTVELGQISNLALK-DGDRSTPRPFQIKLENCDTATKKEVTVTFGGTGSQVIPGKLAI---TGTASGAAIGI-NFGDTEIELGTA-TPAQKLMDGNNQLSFAAFLQGGGATIVPGEFQSVADFALNY. 173
172 1.000e-38gi|169796199|ref|YP_001713992.1| fimbrial protein (pilin) [Acinetobacter baumannii AYE]  clstr ali  19  32MKKFIFIVASSLF-------NIAAAQAADGTITINGLVTDNTCTIDTGDKNLTVNLPTVSSQSLKNAGDVAGRTPFQINLTNC-ASVGKVATYFEPGATVDFNTGRLLNQATSGAAANVNIQLLGSNNAVIPVQDNSQWVNVSAGGNADLNYYAEYYATGAS-TAGTVTSQVKYTIIY. 208
173 1.000e-38gi|415815564|ref|ZP_11506995.1| type-1 fimbrial protein, A chain [Escherichia coli LT-68]  clstr ali  29  54..................................KGEVVNAACAIDSESMNQTVELGQVRSSRLAKAGDLSSAVGFNIKLNDCDTNVSSNAAVAFLGTTVTSNDDTLALQSSAGSAQNVGIQILDRTGEVLILGATFSAKTDLIDGTNILPFQARYIALGQSV-AGTANADATFKVQYL 199
174 1.000e-38gi|423108078|ref|ZP_17095773.1| hypothetical protein HMPREF9687_01324 [Klebsiella oxytoca 10-5243]  clstr ali  28  5........IIMATFAISXXXXXXXXXXXDGTINFTGEILDQACTVDIGSNNMTVDLGRVARTSFQSTGDESDATKFTIKLINCPASV-NSAKVKFDGANDLNNSDLLAITQGPAAASGVAIKLMTADKSLQGLNQNSYSYPLVTTADNNLDFYASYQATQAVVTAGPANAVANFTVNY. 175
175 1.000e-38gi|290474962|ref|YP_003467846.1| fimbrial-like adhesin protein [Xenorhabdus bovienii SS-2004]  clstr ali  20  1.....MKLLKLFIAAVISGSMAAPAFAADGTINFNGRITKATCTVSALTDN-SVNLPEVGATALAGKGTTGGETLFRIGLENCGVGGSANVQVKFGGVKDSIDGNLLRINSESGGAKGVGIGIYEKDGTPINMGALSKGIPVVSPAT-TLEFKAKYVATEATVTPGTVKASTDFTLDY. 173
176 1.000e-38gi|300820224|ref|ZP_07100376.1| fimbrial protein [Escherichia coli MS 119-7]  clstr ali  25  12..MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNTDSADQVVTLGQYRIDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNLLAISTNTTTATGVGIEILDNTSAILKPGNSFSTNQNLIPGTNVLHFSARYKGTGTSASAGQANADATFIMRY. 190
177 1.000e-38gi|386743880|ref|YP_006217059.1| fimbrial subunit [Providencia stuartii MRSN 2154]  clstr ali  20  4......KLKIFSATLLTSVMFSASAYAADSTITIKGNVKDNTCAVAPGSQNQVVDLLNNAVRQLYAIGEVTPLVPFQIELTPCGASVL-AVKVGFVGIADANNTSLLALEPGTSNASGAGIQILDGSRTPLVLNANSNQTPLVAGRSNTLQFYARLMASNLPIVAGHVRATATFTLE.. 176
178 1.000e-38gi|117617720|ref|YP_855057.1| fimbrial protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966]  clstr ali  20  2.....LRTLLISLMLSPLIAVAAIPRAGDGKLNLHGRIIDQPCVVAPESLEQEVEMGVVDVKQLYANGA-GEQVPFSIRLTNCKPGIFRMAKVTFTGSKDAQLSGGLAFT--AGIAKGAGIRLYDVTQTPLDLGTPSRGYLLGGSADNELQFFARVEGAAKNIQPGDYSAVANFIVAY. 182
179 2.000e-38gi|48256973|gb|AAT41671.1| putative major fimbrial subunit protein [Edwardsiella ictaluri]  clstr ali  21  1MIMKKFLLPV---MVLXXXXXXXXXXXXNGKVEFTGEIVNSTCQVSSDSQNINVYLGKYPTSAFKTVGDKSASKAFQINLEQCEPGTY---TVRFDGNTVAGHPDLLAVSGATAAAKGVGIEITDVNGKAFPIADQSQTVTVVSDKKAIFNLQARYRSYVNTVTAGLANATSPFTIEY. 178
180 2.000e-38gi|333929642|ref|YP_004503221.1| fimbrial protein domain-containing protein [Serratia sp. AS12]  clstr ali  25  1MKLNKIMMAAVLAFGATSMMANAAVDQGHGTVTFTGSIIDAPCSITPETVDQTVDLGQVSNVVLKDGGK-STPRNFQIDLENCELTKTNMVSLTFTGMESSAKNGRLGI---TGTAQGASIAITDGAGSVIKLGTPTQTQT-LQNGNNTLSFAAYLQGDNASVVPGDFQSIADFTLAY. 181
181 2.000e-38gi|311277964|ref|YP_003940195.1| fimbrial protein domain-containing protein [Enterobacter cloacae SCF1]  clstr ali  28  4..........FALAACVSLAMMAQPQAHQGTVYVTGTITDNTCAVSPDSKNLTVPMGDVSSKQFSRAGDGSRYEPFVINLEKCG-GAASGVTVHFAGTSDSRNPALLALTXXXXXXXXXXXXIYNPDKSLIPLGAESNTPISPNQATVALHFYARYIADGDSVAAGTANASATFVLTY. 171
182 2.000e-38gi|336247052|ref|YP_004590762.1| major subunit of type 1 fimbria [Enterobacter aerogenes KCTC 2190]  clstr ali  23  1.MKKLIISALVAASFAAVSTPTFAVTVNGGTIHFEASVVNAACAVDANSINQTVQLGQFKLSDFSKKGDETSRIPFSIKLNSCDPAVASTAAITFVGTPSESEQDVFAL-QGAGAAKNIALKLVDSQNKQIAPGQVST-GVKLIDGSNELNYSASLISTSDEVSAGNANAVTNFMVTY. 192
183 2.000e-38gi|253988213|ref|YP_003039569.1| putative minor fimbrial subunit [Photorhabdus asymbiotica]  clstr ali  21  1MKYFKLFVLRIGFMVIATTAYCNQAVQAADNMRFYGALVEEPCTIQPGDEDIKLDFGTIGEKYLYQHG-RTNSEPFQLRLSGCDISVGKSIKLTFSGIENTQLPGLLALGAGS-LASGVAIGMETAEGKRLPLNKEGDTY-PLKEGETLIELKAYVQAEPATIKRGTFHAVATFNLNY. 180
184 2.000e-38gi|395235923|ref|ZP_10414123.1| fimbrial-like adhesin protein SfmF [Enterobacter sp. Ag1]  clstr ali  23  1.MNKFILSALALVPILCVPSVKAASPLGEINVELHGTIVDYTCVVETGGDNKTVKLGSWPTKQLRTAGSTTQAMPFNLKLTGCPPS--GTASITFNGK--STGTGLLALNAAS-TAKNVAIELLNEDKSRLLLNDASKTMPVDANGDVTLKFWANYIATADNADAGLANADATFLINY. 172
185 2.000e-38gi|422023411|ref|ZP_16369916.1| fimbrial subunit [Providencia sneebia DSM 19967]  clstr ali  23  7.........IFSATLLMSMLFSSTAFAADSTITIKGNVKDNTCAVAPGSQSQVVDLLNNPVKQLYAVGEVTAVVPFQIDLTPCGESV-IAVKVGFVGIADVNNNALLALESGNSNASGVGIQILDGSRTPLELNANSSSIVLVAGRGNTLHFYARLMASKLPVVAGHVRATATFTLE.. 176
186 2.000e-38gi|319796192|ref|YP_004157832.1| fimbrial protein domain-containing protein [Variovorax paradoxus EPS]  clstr ali  26  3.....KSVLVKFASLAVAGVLSQGAFAADGTINFTGEIVDAPCSISPNSQNMTVPLGKVSRTAFDGVGKKATPAKFKIDLLGCGATA-KGATVTFSGTADLDDATNLRLANGVGAASGVAIELGDSAATKIPLGSPSGVYT-LGLGDNSLNFQAAYVATKTAVTVGPANSVAQFTVAY. 184
187 2.000e-38Oral.Meta HOMD ehor_c_24_295 Enterobacter hormaechei ATCC 49162 [30195 - 29590] fimbrial protein internal segment  ali  30  22.RMTRTGILLCALA-IAPAVNAHTVVIDGGKVHLRGELVNGGCAVAPDSQNMRVDMGQYRTNAFSGVGSFSTNVPFTVRLLDCSVDVSRTVGIQFQGVTPAEDPQVFLATSRPGESSGVGLALFDEQQRQIIPNATAVSWLPINTRELAFHFSARYRAISEHLVPGTIQSNVWFTLIY. 201
188 2.000e-38gi|268591082|ref|ZP_06125303.1| fimbrial protein [Providencia rettgeri DSM 1131]  clstr ali  23  1MKMKSIAMATFMALGL--ASAANAADQGHGKVTFKGAIIDAPCSISPSSIDQTVELGQISNMALVDGGK-STPRPFEITLENCDITLTKGVQLTFSGAAASFDNTN-KTLGIVGTGAGAGVQITNGSGNVVTLGTA-APFQQIQNGNNTLNFAAYLKGNGDTITAGDFSSVADFTLSY. 177
189 3.000e-38gi|417225632|ref|ZP_12028801.1| type-1 fimbrial protein, A chain [Escherichia coli 96.154]  clstr ali  28  4..KQHVTKSILGLALLSAVPVASAAVVTGGTVHFTGQIVNAACAVSAESVDQIVKMGQFRTANFTSVGMRSHAVPFTIKLEDCDTNISTTAAVSFYGNLDANDPTVLAVSNXXXXXXXVGIEISDYTGKLVKPGSVFSTAQNLVDGANVLSFTARYKSTLASVTPGQADADALFKMQY. 184
190 3.000e-38gi|15042714|gb|AAK82430.1|AF396083_9 MrfH [Photorhabdus luminescens]  clstr ali  24  1MNYFKLFVLRVGLMIVATAVYCNQVVQAADNMRFYGALVEEPCTIKPGDEDIRLDLGTIAEKYLYLHG-RTNSEPFQLRLSGCDMSVGKSIKLTFSGVENRQLPGLLALSAGSQ-ASGIAIGIETAEGKRLPLNKDGDAY-PLKKGENVIILKAYVQAENQTIKRGAFHAIATFNLNY. 180
191 3.000e-38gi|311279462|ref|YP_003941693.1| fimbrial protein domain-containing protein [Enterobacter cloacae SCF1]  clstr ali  28  6........MITATIVASAVLCLTTANAADGTINFTGEIIDQACAVDIGSNNMSVDMGRIARTSFQSAGDESDSTKFTIKLINCPATVT-SAKVKFDGANDQNNSDLLAITQGASSADGVAIKLMTADKTLLGLNQNSYSYPLVSAADNNLDFYAAYKSTQTAVTAGLANSVASFTVNY. 176
192 3.000e-38gi|401763356|ref|YP_006578363.1| major type 1 subunit fimbrin [Enterobacter cloacae subsp. cloacae ENHKU01]  clstr ali  25  4MKKNIILAMIATGSALMMG----NAFAAAGTVNFNGNILDSACDVAVASQNQVVVLGDYYKTEFPTTGSRTAATKFNIILKNCPVTVT-SAKVRFDGTPDMTNTDLLAIDTSAGAATGVAINLMTADKADLPLXXXXXXXXXXXXADNTLDFYAQYISTAAAVTSGPANSVANFSVVY. 178
193 3.000e-38gi|418763389|ref|ZP_13319512.1| fimbrial protein [Salmonella enterica subsp. enterica serovar Newport str. CVM 35185]  clstr ali  22  1.MTLNKLIATTIALGFICTANAAPLDSGHGTVKFKGSIIEAPCSITPDTVDQTVDLGQISNVVLKDGGK-SSPKNFYIKLENCDVSTVKTVSTTFTGAPSAGNPDLLGI---TGTARGASIAITDGAGSTIKLGDATKPQG-IQNINNTLAFSAYLQKTGADIVPGEFSSIANFTLAY. 179
194 3.000e-38gi|410085462|ref|ZP_11282181.1| Fimbriae-like adhesin SfmA [Morganella morganii SC01]  clstr ali  28  4.KQRLVMSVVALAVLSASQLSMAATTVTGGTVHFTGRIVNAACAVSADSTDQTVNMGQYRTAFFNAKGKKSGDVPFSIKLEDCDTSVSTKASVSFSGLSSADDPTALQTSNSAGAAKGVGIQIADHLGKVVKPGSVFSTAQNLVDGVNVLNFSANYISTQATVTPGGADADATFTMQY. 185
195 4.000e-38Oral.Meta HOMD axyl_c_1_21566 Achromobacter xylosoxidans A8 [6488685 - 6489314] major MR/P fimbria protein  ali  24  35MNKNTIAK---FALLATAAAVSQAALAADGTVNFVGEIVDAPCDVSPQATNLVVPLGKVSRTTLDGAGKYSTPAQFELQLANCSATA-KGASVTFTGTADTINTDTLAIIGELGYATGVAVELRDAAQKKIKLGAESPDYT-LRAGTNNLKFGAVYVSTANTVTVGPANATAQFTVNY. 209
196 4.000e-38gi|197287250|ref|YP_002153122.1| fimbrial subunit [Proteus mirabilis HI4320]  clstr ali  22  1.MTNNIKGILTTLWLFFLSLSPNVAYSADSIIQITGYMRDNTCAVAPESQYQTIDLLNNEVKRLYKVGETTPFIPFHIILEPCGESV-IAVKFYFNGISDRNNPSLLALDPIATSASGVGIQILDSERSPIPINPSSDQWIPLVAGSNTVFFYSRLMASDMPVLAGKIKASATFTLEY. 179
197 4.000e-38gi|311281707|ref|YP_003943938.1| fimbrial protein domain-containing protein [Enterobacter cloacae SCF1]  clstr ali  25  1MKRNLITGALALSSLLTVG----QVLAADGTVHFRGEIIDSTCEVTPATQEQNVDLGKVNKTAFTGVTSEASSKDFTISLQNCP-DTYTKAAIRFDGTEDNNSAGDLAIQPSAIAASGVAIRIHNSDNSIVKLNDSAWTDIDPTSHGADLKFIARYIQTTAQVTAGTGNADSQFTVEY. 190
198 4.000e-38gi|421786104|ref|ZP_16222521.1| fimbria A protein [Serratia plymuthica A30]  clstr ali  26  1MKLNKIMLAAVLALGATSMMAQADINQGRGTVTFKGAIIDAPCSITPETVDQTVNLGQVSNVALKDGGK-STPKNFQIKLENCDPGKNNAVSITFSGAASSSDSDLLGI---TGVAKGASIAITDGSGEVIKLGQATKAQT-LQNGNNTLSFAAYLQASGAVVTPGEFQSVADFTLAY. 184
199 5.000e-38gi|238755337|ref|ZP_04616680.1| hypothetical protein yruck0001_10970 [Yersinia ruckeri ATCC 29473]  clstr ali  23  1MKLNKIVLGITLVFGIAAFSQAATADLGHGTVTFTGSIIDAPCSIDSGTIDQTVDLGPVSKVALDNKG-TSTPKDFKIKLEKCNIGDGKSVTAKFTGAEGNTTG----LLGITGTAAGASVVMKDGKGELIELGKSSDAQ-KLQNGNNTLLFSAYLQGNGASVVPGDFSSVANFTLDY. 178
200 5.000e-38gi|146310066|ref|YP_001175140.1| fimbrial protein [Enterobacter sp. 638]  clstr ali  23  1.MNFKKAALASVMGMLLVAGAANAKDQGHGKVTFTGSIIDAPCSINPDSIDQTVSLGQVSNVALKAGAGTSVPRNFEIKLEGCDTTTLKSVKTTFTGAEGATDGSL----GITGTAKGASIILTNGDGVQIKMGEASAAR-QLQDGNNTLLFSAYLKGDGASATPGDFTAVADFTLAY. 176
201 6.000e-38gi|422015478|ref|ZP_16362076.1| major mannose-resistant fimbrial protein [Providencia burhodogranariea DSM 19968]  clstr ali  26  1MNLNKIALVLGL-GLSITAGVANAADQGHGTVTFVGSIIDAPCSITPETSDQIVPMGQISTAELKDGG-RSNSRAFKIALENCTTETLKTVQTTFAGAASPITDGSLAIE---GKAQNAAIVITNAGGKQIKLGTPS-DAVTLRDGNNDLNFAAYMLGDTDAATPGEFKAIATFALNY. 173
202 6.000e-38gi|422016194|ref|ZP_16362779.1| fimbrial protein BcfA [Providencia burhodogranariea DSM 19968]  clstr ali  26  1MKINNKLAVLSLVASSIICGSAFAADVNGGKITFNGEVTTGACAVSGADTDKLVTLDTVQTSVFKAADQLANAKPFDISLLNCDTDTRKSVQISFSGQTVEGKPGLLANTAGAGSAGNVALQLFNPDGTELEVGALSSKVNLTT--TTTIPLSVDYKSTATNVTAGKVQSVANFMLTY. 184
203 6.000e-38gi|16763928|ref|NP_459543.1| fimbrial protein [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  clstr ali  21  1..MILRRVFIAIGCVLFSPLSQANSSLGEVNIELRGNVVDFTCAVVAGDSNKSVNLGTWPTKQLHAAGDATQPVAFSLKLEGCPPG---SASITFSGTPAPGTA--LLALADTAMAQKLAIEIRDGDQRRLPLEQASKAVDIDNNGNATLKFYANYIALADGVQPGLANADATFLINY. 171
204 6.000e-38gi|261344842|ref|ZP_05972486.1| fimbrial protein [Providencia rustigianii DSM 4541]  clstr ali  23  1MKFNKTIMAIAATSLISFSAFSAPVNHGNGKVTFTGSIISAPCSIDPASLDQTVDLGQIADVVLKNGETSSSPVMFDIKLIDCTVETGDTVNVTFSGAAAENNGNPL--LAITGTAGGAGIQIVDSNNAPIVLNEKTKSTHKLQGVTNTLQFAAYIKGLGTEIIPGEFQAVTDFILTY. 187
205 6.000e-38gi|421867890|ref|ZP_16299543.1| putative fimbrial protein [Burkholderia cenocepacia H111]  clstr ali  23  1.MKNLKRSAIPFLLVAAGVAFSSAAHASDGTINFNGKVIASTCSVEGGS-DLTVPLPPVSTTALAEVGSVAARSAFSLALKGCTTGDDNPVKVFENGTNVDRSSGRLTIDAGDKAAEGVQINVLDDQQKLVPIGAQTPASTQLADGTAKLDYFAEYYASGA-VKAGDVNSRVEYSLIY. 182
206 6.000e-38gi|295097593|emb|CBK86683.1| P pilus assembly protein, pilin FimA [Enterobacter cloacae subsp. cloacae NCTC 9394]  clstr ali  23  7............LFICCALLLSGKTFAHDGTVYITGVVKGKTCIVSPGSEQLVVEMHDVAARQLAGQKNETPYEPFTINLEACGAGLS-AVSTHFEGTPDGNNSDLLALTGGPDYATGVAIGLYNPDKSLIAMGDESLPFALSNDQTTALHFYARYLAVTNAVTPGVANAAATFVLTY. 172
207 7.000e-38gi|308189039|ref|YP_003933170.1| Fimbrin-like protein fimI precursor [Pantoea vagans C9-1]  clstr ali  25  1MKLNKKDLLVLGASALFPMGSALAATASGGSVNFNGSVVTSACAISANSANIDVDMGEVRTATLAAAGSEASAKTFSIALEDCNPVAATTVSVTFSGTPDANDANSLAVNGGTASAQNVAIRLYDEQGNVVKLGEA-ATATPLRKGSNTLNFSAKYYSPTGGATAGDASAVATYTVTY. 191
208 7.000e-38gi|161504302|ref|YP_001571414.1| hypothetical protein SARI_02410 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980]  clstr ali  26  1...MIRKGAALVGLLWLSPVIAQPVMVESGRIHLRGQLVNGGCVVATESQDLRVLMGQYRTNAFAGPGSFAPSVPFSLRLISCSAEVWRHVGIAFAGVTPAEDPHVFLASGEGIGNAGIGLALFDDQQRQIIPNSLPLHYAPILTQEMTFHFTARYRAISENMTPGRIHSEVWFTLVY. 176
209 7.000e-38gi|386824077|ref|ZP_10111215.1| fimbrial protein domain-containing protein [Serratia plymuthica PRI-2C]  clstr ali  23  1MKMKKTRYGVVTCFSMGFFVNAAAASPPQVSVLYSGNLVAEPCTLLPENENVIVDFGSVVDKYLY-LNHRTHGVPFQLNLTDCDLGLGKTLKVTFNGPESTALPGLLALSAESQ-ASGIAIGMETEQGQPLPLNAASGKY-PLQDGNTVIRLQAYVQGEPAAITRGPFNAIATFNLEY. 181
210 8.000e-38gi|423107812|ref|ZP_17095507.1| hypothetical protein HMPREF9687_01058 [Klebsiella oxytoca 10-5243]  clstr ali  25  1MKLK-----LATIAFVATMGIASSASAQDGQINFTGKITETGCKINGGTSAQDVKLGEVSKTALPAAGDTATTTRFSLVLTECPEDLGKPISVKYDGTPDSINTDYLQLTGSENVAEGVAIQLLNDDTSALPLGTSSRPVTISNNAETTLNFFARYIATTDTVKAGDANGTVNFTLTY. 179
211 8.000e-38gi|16762466|ref|NP_458083.1| fimbrial subunit protein [Salmonella enterica subsp. enterica serovar Typhi str. CT18]  clstr ali  24  1MKLNLIASALVLSSTMLVG----NAMASDGTVHFLGEVVDSTCQVTPQTADQNVNLGKVNKTAFAGVGSTAAPTEFHIDLTGCPAT-YTKAAVRFDGTEASNSDGDLAIDGAAITASGVAIRIYNADNSQVKLNDSAYSTIDTTAGTASMEFIARYIATDATVTAGTANADSQFTVEY. 189
212 9.000e-38gi|398808357|ref|ZP_10567221.1| P pilus assembly protein, pilin FimA [Variovorax sp. CF313]  clstr ali  28  3.....KTIFVKLATLAVAGMLSQGAFAADGTVNFTGEIVDAPCSISPNSQNMTVPLGKVSRTVFATIGKKSTPAHFTIDLLGCGATA-KGATVTFSGTADLDDASYLRVANGVGAASGVAIELGDSAGTKIALGSPSGEYV-LGLGDNSLKFQAAYVATRTAVTVGPANSVAQFTVAY. 188
213 9.000e-38gi|212709440|ref|ZP_03317568.1| hypothetical protein PROVALCAL_00480 [Providencia alcalifaciens DSM 30120]  clstr ali  24  1MNINKKIAMLSVVISSIVCSAAFAENVNGGNITFNGEVTSGPCAVSSADTDKIVTLDTVKSTVFTAADQLAASKPFNINLLECDTDVRKSVQVTFNGQTVEGKPGLLANTAGVGSAKNVALQLFNPDGSALDIGALSSKVNLAE--TTTIPLSVDYKSTAAAVTAGKVQSVANFTLTY. 184
214 9.000e-38gi|401762891|ref|YP_006577898.1| hypothetical protein ECENHK_06955 [Enterobacter cloacae subsp. cloacae ENHKU01]  clstr ali  23  1MKMKKRLFVLAALASTLTFL----ARADDIQLQMVGNIYANTCLVDSASKDLTVDLGQAASSEFHDVGDTGAWKTFSLKVTHCPKSLA-LATAFFYGQADATHPTKFAN---TGSAKGLALELADSDHILIAPQASFNALIDQNDHTATFPLAARYYATAMPVTAGTFSSVVQVTFTY. 171
215 1.000e-37gi|188532416|ref|YP_001906213.1| major MR/P fimbria protein [Erwinia tasmaniensis Et1/99]  clstr ali  24  1MKLNKI--MMVAAIAFGASSIAHAANQGQGVVKFEGSIIDAPCSINPDTVDQTVNLGQVSKIALKDGGQ-STPKEFQILLENCEIEEGKNVSLTFTGVKAAS-----GNLAINGEAKGASILLSDTSGKPIKLGTA-TAAHKITEGKNILRFNAALQGDGKAVTPGNFTSVADFTMAY. 172
216 1.000e-37gi|283834495|ref|ZP_06354236.1| putative fimbrial protein [Citrobacter youngae ATCC 29220]  clstr ali  26  5....RILLLFIFISPAWVLADAHRLVSTPGKMRMRGNIIEAACYVDPRDRSLLVEFDDLSVRDISGRPEKVSAHDFSIHLLGCPGNVFQRANITFSGASDSNNPDYLSVQSET---ENLAIEIYDSKGQQIRLGEPSPDY-ALNPGKNTLNFTAYLISRDGRMTSGEFTAVTHFVVNYL 182
217 1.000e-37gi|157372904|ref|YP_001480893.1| fimbrial protein [Serratia proteamaculans 568]  clstr ali  22  1..MTKRIWGVVLIALSVCSAEATAKNQGHGTLNLGGEIVETPCGIASESLDQTVDFGLISMTDAALDTQIGSRRNFEIKLVNCELAIYRAATVTFDGTADSRDPELLAVY---GEAQGVAIELLTAAGIPIPLGSTTADY-QIVAGDNTLRFSAQLRIHPDRARAGGFSSLAKFTLSYL 183
218 1.000e-37gi|238791292|ref|ZP_04634931.1| hypothetical protein yinte0001_30450 [Yersinia intermedia ATCC 29909]  clstr ali  26  1MKLNKTILAAGLVL--GFASMANAADQGHGTVTFTGSIIDAPCSIAPESIDQTVNLGQISNVALQNGGK-STPRNFQIKLENCDITTLDTVTTTFSGMESTAVTGLLGF---TGEAEGAGIAITDGSGSVVSLGQPTAGQT-LVGENNTLVFSAYLQGSSDAIKPGNFYSVADFTLAY. 173
219 1.000e-37gi|336248641|ref|YP_004592351.1| fimbrial protein BcfA [Enterobacter aerogenes KCTC 2190]  clstr ali  23  1MKKHLLVMVMTAAGGMSCAANADTATVSGGTVNFTGQVVNAACSVSADSIDQTVTLSQVRTSKLTAAGMVANQKDFSIKLEDCDTTVSQNAAVIFNGQQDSSLAGSLANTAGAGSATNVALQLYGPDGQVLNIGDTSGTITLI-DGENTVPLSVDYVATGAA-TAGNVAATATFSMVY. 179
220 1.000e-37gi|197285323|ref|YP_002151195.1| fimbrial subunit [Proteus mirabilis HI4320]  clstr ali  26  11.MRFLLWGMLLFSGYTVFFTKDATAELANTNIVIKANIVANTCRVSPDSLNKFVDLGVWGTKDFQQKN-TTEPVKFTLNLTDCSI-VTSGVKVMFSGDTDSKDSTLFKL-AEKNAAQNIGIAILDKNQNKILPGKSSMIYPVETTNNISLDFYAQYIATNKDVVGGSANGEVLFSLEYL 185
221 1.000e-37gi|197286560|ref|YP_002152432.1| fimbrial subunit [Proteus mirabilis HI4320]  clstr ali  25  1..MHKLMLIVALSLLFTTKGSAY-----DTLVHINARVTGNTCTVETNSKRITVKLGQIATKDFISTQQRTPVIPFSIKLVDCQPEAS-AVKVSFNGRADPIDNALLAIDAT--GAKGVAISIMDNLGASIDINDKSQSYTLLPNQDNTLQFYARYVATQLPVQAGSANATATFLLEY. 171
222 2.000e-37gi|424801142|ref|ZP_18226684.1| PapA [Cronobacter sakazakii 696]  clstr ali  26  1MKFSKVSLAAAM-GLMLAAGMANAQDQGHGKVTFTGSIIDAPCSIHPDSIDQTVGMGQISNVALKANGNTGTSVPFEIKLENCDVSTLKTVKTTFTGAEGATDGSL----GITGTAKGASIILTNGDGQQLKLGEASA-AHQLQEGNNTLLFSAYLQGDGASATPGDFTAVADFTLAY. 176
223 2.000e-37gi|134292484|ref|YP_001116220.1| fimbrial protein [Burkholderia vietnamiensis G4]  clstr ali  27  19........................AAATPGTIRFQGEIVAGACGISQETLDQTVSLGQVPSHVFKKVGDRSEAKNFNIVLTDCDTSTQTNAFFTFTGASDATNADLIA---TTGSASNVGIRLQAGANDYLKNGTEQSSPVVLSKSGNTVTFGAMYEATAAAVTPGIANAVANFTVRY. 169
224 2.000e-37gi|333925984|ref|YP_004499563.1| fimbrial protein domain-containing protein [Serratia sp. AS12]  clstr ali  26  1MNFKLIPLALISALTLGAAMNASAATVNGGTVHFKGDVVNAACAVNTNSFDQTVHLGQVRTAKLAKDGDKSTPVGFNIELNDCDTTVSSTASILFDGVSVSGKPTVLALQSSAGSATNVGVQILDSTGTPVMVGSAASTAYTLSDGTNKIPFQAAYY...................... 160
225 2.000e-37gi|395232513|ref|ZP_10410763.1| type 1 major fimbrial subunit precursor [Enterobacter sp. Ag1]  clstr ali  28  1MKIKNLAL-VALSALSLSSGAAYAVTVNGGTVHFKGEIVNAACAVDAGSVDQTVQLGQVRSARLAAAGSTSSAVGFNIQLNDCDTTVSTKASVAFSGVAVTGKTDTLAIQGAAGSATNVGIQILDNTSTPLALGATFSAKTTLNDGTNIIPLQARYI...................... 158
226 2.000e-37gi|421142982|ref|ZP_15602947.1| minor component of type 1 fimbriae [Pseudomonas fluorescens BBc6R8]  clstr ali  23  1..MKKYLCILCLMPCL-----ANQSYAADTSISITGYLKDNSCSVSVDSKDFTVDLMSNASKQLNHVGTTTVPVPFTIVFDKCGGSTTG-VRVGYSGTSDNDNIALLKIDEGVNAASGMGIQILNSDKQAIPLNTTEQSTHLIAGQSNTLNFYACLMATHSPVTAGVVNATANFTLE.. 172
227 2.000e-37gi|423111945|ref|ZP_17099639.1| hypothetical protein HMPREF9687_05190 [Klebsiella oxytoca 10-5243]  clstr ali  23  27...KLNVAVLVTGILTVSIAGAATCPSNSCNLTVTGTVTATSCDVETTSQNITVPLGDVSIGTFQSVGDTSQAKSFSIHLKDCSDSVSG-AKVTFQGNADPDNTALLQLTQKEGAATGVGVEILQGNESSIALNTQVSAG-AISPGENTLTYRLRYKSTRNVVTAGFADAVMFFDLEY. 200
228 2.000e-37Gut.JP.Meta  ali  24  1MKLNLITGALVLSSTIM----ASQVFASDGTVHFRGEVIDSTCEVTADTKDQSVDLGKVNRTAFTGAGSTAAPTAFHIDLEKCP-DTYTKAGVRFDGTEASDGNGDLANTTTPGTATGVAIRIYNADNSQVKLYTKSAE-TPIVATKASMQFVARYIATSATVTAGTANADSQFTVEY. 188
229 3.000e-37gi|157146852|ref|YP_001454171.1| hypothetical protein CKO_02627 [Citrobacter koseri ATCC BAA-895]  clstr ali  28  6........VALVGLICAMPAFAHTVILESGNLHLRGQLVNGACAVNSESQDLRVQMGQYRTNVFSGTGSFAPSIPFALRLTDCSSEVYSHVGIAFSGVTPAEDPQVFLARSDTAATSGIGLALFDEEQRQIIPNSLPLHYAPILTQEMTFHFTARYRAISENMTPGSIHSDVWFTLVY. 176
230 3.000e-37gi|403053735|ref|ZP_10908219.1| type-1 fimbrial protein subunit A [Acinetobacter bereziniae LMG 1003]  clstr ali  28  1..MKKISLIAFAL---VASSTSFAATVTGGQVHFTGDLVNAACAVDVNSDGQTVDLGQHRVSKFKKAGDMSGPVPFQINLVDCEAAVTKGVSIAFKGSTTATNPKLLVVGAGASAAQGVGIQISDSSSTALALGTGFTKEIALNDGTNSFGFTARYVSTGPTLTAGKANADATFVVNY. 181
231 3.000e-37gi|261342535|ref|ZP_05970393.1| polar fimbria protein A [Enterobacter cancerogenus ATCC 35316]  clstr ali  24  1...MKPVIARILATVYMGLAFCTPAQAHDGTVYINGKIKQRTCTLSPDSQALLVRMGSVQNNLFTRVGDSSRYESFTINLESCQGS-KQNLSISFEGTPDKRNPSLLALTPAAASATGIGIGIYNQDKTLIPMGNASATLTPAPASDTIFVFFARYVSTAADVTTGTANASTTFIVNY. 175
232 3.000e-37gi|183599053|ref|ZP_02960546.1| hypothetical protein PROSTU_02498 [Providencia stuartii ATCC 25827]  clstr ali  25  1..MNSLLKYILLILFF----NHSISFSADGEIKFVGSIIPTACSVDTNSVHKVVNMGKVSVAAFTNKNSAAAATPFRITLSNCP-TDYKKIQFKFDGKSDSANPSLLGLSPNATAATGIAIGLYEENSRRIPLNGGSQFKEITPSKTVEMNFVAKYIATSDQIIPGSADALAHFSIIY. 174
233 3.000e-37gi|319897284|ref|YP_004135479.1| hafd pilus protein [Haemophilus influenzae F3031]  clstr ali  19  46.............LALLACIVALPAYAYDGKVTFQGEILDGTCKIETDSKNRTVTLPTVGKANLSLAGQTAAPVPFSITLKECKIADAEKANLLFSGAATKGQP-YLPNTASSGKANNVGIQIVKADGTPIKVDGSQANSEKAQNGTVIFDYFAHYYATGAA-TAGEVEATATFQVQY. 220
234 3.000e-37gi|261342530|ref|ZP_05970388.1| fimbrial subunit type 1 [Enterobacter cancerogenus ATCC 35316]  clstr ali  25  1MKKHILALVTAAALTGGICANAQAVTVSGGSVDFVGQVVNAACSVAADSVDQTVILSQVRTVKLTQAGMMANQKDFQIKLEDCDTSVSQNAAVIFNAQQDEAQPGTLANTAGAGSAQNVALQLFGPDGKALHLGTSSST-VKLINGENIIPLSVDYIATGAA-TPGNVAATATFQMVY. 179
235 3.000e-37gi|395497206|ref|ZP_10428785.1| minor fimbrial subunit, polypeptide (FimF) [Pseudomonas sp. PAMC 25886]  clstr ali  23  1..MKKYLCVLGLMPCF-----ASHSYAADTSISITGYLKDNTCSVSVDSKGFTVDLMSNAAKQLNRVGATTVPVPFKIVFDKCGSSTTG-VRIIYGGTSDEDNNTLLKIGAGTNAASGLGIQILDSDKQPIPLNAAPQSSPLIAGQSNTLNFYACLMATRSPVTAGVVNATADFTLE.. 172
236 3.000e-37gi|261344637|ref|ZP_05972281.1| fimbrial protein [Providencia rustigianii DSM 4541]  clstr ali  24  1MKK----IILATLISGVMSSSALAVDAGSGTVTFSGSIIEAPCSIAPGEENQEVALGQVSNVTLDN-GSESSAQPFQIKLEGCNLKGDNQVAVTFKGTEAGTNTGYLQI---TGDATGAAVKIMNGSGAQIKVN--SSAKQNYVEGNNTLKFQASLISKPLPVTPGQFQAVTNFTLAY. 176
237 3.000e-37gi|416778620|ref|ZP_11876017.1| fimbrial protein [Escherichia coli O157:H7 str. G5101]  clstr ali  25  5........MIVGALAFTSVFMAGHLQAADGTVHFRGEIIDSTCEVTPETKDQVVDLGKVNRTAFSGVDDVAAPTAFSIDLTQCPET-FKSAAIRFDGNEDAHGNGNLAIAGAVSAAKGVAIRLYNADNTQVKLYENSAS-TPISNGNASMKFMARYIATETTIDPGTANADSQFTVEYI 199
238 3.000e-37gi|293397346|ref|ZP_06641610.1| S-fimbrial adhesin protein SfaG, partial [Serratia odorifera DSM 4582]  clstr ali  25  7........................ADLGVINISITANLVANTCSVSLASQNQTVQMGDWADKQF-AVNPETLAKPFILTLEDCDAGA-RGVKMTFNGTANGADSSLLALT-GAGSAQNVGLAILDKDKNRIPLGKPSGIYPLKAGGKQNLQFYGQYVATAQPVKAGLANADATFSLEY. 158
239 4.000e-37gi|268590937|ref|ZP_06125158.1| major MR/P fimbria protein [Providencia rettgeri DSM 1131]  clstr ali  27  1MKLTKIALATIIASSFGIA-QAAPVDQGSGVINFTGKVINAPCSI-PGDGTINVDLGQVANKVLETGNKYSQSVQYNIQLENCDLGAVSKVKVTFTGTPDTTAKELLAN---TGTSKGVGVRLINADGATMKVGDTS-VELPLADGPNKLVFSARVEANGSKVETGSIISQATYALNYL 185
240 4.000e-37gi|283785516|ref|YP_003365381.1| major fimbrial subunit [Citrobacter rodentium ICC168]  clstr ali  30  1MKKNSIALALSVTALF----TATNVMAYDGTVNFVGQILDTACTVDIGANNLVVDMGNVYKTAFAAAGDEASTTKFTLRLINCPASVS-TARVKFDGANDASDSTLLAIMPDPAAADGVAIRLKTADKTNLDLNQNGYTYVVSSTMDNNLDFYAAYVATRVPVMAGPANAVANFTVNY. 175
241 4.000e-37gi|331651717|ref|ZP_08352736.1| putative fimbriae structural protein [Escherichia coli M718]  clstr ali  17  6.MFKGQKTLAALAISLLFASPVFAADEGSGEIHFKGEVIEAPCEIHPDDLDMNIDLGEVTTSHINRE-HHSEKKPVNIRLINCDGGVVSKVGVTFDSTAKTTGATPLLSNISAGEATGVGVRLMNKDESFVVLGTEAPTIDLLASSTQTLNFFAWMEQNAVSVTAGAVTANATYVLDY. 192
242 4.000e-37gi|197286557|ref|YP_002152429.1| major subunit of type 1 fimbria [Proteus mirabilis HI4320]  clstr ali  23  1.MKKLLLSAIITSAMAIIATPALAVTVNGGTINFEGSVVNAACGVDSSSSNQTVRLGQFRVAEFTKKGDETGRIPFSIKLNNCDITVSSLAAITFNGTASDGDATAFAL-QGSGAATNVALKITDSSSKNVVPGQPSSTQKLI-EGENQLNYNASLISTDDTVKAGSANVTTNFMVTY. 185
243 4.000e-37gi|401678673|ref|ZP_10810632.1| P pilus assembly protein, pilin FimA [Enterobacter sp. SST3]  clstr ali  25  1MKKHVLAMVIATAMVSGVAMNAQAVTVSGGTVNFVGQVVNAACSVAADSVDQTVTLSQVRTVKLTTKGMQANQKDFKIVLEDCDTTVSQNAAVIFNGQQDAALAGSLANTAGAGSATNVALQLFGPDGNVLNIGDTSSN-VKLINGENTIPLSVDYIATGAA-TPGNVSSTATFQMVY. 179
244 5.000e-37gi|148828399|ref|YP_001293152.1| S-fimbrial protein subunit [Haemophilus influenzae PittGG]  clstr ali  21  52..................CIVALPAYAYDGKVTFQGEILDGTCKIETDSQNRTVTLPTVGKANLSSAGQTAAPVPFSIRLKDCNADDAIKANLLFKGGTV---GNYLSNKTGDGKATNVGIQIVDGTGTPIKVDGSEANREKAPNGTVIFDYFARYYATGAA-TAGDVEATATFEVQY. 219
245 5.000e-37gi|161615972|ref|YP_001589937.1| hypothetical protein SPAB_03771 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]  clstr ali  24  43MRNKIILAMAAAGMMYGASVFAAAGPFGSGKILFTGTITNSPCDIAPGDDAITVPFGQISYRKLNTADATTESKPFTIHLQNCSAGKMSKVTVSFSGTADTSGKAYV----STGSAQHVGVQLLKGDNTLITPNTPMPDAQQLQAGSNELNFFARLIALTGAATPGDVNASVTYTLKYL 236
246 5.000e-37gi|238893503|ref|YP_002918237.1| putative fimbrial-like protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  clstr ali  21  1MKMKKYSRGMASFVVMMMLSPV-AAQAADGKVTFNGEVIENTCTVV--NKDKTVTLPTVQRSALSSAGETAGVVPFTIDLTSCTPGA--DVSVYFEKDQYVSTEGRLKNTLSDGTAENVDVELLNTRFTPINLAETPAVAVAEQDGSASLPFYARYYAT-DAAKAGKVAAYVNFTVVY. 187
247 6.000e-37gi|268589729|ref|ZP_06123950.1| type-1 fimbrial protein, A chain [Providencia rettgeri DSM 1131]  clstr ali  25  1..MSILKKSLTIIGVTLAVTSTPTVFA-SGTINFTGEITDIACTVDSNSKNLNVDLGKVSAKSLAAQGEVAGLKNFTIKLVDCP--TNSKVTVRFGGTRDTADNDILAINQAVGVANNVGVALFEKDATQIKLFEDSK-QIEFDGTTVDLDYVARYKATG-VVTAGPANSSAVYSIQY. 172
248 6.000e-37gi|157146567|ref|YP_001453886.1| hypothetical protein CKO_02328 [Citrobacter koseri ATCC BAA-895]  clstr ali  23  4MKKMVFLLAAGLMA---------YACADDIQVQMVGNIYANTCSVDSASKDLTVDLGQASSSDFKDVGDTGEWKAFSLEVTHCPKTLT-LANAFFYGQADSVHPTKFAN---SGSAKGLALELADQDNILIAPQASFNVLINQSDHTATFPLAARYYATSMPVSAGSFDSVIQVTFTY. 169
249 6.000e-37gi|300991480|ref|ZP_07179571.1| fimbrial protein, partial [Escherichia coli MS 45-1]  clstr ali  27  4.....MAVFSALTLGVATSASAAPATVNGGTVHFKGEVVNAACAVNANSFDQTVQLGQVRTEKLKADGDKSAAVGFNIELSDCDTKVSNGASILFSGTTVATKNNVLALQGSSGTATNVGVQVLDHTGSAVTFGNTPTASYTLSDGTNKIPFQALYIATGQS-TAGTANADATFKVQY. 177
250 6.000e-37gi|238793202|ref|ZP_04636830.1| P pilus assembly protein, pilin FimA [Yersinia intermedia ATCC 29909]  clstr ali  28  1MSNFKKSAFIIALASSAFISQAFAADEGNGRIHFTGTVINAPCSIAPNSTDISVDLGQVANKVLETGNKYSQNVQYSIDLQDCDLTAMSKVSVTFGGVSDATSPALLAN---TGSAGGAGIRLIDTNGALLKVGDTGAD-VNLVTGPNQIVFAARVEATGAPVTTGTIVSQATYALNY. 184
251 6.000e-37gi|268590684|ref|ZP_06124905.1| type-1 fimbrial protein, A chain [Providencia rettgeri DSM 1131]  clstr ali  23  1MNIKNKLAVLSVVVSSIICSSTFAATVNGGKVTFNGEITSGACAISGSDTDKIVTLDTVKTTTFTAADQLAMAKPFNINLVECDTATRKSVQISFNGQTVDGKPGLLANTAGAGSAENVGLQLFNPDGSPLEIGALSSKVDL--TDTTTIPLSVDYKSIGAVVTAGKVQSVANFMLTY. 185
252 6.000e-37gi|311278041|ref|YP_003940272.1| fimbrial protein domain-containing protein [Enterobacter cloacae SCF1]  clstr ali  24  3.NKTLLAAVTATLMVGASFNASADDNQGSGKITFTGEVISAPCSIAPGDEDQTIKLGEVADTVLNTAGQYSLPVPVTIHLQDCGTNTIDKVKVTFTPGVDATDPNLMKNTGNVGGASGVGVRLLDAGSNKVTLGTPVTVAFTTTNAYQELNFQARMESLTNNATPGNLKAQANYVLDY. 186
253 6.000e-37gi|117626622|ref|YP_859945.1| type 1 fimbriae major subunit FimA [Escherichia coli APEC O1]  clstr ali  25  20MKIKTLAIVVLSALSLSSTAATTPTTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTATLKQAGATSSAVGFNIQLNDCDTTVATKAAVAFLGTADSTHPKVLALQSSAGSATNVGVQILDRTGNELTLGATFSAETTLNNGTNTIPFQARYFATGAATPG-AANADATFKVQY. 202
254 7.000e-37gi|365847957|ref|ZP_09388438.1| fimbrial protein [Yokenella regensburgei ATCC 43003]  clstr ali  24  1..MKKILLPAAALILSATAMNAYAV---NGKVEFTGEIIKSTCNVVSGDQDKQVFIGKYPTSAFTKVGDVTASKAFTIQLEKCTAG---DYTLRFDGQTVAGHSNLLSVDK----AQGVGIEILDNNEKIIPINQSAGTDTPASDGTATFNLKARYKSF-DTVQAGSANANANFTIEY. 175
255 7.000e-37gi|188535135|ref|YP_001908932.1| minor fimbrial subunit PmfF [Erwinia tasmaniensis Et1/99]  clstr ali  24  1..MNSIIIAAALLFAVLSSAPAMAAVLIGGDLRFEGEVVAYPCSVAPESERVPVNFGEISTKSLYINGK-SIPVPFSIRLQDCNPGLLNTVSVTFSGDENPNLANHLAIKATAGGASGVGIGLLEADNTPVSLGVPTTP-VTIGDSVMQLDLQAFVEAEPDTLTAGPFSATAYYLLNY. 181
256 7.000e-37gi|383813543|ref|ZP_09968968.1| type-1 fimbrial protein subunit A [Serratia sp. M24T3]  clstr ali  25  1MKYKTIALSVVASLSLVAVXXXXXXXXXXXXXHFTGQFVNAACAVSTDTADQTINLGQYRTASITAAGQTTTNIPFNIKLVNCDTTVATAASIAFTGTPDEDNSTLFAVNAGSTAASGVGIQLLDSASNDLPPGTTYSVAKTLTDGDNTIPFTARYKSTAATVTAGQADADATFVIQY. 188
257 8.000e-37gi|268592281|ref|ZP_06126502.1| fimbrial subunit type 1 [Providencia rettgeri DSM 1131]  clstr ali  22  1MKKNVFAYLIAASSVFAI----NNALAADGTIDFTGEITDQACQFATGSDAFTVNLGKISKTALPSTGSTAAATKFTIKLENCPQTVT-SATVKFDATSYAGDNSVLQLTTAATTAQNVGIQIQDVTGTTVPLFTESSAYALKEKTVNNLDFTARYIAMSNSVGVGQANSTATFTINY. 175
258 8.000e-37gi|253688667|ref|YP_003017857.1| Fimbrial protein [Pectobacterium carotovorum subsp. carotovorum PC1]  clstr ali  25  1.MHKSLLNTLIGASLLSSSVTVFAATVAGGTVHFKGEIVNAACAVSTNTADQIVNLGQYRTARFTGVGTYSGKVPFTINLEDCDSTVSTTAAVAFTGTADSNDNTVLAVSNXXXXXXXXXIEISDRTGAVLTPNGAYSAPQTLNDGSNVLAFNARYKATQATTTPGAADADATFTIDY. 182
259 8.000e-37gi|268591034|ref|ZP_06125255.1| fimbrial protein [Providencia rettgeri DSM 1131]  clstr ali  22  1..MKIKSIAMATLLVLGGASAANAADQGHGKVTFKGAIIEAPCSIAPESIDQTIELGQISNMALADGGK-SSPKTFDIALQNCNSSLTKGVQLTFTGASASFDEDS-KTLGIVGTGSGAGVQITSGNGEIVTINTA-TPFQQIQDGSNTLQFSAYLKGNGGTITAGEFSSVADFTLSY. 177
260 8.000e-37gi|311277963|ref|YP_003940194.1| fimbrial protein domain-containing protein [Enterobacter cloacae SCF1]  clstr ali  25  5..........VLSGLWLCGAFAAHADDGSYNLKLTGTIVAETCNVDASSETQTVRLGQFSTADFPTVGSTSRSAPLPITLTGCTQNITGG-QVWFTGTADSDDPSLLALSADAQMATGVAVQILDGSQSPVSINNTHSAVYPLHAGDNVLTFNLRYMSTKSQVTAGNATAVMYFDLQY. 176
261 8.000e-37gi|282599903|ref|ZP_06257403.1| protein FimF [Providencia rustigianii DSM 4541]  clstr ali  23  1..............MLTFMLLCQNAFAADSTINIKGNIKDNTCAVAPGSQNQVVDLLINAVKQLHSNGEVTPLVPFSIDLTPCGTAVT-AVKVGFVGIADGNNKSLLALEAGSANASGVGIQILDGARTPLVLNADSNNTPLMAGKSNTLHFNARLMASKTPVVAGHIRATATFTLE.. 165
262 9.000e-37gi|291326648|ref|ZP_06125288.2| putative minor fimbrial subunit PmfF [Providencia rettgeri DSM 1131]  clstr ali  23  12.KRTKYLLSIGLYLLVSGPMSASVIPTNMGSYSFRGMVIATPCQIAPGSEKVPVDFQQISVKDLYKEGK-SKPLNFSIHLTNCNTTIFKSVTVTFNGIENKNLPDHLAISDQS-EASGIGIGLLNLNETPIELNTPSLAQ-NLATNNTEIQFKAYVEAENQTITYGNFYSTAYYTLNY. 190
263 1.000e-36gi|161504847|ref|YP_001571959.1| fimbrial subunit [Salmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980]  clstr ali  23  1MKKTVLALMASAIVFGGMVSTAQATTVTGGTVNFVGQVVDAACSVSADSVDQTVTLSQVRASKLTGAGMVANQKDFTIKLEDCDTQISQNAAIIFNGQQDANQPGSLANTAGAGSATNVALQIYGPDGQALNIGETSST-VTLNDGENVVPLSVDYIATGAA-TAGNVTATATFSMVY. 179
264 1.000e-36gi|327412748|emb|CAX67751.1| fimbria A protein [Yersinia enterocolitica]  clstr ali  24  1MKFNKIMLSAILVFGASSMAQANPVMGATGKVTFSGKIVDAPCSIAPESVDQTVKMGSIANGALKAGGK-STPQPFMLKLTDCDVATKKSVVTTFTGGASESKDGHLGVI---GSAKGISVGIGDTAGNLIVLGKPVPSELIV--GSNELNFTTFVKGDAAAITPGDFQAVAGFTLAY. 178
265 1.000e-36gi|421726676|ref|ZP_16165846.1| SefF [Klebsiella oxytoca M5al]  clstr ali  26  1.MKRHIARALSLMVFPMLLLVSVPATHADTDVYFTGNLVADPCELHVDSEDQIVDFRNIPSKTFIKY-HLSERERFSIMLINCDLSLGSTVKVTFMGTEDVDQPGLFAV---TGTAGGIAIAVEDADGTPVLPNTAMRPAT-LTAGDTNLNFQAFVSAVHSRVREGDFECVTTFLLEY. 173
266 1.000e-36gi|334122766|ref|ZP_08496802.1| hypothetical protein HMPREF9086_1061 [Enterobacter hormaechei ATCC 49162]  clstr ali  24  4MKKTIALLALGLM---------TQAHAEDIQIQMTGNIYANTCIIDTASRNLTVDLGQAVSGSFKDVGDTGEWKDFSLSVSHCPATLA-LATAFFYGQPDSTHPTKFAN---TGTAKGLALELADQDKILIAPQAAFNAAINPSDHTATFPLSARYYATAMPVTAGTFSSVVQVTFTY. 169
267 1.000e-36gi|418941139|ref|ZP_13494477.1| putative fimbrial-like adhesin exported protein [Escherichia coli O157:H43 str. T22]  clstr ali  26  92................................NISGRVLDYGCTVSSDSLNFTVDLQKNSARQFPTTGSTSPAVPFQITLSECSKGTTG-VRVAFNGIEDAENNTLLKLDEGSNTASGLGIEILDGNMRPVKLNDAGMQWIPLVPQNNILPYSARLKSTQKSVNPGLVRASATFTLE.. 238
268 1.000e-36gi|91210142|ref|YP_540128.1| S fimbriae minor subunit SfaG [Escherichia coli UTI89]  clstr ali  27  1MVKDIIKTVTFSCMLAGSMFVTCHVCAAGSVVNITGNVQDNTCDVDINSRNFDVSLGSYDSRQFTAAGDTTPASVFHVGLTSCGSAV-RAVKLTFTGTPDNQEAGLIQINSING-ARGVGIQLLDKDKHELKINVPTT--IALMPGTQTIAFYARLKATYLPVKAGNVDAVVNFVLDY. 174
269 1.000e-36gi|336248905|ref|YP_004592615.1| major fimbrial subunit protein [Enterobacter aerogenes KCTC 2190]  clstr ali  24  1MNKKLLPVVALIL-----SASATSAYAVNGKVNFTGEIIQSTCTVTSTDQNKDVFIGKYPTTAFNAVGDVTASKAFTINLEKCEAG---DYSLRFDGATVAGNPNLLSVDN----AKGVGIEILTNDEKIVPINQSADAASDDNSGTAVFNLKARYKSFLKTVEAGSANANATFTIEY. 174
270 1.000e-36gi|197285327|ref|YP_002151199.1| fimbrial subunit [Proteus mirabilis HI4320]  clstr ali  29  1MKYSLIYSIVLFFTLSFTAYSNENISLDDGIVTFKGGIVEPACTVSSESEYQIVDLGVISSNQFHGVGSHSIKIPFFIKLMGCNKSITDKVSIIIIGDVNNNDKRLFSITDQQNSASGLGVALFNDEGEIIIPNK-FNKYKFIEENELKLKFKASYLATKENVIGGKADSVVWFVFNY. 179
271 1.000e-36gi|378768169|ref|YP_005196640.1| fimbrial protein [Pantoea ananatis LMG 5342]  clstr ali  25  1MKLNKLASVLALGLSMAAISNVYAANQGQGKITFTGSIIDAACSISPETSDQEVSLGQIAASQLADNG-TSKPVNFEIDLQHCTTTTAPSVKVTFGGSPAIEGDNTW--FGITGTASGAGVVITDASSNKIPVGGTTEMARELIEGDNTLGFSAYLQGLGDKVTTGEFSSIADFTLAY. 194
272 1.000e-36gi|157369762|ref|YP_001477751.1| fimbrial protein [Serratia proteamaculans 568]  clstr ali  23  14..................SATAYNATAASGNVKFTGEIVQSTCKVVDKDQNKEVYLGKYPTTAFPTSGSTSGAKAFDISLEKCEAG---NYTLRFDGNTPAGHPELLAV---TGGANGVGVEILDNNGATLPISQEVATPATVNPGSATFNLRARYKSYQDLVTAGQANSNATFTIEY. 174
273 1.000e-36gi|422016040|ref|ZP_16362630.1| fimbrial subunit [Providencia burhodogranariea DSM 19968]  clstr ali  23  1MKKKLLASLIAATSIFAV----NNALAADGTIEFTGEITDQACEFATGANALKVILGKVSKTALPATGATAAATKFTIKLINCPATA-ISAKVQFDADSYAGDDEVIALKDETDVATGVGIQITDDTNTVVPLFTPSKAYALKQSVENSLDFRARYIAKTDAVTVGPANANATFTINY. 173
274 1.000e-36gi|283787095|ref|YP_003366960.1| fimbrial subunit [Citrobacter rodentium ICC168]  clstr ali  23  1..MHRIMIFLASLLTPLCTAPAWAQGQLGGDLSFKGVVVAYPCSIAPDSERIPVDFGKISTKSLSINGKTT-PVPFTIKLQDCNPSVFHSVTVTFSGTENPNLADRLAISATAGNAGGVGVGLLEADDTPVRLNVPTTP-TTVSDTVLRLNFQAFVEAENGTLTTGPFTATANYTLNY. 181
275 2.000e-36gi|145627746|ref|ZP_01783547.1| S-fimbrial protein subunit precursor [Haemophilus influenzae 22.1-21]  clstr ali  18  31.............IALFACFIAPPLYAADGTVTFEGEILDGTCKIDTGSQNRTVTLPTVGKANLSRAGQTAAPVPFSIMLKDCKIDDTTKVKLLFKDGVGGQQP-YLANQKGSGKATNVGIQIVKADGTNTPIGTEADSKKAADTGKAQFDYFAHYYATG-PATAGYVEAAATFEVQY. 205
276 2.000e-36gi|157372381|ref|YP_001480370.1| fimbrial protein [Serratia proteamaculans 568]  clstr ali  23  1MKLNKIMMAAVVAFGM---SSMAHADEGHGKVNFAGSIVDAPCSISPETVDQTVNLGQVSNVALKDGGK-STPKNFQIDLENCTVATGKTVQVTFTGA--KAQETNKNLLAITGSASGAGIAMTDTSGALVELGKGGTAQM-LQNGNNTLQFAAYMQGLTAAVVPGDFTAVTDFTLTY. 178
277 2.000e-36gi|157372909|ref|YP_001480898.1| fimbrial protein [Serratia proteamaculans 568]  clstr ali  24  1MRLRALAMLSCTPFWFTTLPTLADTELVGSPLQFHGTVVSRPCNIEPQSADQVVEMDTVIVKTLYRYGH-SNPVPFNIKLTDCKTSVFKSVNVTFSGTEDSELPGKLAINNGTNGA---AIALFDSKGADIDLNQATS-AVALQDGANILNFTAYVQGQNKTITEGEFSSVANFVLAY. 178
278 2.000e-36gi|401678668|ref|ZP_10810627.1| P pilus assembly protein, pilin FimA [Enterobacter sp. SST3]  clstr ali  23  1..MKKRXXXXXXXXXXXXSLQTARADNDSFNVQFIGTIVGESCNVDTGSVEQTVELGDFTADDFPSVGTTTPDTKFDITLKGCTRAITGT-KVWFTGNVDANNPTLLALSDNGKGATGLGVELLDSNRTPIPINNTESSLYPLLPGDNTLTFYLHYKSTLPVVTSGNATAVMYFDLLY. 180
279 2.000e-36gi|422014792|ref|ZP_16361401.1| fimbrial subunit [Providencia burhodogranariea DSM 19968]  clstr ali  28  4.KQRLIKSVIGLTVLSASGLGVAATTVTGGTVHFTGTIVNAACAVSANSTNQTVNMGQYRSAFFDAVGKKSGNVPFSIKLEDCDTTVSKKVSVSFSGLTTADNVTALSTSNXXXXXXXXXIQIADHLGQVLKPGSVFSTAQNLVDGANVLNFSANYISTKAVVTPGAADADATFTMQY. 185
280 2.000e-36gi|293393927|ref|ZP_06638233.1| type I pilus biogensis protein FimA [Serratia odorifera DSM 4582]  clstr ali  25  19......................TSASAADGQINFTGEIIESACQVVNSSAPLDVTLGKVSKTAFNGAGSTAAPTKFTLQLKSCPATVS-SATVKFDGTAVDSDNSVLALTQVSGGATGVGIQLTDASQKVLPLFTESAPYPLTASTANSLDFIARYVATAATVTVGPANAVANFTVNY. 183
281 2.000e-36gi|340001329|ref|YP_004732213.1| fimbrial subunit protein [Salmonella bongori NCTC 12419]  clstr ali  26  1MKPNLIVSALVLSTSMLVG----QAMASDGTVHFRGEVIDSACEVTADTAEQNVDLGKVNRSSFINAGDVAAPTAFQIDLIKCPAT-YTKAAVRFDGVEASDGNGDLAIGDPVKASTGVAIRLYNADNSQLKLYEDSTPTIDATAGTASMKFIARYIAINNAVTPGTANADSQFTIVY. 189
282 2.000e-36gi|167584364|ref|ZP_02376752.1| Fimbrial protein [Burkholderia ubonensis Bu]  clstr ali  21  1MKKTVISTALAAASIVAF---APAAHAFDGTIDFTGSLVATTCTINGGGSNFTVALPPVSTDALKAAGSSAGRTPFQLKLTNCQPDTGKVSTFFEAGPTINTATGRLMVD--AGGAEGVEIGLLNDSFQHIAAGAAYNAQVDITGGNATLNYYAQYESLGTPLKAGPANSRVQYTMSY. 179
283 2.000e-36gi|238784151|ref|ZP_04628165.1| hypothetical protein yberc0001_12610 [Yersinia bercovieri ATCC 43970]  clstr ali  26  1MKLNKTILAAALVL--GFASVANAADQGQGTVTFNGSIIDAPCSIAAGSDSQTVEMGQISNVALQNGG-RSSSHDFDIKLENCDTTTLKTVTTTFSGAESAAVPGLLGIV---GLAEGAGIAIVDGTGSVVTLGDATAEQTLIT-GNNTLAFSAYLQGSSDAIKPGSFSSVANFMLAY. 173
284 2.000e-36gi|340786766|ref|YP_004752231.1| fimbrial subunit [Collimonas fungivorans Ter331]  clstr ali  27  1MKQMTIAKLVAVAAAGLLS---QAAFADGGTVNFNGNIVDSPCTVDPSSQNITVPLGDVSRTVFGAAGKKSTPSKFTILLTDCGPTA-KGATVTFTGTTDAIVKDDLAIANGVTAATGVAIELGDSAGTKIPVGSASGTYV-LGLGNNPLKFQAAYISTSTAVTVGPANSTAQFVVAYL 179
285 2.000e-36gi|163854418|ref|YP_001628716.1| type-1 fimbrial protein [Bordetella petrii DSM 12804]  clstr ali  27  23.....................PMAAQAASGTVEFQGEIIQSTCDVTTATKDQTVVIGTYPTTLFKNVGDVSASKGFTIGLENCVPG---DYTIRFDGQAPAGQPELLAVN----VATGVGIEILDNNDKVFPLNQDITDPAVAADGTATVNLKARYKSFEQTVGAGEANATSTFSIEY. 175
286 2.000e-36gi|421492430|ref|ZP_15939791.1| hypothetical protein MU9_0959 [Morganella morganii subsp. morganii KT]  clstr ali  23  1MKKHIKQTLLPLLCGSLLIHSAAAYELGRVNIELSGEIVAYSCGVEVSQANKKVELGRWALKNFRAAGDKTQSMPFSFQLQNCPPS--SAVTFVFSGKKDKQDSSLLAINEGASAAGSVAVEILDSQKNRLPVETKSPKIAMDINGNGQAQFYANYIATGNRPTPGIADADATFMITY. 176
287 3.000e-36gi|422015471|ref|ZP_16362069.1| fimbrial subunit [Providencia burhodogranariea DSM 19968]  clstr ali  22  1MMNRQFKKLIFILLL----PYAGTVFAIPDNLHFHGILVEEPCTIKPGDESVRLDFGNVPDKNLYAYG-RTVSEAFTINLSECDTSIGKSVNVTFFGTSNLVLPGYLALQNNS-SATGFAIGIEDIDGTFLPVNTQSN-KLSLQNGTTALKFKAYLKGEPDAIKRGPFNAIATFKLDY. 176
288 3.000e-36gi|419959171|ref|ZP_14475228.1| fimbrial protein [Enterobacter cloacae subsp. cloacae GS1]  clstr ali  23  1MKLNVIATSLVLSSVLF----SGATLAADGTVHFRGEVIDSTCTVTTDTSNQTVNIGRVSVKTFAGIDSTASVKDFHIRLEGCPATYTQ-AAVRFDGTEDDGTDGEFTGSGDAIAATGVAIKLFNSDDTAIPLYNNSK-YVAIADGKADMGFKAKFVQTLATVTPGTANADSQFTIEYL 191
289 3.000e-36gi|402565143|ref|YP_006614488.1| P pilus assembly protein, pilin FimA [Burkholderia cepacia GG4]  clstr ali  20  4......KALSILMATAGLLAVASSAQAADGTITITGEITAQTCNIDGGGKDFTVTLPNVSTSALSTPGSTAGRKPFRIALSNCSPNSGNASVYFEPGTTVNAQTG--QLFNATGDAKNVEVGLLNKDGSNIKLGQQNSQVVPISGGAATLDYYAQYVATGGSATAGSVGTSVLYSVSY. 179
290 3.000e-36gi|422006577|ref|ZP_16353566.1| fimbrial protein domain-containing protein [Providencia rettgeri Dmel1]  clstr ali  21  1..MKLKSITTSIFITLGLVSFANAADQGHGKVTFKGSIIEAPCSISPDSIDQTVELGQISNMALVSGGK-STPRSFDIALENCDVTATKGVQLTFTGAAASFDATS-KTLGIVGTGAGAGIQITNGGGNIVTLGTA-TPFQNIQSGDNTLRFSAYLKGNGGTITAGDFSSVADFTLSY. 177
291 3.000e-36Oral.Meta HOMD esak_c_1_18347 Cronobacter sakazakii ATCC BAA-894 [2279233 - 2278601] fimbrial protein  ali  25  35MKKKLCWMALAGALTF----HAASVLAADGKINFTGKITDQACEIDDDDKVLDVDLGVYSVNQFATVGVKTPPIPVKIKLKNCPSGENPHFSVYLTGDADPVNKDYLKV--ADGGATGVAIVITDDEGTLIPMNQFSQRKFEIPDATMDLNLIAYYESTSTTVGAGVANGTTDITFDY. 210
292 3.000e-36gi|283832641|ref|ZP_06352382.1| protein FimF [Citrobacter youngae ATCC 29220]  clstr ali  26  1MNKFILFCFYMILALNCFADQVS-------TITVTGNVHVAACRVDPSSQNVPVDLGKHSIYQLKNIGDSTDPVTFSIDLEDCPETT-NSALIKLDGFSDTDNNQLIKLDDMPDSASGVGVAVYDNTGTIVPLWMPSAAY-QLQKGSNLLTFTAKYVVSKLPVTNGIADATVSFTLNY. 169
293 3.000e-36gi|153832599|ref|ZP_01985266.1| fimbrial protein [Vibrio harveyi HY01]  clstr ali  23  1MKAKFIRSSIAATFLFGLMSATPALAENTTNVYFKGEIVESACGLSPDSIDQTIQLGQQPTHIFKAKGDRSTPVPFQVKLTDCDTSVATTAQFTFDSNPDTTGN----LFSVEGGATGIGVRIL-HDGNPINNGDVAASNVLI-DGTNIASFSAAYEATATPVTAGVAESWALLRVTYL 177
294 4.000e-36gi|398798868|ref|ZP_10558165.1| P pilus assembly protein, pilin FimA [Pantoea sp. GM01]  clstr ali  24  1.MKSKLALLVAITASLGIVGTSTAA---DGTINFTGTITDNACTVDTGSANQTVNLGTVSTKTFTGAGVTASPTRFTINLTSCPATVT-SASVRFDGATSSANNQILALNSGQ-TATNVGVALYEQDSTLIPIASKSVDRPITATGPNVLTFIAKYYATATPVAAGSANSTANFTIAY. 173
295 4.000e-36gi|120367|sp|P22595.1|FIMA1_SERMA RecName: Full=Type-1 fimbrial protein subunit; Flags: Precursor  clstr ali  21  14..................SATASNAMAANGTVKFTGEIKQSTCQVTSDTQNKEVYLGTYPTSAFPTVGSKSASKAFQISLEKCDAG---DYSLRFDGNTVAGNPDLLSVSNVGGTATGVGIEITDNNGKPFAIGDGSNKVTIAADGKATFNLQARYRSFDSNVTAGLANATSPFTIEY. 179
296 4.000e-36gi|183601134|ref|ZP_02962627.1| hypothetical protein PROSTU_04763 [Providencia stuartii ATCC 25827]  clstr ali  25  1MKK----IILATLISGAMSASAFAVDAGKGTVTFTGSIIEAPCSIAPGDESQTIDLGQVSNVTLQKGG-MSAAQPFEIHLEGCTLNANNMVEVKFEGTEWVNNGSNTGLIQITGDASGAGIVLMNKSGAKININD-STVERAYTSGNNILSFQAALQGSDATVVPGSFQAVTNFTLAY. 185
297 4.000e-36gi|333929641|ref|YP_004503220.1| fimbrial protein domain-containing protein [Serratia sp. AS12]  clstr ali  21  1MKRCVPYFVSPFILLVLLNTQAQAAHQTQGRVNMQGSIIDTACAIAAGSREQTIDMDTVPVGDIMRDGQGTT-RPFSVELIHCELSDWRHFQVTFDGEADG------ALFGVNGEAKGVALEITDSRGNKAAPGEP-LPLGEITPGTMNLDYTMRLVSNSQVVKAGEYTSAVRFKLDY. 179
298 4.000e-36gi|37524777|ref|NP_928121.1| MrfG protein [Photorhabdus luminescens subsp. laumondii TTO1]  clstr ali  23  1MKYLKLFVLRVGFMVIAATVYGHQGVQAADNMRFHGALVKEPCTIKPGDEDIQLDFATISEKYLYLHG-RTHSEPFLLRLSGCDMSVGKSFKLTFSGIENTQLPGLLALSAGSQAA-GIAIGIETAEGRRLPLNKEGDAY-PLKEGENLIALQAYVQAENQTITRGAFHAIATFNLNY. 180
299 5.000e-36gi|423108377|ref|ZP_17096072.1| hypothetical protein HMPREF9687_01623 [Klebsiella oxytoca 10-5243]  clstr ali  29  1MQKNKVRVLSLASFPLMLLLAGVSVTHADTDVYFSGNLIADPCELHVDSEDQIVDFRNVPSKTFMKY-PRSERERFSIWLTECDLSLGDTVTVTFMGTEDSAQPGLFAV---SGTASGIAIAVEDENGVPVKPNVPMRPA-ALRSGDTFLNFQAFISAVHSLVREGDFECVTTFLLEY. 174
300 5.000e-36gi|397163899|ref|ZP_10487357.1| fimbrial family protein [Enterobacter radicincitans DSM 16656]  clstr ali  21  1..MKNLKTTALASFVVLALSSISSVSAADGTINFTGEITDAGCNTSVNGSSATVDMGKVVKTSFKGVGSTASSTGFTIEMDDCPSTIT-SVTFKFDGQNENGDDTVLALTAGANSATGVGIQLYDKDRNVIQLAKASAPYTITNTGTNSLPFYAKYIQTQNTVTTGPANSVATFTVNY. 185
301 5.000e-36gi|159794884|pdb|2JMR|A Chain A, Nmr Structure Of The E. Coli Type 1 Pilus Subunit Fimf  clstr ali model  33  2...........................ADSTITIRGYVRDNGCSVAAESTNFTVDLMENAAKQFNNIGATTPVVPFRILLSPCGNAVS-AVKVGFTGVADSHNANLLALENTVSAASGLGIQLLNEQQNQIPLNAPSSAWTTLTPGKNTLNFYARLMATQVPVTAGHINATATFTLEY. 154
302 5.000e-36gi|365969643|ref|YP_004951204.1| protein FimG [Enterobacter cloacae EcWSU1]  clstr ali  24  4MKKTLAILILGLIA---------RAQADDIQIQMTGNIYANTCIIDSASRNLTVDLGQAVSGDFKNVGDTGAWKDFTLSVSHCPPTLA-LATAFFYGQADSTHPTKFANI---GSAKGLALELADQDNILIAPQAAFNVPVNSADHTATFPLAARYYASALPVTAGTFNSVVQVTFTY. 169
303 6.000e-36gi|398794513|ref|ZP_10554560.1| P pilus assembly protein, pilin FimA [Pantoea sp. YR343]  clstr ali  24  1..MKLNALAIATLIALGTTSASHAADQGSGTITFTGSIIEAPCSVSHENSDQTVDLGQVSNVSLANGGK-SQPRQFNIMLENCALXXXXXXXXXXXGPAGNSDR-----VGIAGTAKGASIAIVDGTYNLIKLGTPSVAQ-ALQDGNNNLSFAAYLQGDKDPIVPGEFQAVVNFGLNYL 176
304 6.000e-36gi|423122121|ref|ZP_17109805.1| hypothetical protein HMPREF9690_04127 [Klebsiella oxytoca 10-5246]  clstr ali  23  1MKTNNKMLLTLGVAALLPFGSALAAGTSGGTVNFNGSVVTSACAISANSANIDVNLGEVRTATLAAAGSESTAKAFSIVLEDCNPIPATTVAVTFTGTPDNADADSLAVNGSSASAQNVAIRLYDEQGNVVRLGEAAAP-VVLRSGSNTLNFSAKYYSPQGNATAGDASAVATYTVTY. 193
305 6.000e-36gi|311280581|ref|YP_003942812.1| fimbrial protein domain-containing protein [Enterobacter cloacae SCF1]  clstr ali  30  1..MLRMLALLMVLCATAPPAFAHRVVVDGGRVQMRGELVNGACAVAPESQSLRIDMGQYRTNTFAGVGSFSTTVPFTLKMVDCRTDISRLVGVTFQGLSPAEDPQVLAATQVSGAGSGLGLALFDNKQQMIIPNAPPVTYFPVTTGEMTLYFSARYRVISLPLTPGAITSDVWFTLIY. 180
306 7.000e-36gi|330817103|ref|YP_004360808.1| minor fimbrial subunit HifD [Burkholderia gladioli BSR3]  clstr ali  19  1..MNIKYFPLLMSXXXXXXXXXXXXXXSDGTINFTGSVVASTCKINGGTNDLTVPLPTAAASQLATVGATAGRTPFTLSLSGCTPAPVRKVSVAFEPGPNVNLATGRLVPTGENAATGVEIEILNDKYTPIKIGAESSTQGTGGTGTATLQFAAQYVATGDKVTGGPANSFVTYSLVY. 195
307 7.000e-36gi|283786572|ref|YP_003366437.1| fimbrial subunit FimF [Citrobacter rodentium ICC168]  clstr ali  26  16.....................AADAFAADSTITISGYVRDNACAVAGESKDFSVDLLNNAAKQFSTVGATSPTVPFRIVLSPCGSAVT-AVKVSFVGTADNDNSHLLKLDGGALAASGMGVQILNDRQTALPLNAAASPWTTLTPGKNTLNFYARLMATRVPVTPGHVNATATFTLE.. 173
308 7.000e-36gi|291326632|ref|ZP_06125223.2| fimbrial protein [Providencia rettgeri DSM 1131]  clstr ali  22  5.KMKLNKLALVLGLGLAVVAGSASANQGGGQVTFKGSIIDAPCSIPPGSQAFEVQMGAIATSALNGGGK-SIARDFNIQLEQCDITTLKTVQTTFTGIPSTSVTDGLAI---AGTAKNAGIVITDYNGTKIALGAKSPSQTLLT-GANTLRFQAYLQAANKPAVPGEFDAIATFALSY. 180
309 7.000e-36gi|270264496|ref|ZP_06192762.1| fimbrial protein [Serratia odorifera 4Rx13]  clstr ali  23  1MKK----LIILTTLCGTGYLFPAIATAADKEIDFFGTVVNRPCNIEPQSADQVVEMDTVIVKTLYRYGH-SNPVPFNIKLTDCKTAVFKSVNVTFSGTEDSELPGKLAINNGTNSA---AIALFDSKGTDIALNQATS-AVALQDGATVLNFTAYVQGQNKTITEGEFSSVANFVLAY. 174
310 7.000e-36gi|212711927|ref|ZP_03320055.1| hypothetical protein PROVALCAL_03002 [Providencia alcalifaciens DSM 30120]  clstr ali  26  10............ILGINLAMLTVPTVLASGVINFTGEITEQACTVDSKSRNLNVDLGRVSTRSLSSQGEVAGVTNFIIKLVDCPDDT--KVTVNFAGTRDSVDHHILALHQGNGMAKNVGVALYEKNATPIKLYENTKE-VELDGDSVELEYVAAYKATG-VATAGQANSSAVYSIKY. 172
311 8.000e-36gi|156934149|ref|YP_001438065.1| hypothetical protein ESA_01976 [Cronobacter sakazakii ATCC BAA-894]  clstr ali  26  1MKK----IVIAAGFAAIASMSATSAMAFDGTVKFTGEILDQACTVDIGTDNLTVDLGKVSKTAFTGVGTDASTTKFTIKLKDCPETVT-SAKVKFDGAPDTSDSDLLALDSAADAASGVAIKLMTADKTALPLHSVNDSYVLSSTSENNLDFYAAYRSTSATVTAGKANSVANFTVNY. 175
312 8.000e-36gi|422022472|ref|ZP_16368979.1| fimbrial major pilin protein [Providencia sneebia DSM 19967]  clstr ali  26  1MKK----IILATLISGAMSASALAVDAGQGTVTFEGSIIEAACGIAPESTDQTVNLGQVASAQLAGGG-MSRPVNFTIELVDCDTSISDTXEVTFTGGINPNLADSLAIQ---GTASGAGVVITGLDAVPVKLGSXSAGXIALQDGDNSLLFSAYLKGDSTTIVPGFFTALTNFTMQY. 171
313 8.000e-36gi|82545300|ref|YP_409247.1| fimbrial protein [Shigella boydii Sb227]  clstr ali  20  1..MSAFKKSLLVAGVAMILSNNVFADEGHGIVKFKGEVISAPCSIKPGDEDLTVNLGEVADTVLKSD-QKSLAEPFTIHLQDCGGTTYSKAKVTFTANTMTGQTDLLKNTKETGGATGVGVRILNSQSGEVTLGTPVVITFNNTNSYQELNFKVRMESPGKDATPGNVYAQADYKIE.. 181
314 8.000e-36gi|410085473|ref|ZP_11282192.1| major pilin protein FimA [Morganella morganii SC01]  clstr ali  25  1MKLNIIASVVXXXXXXXXXXXXDPVIVNGGTVHFTGELVNAACAVSTESSNQTVELGQYRTATLTGS-AMSTPVPFKIKLVDCDPTVATTAAVAFSGQSMAGDVNLLAVTSGTNAAQNVGIQISDATSAVLPPNGAFSAAKTLIQGTNVLDFTARYVAKGAT-TPGQANADATFVVKY. 180
315 8.000e-36gi|419368820|ref|ZP_13909949.1| fimbrial family protein [Escherichia coli DEC14A]  clstr ali  22  338.RRMRRALFSCFCGLLWISSGWAADPLGTININLHGNVVDFSCTVNTADIDKTVDLGRWPTTQLLNAGDTTALVPFSLRLEGCPPG---SVAILFTGTP-ASDTNLLALDDPA-MAQTIAIELRNSDRSRLALGAASPTEEVDANGNVTLNFFANYRALASGVRPGVAKADAIFMINY. 509
316 9.000e-36gi|422017186|ref|ZP_16363754.1| hypothetical protein OO9_00750 [Providencia alcalifaciens Dmel2]  clstr ali  22  23.........VFFSSILTSLLLCTSAFAADSTIIIKGNVKDNTCAVAPGSQNQVVDLLLNAVKQLHSVGEVTPTVPFRIELTPCGSAVT-AVKVGFVGIADLNNKSLLAIEPGSSNATGAGIQILDSAKNPLVLNADSNNVVLVAGKANTLNFNARLMASKLPVTAGHIRATATFTLE.. 192
317 9.000e-36gi|423111944|ref|ZP_17099638.1| hypothetical protein HMPREF9687_05189 [Klebsiella oxytoca 10-5243]  clstr ali  24  8....LRAYSAYIMLVVLATIPDRVSYAAGGQVNVTGNIIANTCTVLPADQEKSVSMGSVPVKQFTNGNGEASPTSFMLTFTDCASQVSG-ISVKFSGTPDSSNTELLSLDDDPSVASGIAIALLDSNRARIPLKTSTAAYPLPAGSTSTMKFYAQYVRNGLPLSAGKADATTSFTVTY. 181
318 1.000e-35gi|409427212|ref|ZP_11261735.1| P pilus assembly protein, pilin FimA [Pseudomonas sp. HYS]  clstr ali  24  1MNKRTLGFALSLPLLAGISL---HAQATDGQIEFTGSISGTTCTINPGGQNFTVPMSPAHTSEFSGAGSIAQPRTFEISLTNCAAGSSGQVDIEFLGGALVQN-GRLNMDAGPASATNVQYQLLNQQGGPIIIGGPTTIPVALEDGSATLRYTSQYYATAATVTPGAANSRVQYLIN.. 179
319 1.000e-35gi|146310073|ref|YP_001175147.1| fimbrial protein [Enterobacter sp. 638]  clstr ali  23  1MKRSFCTRVSFCALALLAAINVNEAQALDNNLHFSGTLVSEPCNLDPQTSDITVDFSSVVAKYLYQ-NSRTLGVPFVVNLTDCDISLGSKVTMTFKGSENSTLPGLLAV---TGTAKGIAIGMETPEGTKLPFNQPTPEY-AIANGSNQFTLQAYVQGEQQTITPGDFSATATFELAY. 180
320 1.000e-35gi|288549519|ref|ZP_05967299.2| fimbrial subunit type 1 [Enterobacter cancerogenus ATCC 35316]  clstr ali  26  1MQMKLSSVFRNMVAAAAVSGITFAAVAADGQINFTGTILDSACTIDTNTANQTVNLGKIPKSSFNAAGAVAAATRFSIVLNNCPAAVT-SASIKFDGNADSSDTSILALNSGQ-TAKGVGVAFYEEDGTAIPLATQSRSITLDTSNSNKMTFVAKYKATQAAVVAGTANATSDFTITY. 183
321 1.000e-35gi|423114407|ref|ZP_17102098.1| hypothetical protein HMPREF9689_02155 [Klebsiella oxytoca 10-5245]  clstr ali  25  1MKISKIASAVVLTM--GVASFAAQADQGSGKVTFWGSIIDAPCSIKNGYGDQRIELGQISNTHLDNGG-ISTPRPFDIELENCGDPMYNTVTVTFNGGNVPNDMTMLAI---TGQAAGAGVRIQDYSGTMVTLDKPTAGRI-LGIGDNTLSFSAYLEKIATNVTPGDFEAVTNFTLAY. 180
322 1.000e-35gi|188534984|ref|YP_001908781.1| minor fimbrial subunit, polypeptide (FimF) [Erwinia tasmaniensis Et1/99]  clstr ali  22  5...........VSILCLLSVFAGNTHAADSTITITGYLKDNACSVAVDSQNFTVDLMSNAGRQLYRPGAVTPAVPFTIVFDKCGSSAT-AVRVGYTGISDGDNATLLKLDAVSNAASGMGIQILDKDKDPVSLNSAQDTTTLTAGQANTLGFYARLMATRSPVTAGIVNATANFTLE.. 172
323 1.000e-35gi|293393810|ref|ZP_06638117.1| fimbrial protein MrfG [Serratia odorifera DSM 4582]  clstr ali  24  8MMRAKQTSSALLGVGIVLAGLMTQPAAADENMRFHGTLVAEPCVILPGEERIQLDFGTIVDKYLY-LNTRTHSQIFTLHLAECDLSLGNTVSVTFSGSENANLPGLLALDGGS-SASGIAIGLENRDGTALPLNSASDKY-RLAAGSNQIALQAYVQGENKTIGRGEFSATATFSLEY. 190
324 1.000e-35gi|296100461|ref|YP_003610607.1| P pilus assembly protein, pilin FimA [Enterobacter cloacae subsp. cloacae ATCC 13047]  clstr ali  22  8.............FSIALLIFTFPVRSYDVLVSVTGNLIGNTCVVAADSKEQDVPLGTIGIKQFPRAGAVSNKTPFTIRLEACGPTFAG-VKIRFSGTPDNDNPQLVKI--ADGGATGVAVQILDKDGGLIPLDTQTTARGTPGDDSVEMTFYARLAATGAPVNAGDVSAFATWTTEY. 170
325 1.000e-35gi|410085467|ref|ZP_11282186.1| Fimbrial subunit [Morganella morganii SC01]  clstr ali  23  7.KFSGTGNIKGILAFILAAVFSPAAVSDIGSINMKANLVSNACTITPGTMNQTVDLGTWAVKQFQETPRGVPPKQFFIELIDCGH-LASGVKVKFSGTVDPVNNTLFKLDAAS-TATNIGISVLDRNKDVIKPNTETIVYPLRPDATNILVFYAQYVATANSVGAGTANSQATFTLEYL 185
326 1.000e-35gi|30524677|emb|CAC85333.1| PixA protein [Escherichia coli]  clstr ali  21  2.....LKSTLGIAIAFSLCAVAHAANQGQGVVNFKGTVIDAPCGIDPDSADQTIDFGQISKSHLDADG-ISVKKDLNIKLVNCEP--NKSVKVTFSGATIASAANELGTVGDTGTA----VVISGQDGKLVSFGTEGSAQ-SLQEGENTLHYSSWVKATGGTVKEGDFTAVANFNLSY. 167
327 1.000e-35gi|188534988|ref|YP_001908785.1| type-1 fimbrial protein, FimA [Erwinia tasmaniensis Et1/99]  clstr ali  23  22.KIRFINSLIAASLLTAGMAHAATTTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVKTATLSEAGKTSSAVGFNIQLNDCDTSVATKAAIAFSGTAGGDNTTALALSSSAGGATNVGVQVLDSAGKALAFGATFSTAATLSDGTNTLPFQARYIATG................... 183
328 1.000e-35gi|422016537|ref|ZP_16363120.1| fimbrial protein [Providencia burhodogranariea DSM 19968]  clstr ali  25  1..MKKKATYKVASLGFFALMMASTMMDAQGSVQMQGSIIETACAIDVGSRDQTIDMGSLALTQIHRDGQ-GPVRPFVIRLVNCDKPNWQYFRVTFDGPHDHG------LFGVNGQAKGVGLQIQRDDDGEIALPGQVMSVQTLTRGTRDLTYQLRLVANHDALAAGQYYSQLRFKLDY. 176
329 1.000e-35Oral.Meta HOMD esak_c_1_17026 Cronobacter sakazakii ATCC BAA-894 [2749152 - 2748433] Fimbrin-like protein fimI Flags: Precursor  ali  19  63.MMQLTKGGCGVIAVLAALCASEAALANSQTITFNGKVLDAACTVTVGDGSSTVELGETVKSDLVNKGDTGAPKLFTITLSSCPAGSPAKANIKFNGETDGDDS-YFKNIATTDAATNVGVLLKQYGTDTVYVNDGNTDITLPAGGDVTVDYTAQLVATGTGVTKGNVVSTLTYSISY. 239
330 2.000e-35gi|422014787|ref|ZP_16361396.1| fimbrial subunit [Providencia burhodogranariea DSM 19968]  clstr ali  21  1.................MLSFLSKADIGQINLVMKANLVSNACTISPETVNQTVNLGTWATRQFKETYKGVPPKRFIINLIDCGPAATG-LKVTFSGVVDPNNNMLLKLDAAS-TATNLGISILDRNRNMIKPGVETIIYPVRANSTNILEFYAQYVATNKNVTAGTANSQATFVLEYL 161
331 2.000e-35gi|261341383|ref|ZP_05969241.1| fimbrial protein [Enterobacter cancerogenus ATCC 35316]  clstr ali  24  15.......................SAHADDINLQITGHIYANTCVVDSASRNLTVDLGQATATSFKSVGDTGEWKEFSLKVSHCPSSLTLS-NAFFYGQPDSVHPTKFAN---TGSAKGLALELADQDNILISPQASFNVVINKSDHTAEFPLAARYYATSTPVSAGTFNSVVQVTFTY. 166
332 2.000e-35gi|268592411|ref|ZP_06126632.1| fimbrial protein [Providencia rettgeri DSM 1131]  clstr ali  25  1MKK-----VFLAALVSAAIASPALADQGHGKVTFKGEIIDAPCSISSDSIDQTVWLGQIANSVLANGG-TSSAKQFNIELEDCDKVYNDKVSITFSGSSAAFNSKLLGVTGLDATAGNVGIQLTDTNGAALDMGVATAQEHQLQAGDNTLRYSAYVQGANVAVDKGKFEGVTNFTLTY. 186
333 2.000e-35gi|1232058|gb|AAA92618.1| major fimbrial subunit protein [Escherichia coli]  clstr ali  22  6...........FILGILAAASSSATLAYDGTITFNGKVVDQTCSVTTESKNLTVTLPTVSSNSLTSNGEVAGLTPFTISLEGCTSPASENVKAYFEPNATTDDSHNLNIASGSGNATNVQIQLLNADGTPILLGTDSATPVAINGTNVTLRYNARYYATGQA-TAGNVSATVNYTIAY. 180
334 2.000e-35gi|317493889|ref|ZP_07952306.1| fimbrial protein [Enterobacteriaceae bacterium 9_2_54FAA]  clstr ali  25  10..........AAIFLLLSGPIYAQTELIGGDMRFHGTVEALPCSVKPGGDKIGVNFKQISTKDLYS-NKTSPPVPFTIPLENCSDAVFKTVSVTFSGIESTELPNHLIINPVSSSASGVAIGLKESNGSAIELNKPTT-AENIANGSMDLTFQAWVAGENGDITLGPFTATANYTLTY. 181
335 2.000e-35gi|401763210|ref|YP_006578217.1| fimbrial protein [Enterobacter cloacae subsp. cloacae ENHKU01]  clstr ali  23  5.........VAAVALITTLGMVSAAQADDGQVNFTGNIIEQGCKIDTTTAPQTVKLGDIAKTALPEAGSVAANTRFTLKLSECPADLGKAVVVKYTGKPDATNNDYLEVTGTTGVAKGVAIQLLNGDGTALPLATASKAATIDATGTATMNFSAQYIATAATVEAGSANGTANFTLAY. 178
336 2.000e-35gi|375262043|ref|YP_005021213.1| fimbrial protein domain-containing protein [Klebsiella oxytoca KCTC 1686]  clstr ali  23  1MKKT-----LLAAVVAGCAAFSGAALADDGQVKFIGDIIDAGCDVVNDSNPLEVQMGQIAKTAFSGTGSTAAEQNFAIKLENCPTTVTK-ASVLFSGANVNGDNDKLQLTGAGTVAEGVALQLVDASNATLPLYTRSASLTIPATGNIDLPFRVRYIQTESTIVAGKADGTANFTISY. 177
337 2.000e-35gi|157148538|ref|YP_001455857.1| hypothetical protein CKO_04365 [Citrobacter koseri ATCC BAA-895]  clstr ali  24  1...MKINTFAIFIPAIFMVSSAHAVEGETSSVVFTGNIVEATCELSSGSRSKAVELGDVATTAFAGAGSTTAPKDFTIDLENCGESAG-SASVTFSGD-VLADGEDETLNTSGFATTGVGIQIL-ENGTPLKLGSQASSAKPLDEGNNVLPFSARYISTLAITQAGEANAVANFTLNY. 174
338 2.000e-35gi|333925988|ref|YP_004499567.1| fimbrial protein domain-containing protein [Serratia sp. AS12]  clstr ali  27  8.....LKFSILTCCMIAGLTTINMGYAASALVNITGNIQNNTCNVSVDSIGRVVNLGVYSARQFNIVGEKTVPVGFDISLVNCGNAV-RSVDITFEGVADNQNPALVKIDSHTGT-KGLGIQLLDNNKNELALNTPFN--TPLTPGDQTFKFYAQLKSTDIPVTAGDVDAVVNFVLNY. 176
339 2.000e-35gi|53721129|ref|YP_110114.1| fimbrial protein [Burkholderia pseudomallei K96243]  clstr ali  18  1MKKKVVSFAVATLFGLVAAQSVYAQSIDQGQVKFTGELTANTCTIDAGSKDQIVPLPKVSTSALAAPGDVAGSTAFEIKVSKCAADVKKVAAHFEMENMDPNTRTLKNEATGTDAATNVTIQLVNSDGTELPVGSTGSYFDVTGTDDATMIYGGQYYAL-DTTTAGKVESHTLFTLAY. 180
340 2.000e-35gi|238793226|ref|ZP_04636853.1| fimbrial subunit type 1 [Yersinia intermedia ATCC 29909]  clstr ali  27  1MKSKLIALSIMIVSGSTLSV----ANAADGTINFTGNIIDPACTVNPASASQTIALGTVSSNALATSGATAAPTAFSIALTDC--AVAGNVSVKFDGTHNTSNPDLLAITSGAGVATNVGIALYEQDGTQIPLNTASAAKPIVPTGTATLNYIAKYMATGQS-TAGIADGVTQFSVIY. 175
341 3.000e-35gi|183597903|ref|ZP_02959396.1| hypothetical protein PROSTU_01239 [Providencia stuartii ATCC 25827]  clstr ali  25  1MKK----IILATLISGAMSASALAGDAGSGTVTFNGSIIEAPCSIAPGNENQTVELGQVSNVTLAAGGE-SSAQPFSIKLEGCNLENNNQVTVIFSGAAVDGEAANTGLLQISGDAAGAAVKIMNSSNTQIKINDNDGYTRNYVQGNNELKFQAALKGLGATVVPGNFSAVTNFTLAY. 177
342 3.000e-35gi|387905917|ref|YP_006336254.1| fimbrial protein [Burkholderia sp. KJ006]  clstr ali  21  4.......IAFAMSLFGLACAAANTAHAADGTVNFTGSIVASTCQIEPGTNNQVVNLPRVSTSQLGSVGATVGRTPFVFLVSGCTSAPAKKVSVAFEPGPNVDLSTGRLNLTGADAAGGVQIQILNDKYEPILVGAPATVNVNTDSGRAALVFSAQYIATSATVTGGSANSYVTYSLVY. 188
343 3.000e-35gi|283786568|ref|YP_003366433.1| fimbrial major subunit FimA [Citrobacter rodentium ICC168]  clstr ali  27  1MKIKALAVAMSALSLTSAAAFADTTTVNGGTVHFKGEVVNAACAVDADSADQTVRLGQVRAAKLATAGSTSSAVGFNIQLNDCDTSVSTKASVAFSGAADADNSTVLALQSSAGGATNVGVQILDRTGTPLALGATFSAATTLNDGTSFIPLQARYYATGAATAG-IANADATFKVQY. 181
344 3.000e-35gi|218549719|ref|YP_002383510.1| fimbrial-like adhesin protein [Escherichia fergusonii ATCC 35469]  clstr ali  19  1..MFKGKTLIATAITLLLASTAYAADEGSGEIHFKGEVIEAPCEISQNDIDKQVELGQVSTNHINQA-HHSDAIAVDIHLIHCDLENSNKVSVTFDSSAKTTNADPILSNTSTGEATGVGVRLMNKNQSNITLGTATPDIELIPASTQTLNFFAWMEQLATPVTPGAVTANATYVLEY. 186
345 3.000e-35gi|283834158|ref|ZP_06353899.1| putative fimbrial protein [Citrobacter youngae ATCC 29220]  clstr ali  22  4.KQTPAAWALLAIVPMLTFSALCQAASSLGEINIRGNVVDFTCAAIASDSNKTVDLGTWPTKQLQTSGDTTQPVSFTLKLEGCPPG---SASITFSGTPAPG-TTLLALDNSV-MAQKVAIELRDSDRTRLPLEQASQAVSIDENGNATLTFFANYIALADGVQPGVARADATFMINY. 177
346 3.000e-35gi|419916177|ref|ZP_14434508.1| PixA protein [Escherichia coli KD1]  clstr ali  19  2.....LKSTLGIAIAFSLCAVAHAANQGQGVVNFKGTVIDAPCGIDPDSADQTIDFGQISKSHLNSNG-ISVKKDLNIKLVNCDLSAKKTVQVTFNGATVNGHKDELGTAGDTGTA----VVISGQDGKLISFGTPGTAQ-NLKDGENTLHYSSWVKASDGTVKEGAFTAVADFNLSY. 172
347 4.000e-35gi|403051343|ref|ZP_10905827.1| fimbrial-like adhesin protein SfmF [Acinetobacter bereziniae LMG 1003]  clstr ali  19  1.MKNIVAFMVIFCSSIHQHSNAQDSSVELGRVNISGNVTTVTCGVLNSEQDKYIHLGTIATKDLPSVGSQSKAIPIPFEMSNCPP--NGSVTITFEGVRDSDNAELLAIDDLVNKAENIAIEIRDQNKKRLALGKKSEEFIVDSNGKVSTLFYANYIVTKAQAKAGLANANAQFSIEY. 177
348 4.000e-35gi|218691710|ref|YP_002399922.1| putative minor fimbrial subunit AufD [Escherichia coli ED1a]  clstr ali  23  12MNLIFSKYSVFFILFVFFAFPLSGQANDSVVVTFTGILLAKSCDITTGSKDQSVKMGTYDANEFLNVGDVSPSQTFTINVQGCPTSSGVSANVRFTGDADAINSALLRLSAGADSATGLGIEILDNNDVAIAINGESGDLVLNENGDANLTFKLRYKSTQENVHAGQANALLYFDIDY. 197
349 4.000e-35gi|218704036|ref|YP_002411555.1| putative fimbrial-like adhesin protein [Escherichia coli UMN026]  clstr ali  16  30.MFKGQKTLAALAVSLLFTAPVYAADEGSGEIHFKGEVIEAPCEIHQDDIDKEVELGQVTTSHINQS-HHSDAVAVDLRLVNCDLENSNKVAVTFDSSAKTTGADPILNNTSTGEATGVGVRLMNKDQSNIVLGTATPDIDLAPTSSQTLNFFAWMEQIATPVTPGAVTANATYVLDY. 216
350 5.000e-35gi|261341721|ref|ZP_05969579.1| hypothetical protein ENTCAN_08194 [Enterobacter cancerogenus ATCC 35316]  clstr ali  26  1MKFTKKTVLAIAAMALLPAGNALAVGTSGGTVNFNGSVVTSACAISAGSANIDVDMGEVRTATLAAAGSESTAKAFSITLEDCNPIAATTIAVTFTGTPDSADAHSLAVNGSANSAQNVAIRLYDERGNIVRLGEA-AAAVPLRAGPNVLNFSAKYISPEGHATAGDASATATYTVTY. 193
351 5.000e-35gi|421484430|ref|ZP_15931999.1| fimbrial protein [Achromobacter piechaudii HLE]  clstr ali  22  1MKKNQLARLIASIAFGTACTAAFAADKPNGEIRFEGSIVEAPCSIASDSVNQTVRMDQIASAELKG-GKKSTPKSFKINLLGCDLTAKKSVTATFTSTPSDAYDGLVAIQ---GAARGASLGIADGRGELIKMGHESS-ATKISTATPSMEFQAFLQGEQATLVPGEFHAAVNFTLTY. 185
352 5.000e-35gi|423204607|ref|ZP_17191163.1| hypothetical protein HMPREF1168_00798 [Aeromonas veronii AMC34]  clstr ali  28  1MKKAIVASVLLAVFSGASSATPAATDQGHGVIKFIGAIVDAPCSIAPESVDQTINMGQISNSVLEHQGE-GPLRPFDIHLEGCSLDTAKTAAITFNGIPDDTEKKHLAIN---GFAKGAAIAISQLDGSEVVLGTPTKAAT-LVEGDNHLKFGAKLVSNGGKAIPGEFSATTDFIMTY. 183
353 5.000e-35gi|365837598|ref|ZP_09378962.1| fimbrial protein [Hafnia alvei ATCC 51873]  clstr ali  25  15..KSTLTVMALYVLLLTGFSNSAHADPGIGQVQLTGTIIDVGCDVST-SASQSINLGSFEAGIFSSSGTVTNKQTFNIVLKECSANIKGSA-VSFSGTSDANDATLLALTNSGTQAKGVAIQLLDNTDSPIAINSTTSVY-PLNSGDNSLQFGLRYKSTLASVVAGDANAVLYFDMNY. 187
354 6.000e-35gi|53719254|ref|YP_108240.1| fimbrial subunit type 1 [Burkholderia pseudomallei K96243]  clstr ali  25  1MKAKGMQYGLTAVLLSMLSGAAYSQTATTGTINFTGSITDVPCEIDTAATSSNVTMAKVFANDFSGVGSTTGTTAFKIVLKNCGASTSG-ATVRFMGTTDSANPA--ALQTTAGGAGGVALQLVDDTGTPISIGSSSKAYT-IAEGDNTFNFAARYIATSATVTGGAANATAVFALTY. 175
355 6.000e-35gi|172064651|ref|YP_001812301.1| fimbrial protein [Burkholderia ambifaria MC40-6]  clstr ali  21  4.KKVTLLSAAVGAAFVGVFSLSAPAHAADGTITFNGKVTAATCTVQAGKGDLTVQMPTVSVSAFKADGDVAGSKPFTISFSGC-TGDASTVKVGFESGANVDPVTGRLKLNGADAAKNLQLGLYNGDSSKITIGDSATVGVSLASGSGTVLYMAKYVQTGATVKAGNANTSVTYSLIY. 181
356 6.000e-35gi|16128694|ref|NP_415247.1| predicted fimbrial-like adhesin protein [Escherichia coli str. K-12 substr. MG1655]  clstr ali  16  1.MFKGQKTLAALAVSLLFTAPVYAADEGSGEIHFKGEVIEAPCEIHPEDIDKNIDLGQVTTTHINRE-HHSNKVAVDIRLINCDLPASSKVGVTFDSTAKTTGATPLLSNTSAGEATGVGVRLMDKNDGNIVLGSAAPDLDLDASSSQTLNFFAWMEQIDNAVTAGEVTANATYVLDY. 187
357 6.000e-35gi|429095626|ref|ZP_19157732.1| Putative fimbrial-like protein [Cronobacter dublinensis 582]  clstr ali  24  1MKKHLCLMMFA----GXXXXXXXXXXXXDGTIKFTGSISENGCEFDGDSKTLDIDLGAYSAKQFKTVGVKSPPTPIVIKLKNCPIGENPHFTIYLTGDADPTNKDYLKV--AAGGATGVAIVIADDQNKVIPMNQFTERKYELTSTTMDLKLSAWYESTSTIIGAGAANGTTDITFDY. 176
358 6.000e-35gi|395235918|ref|ZP_10414118.1| type-1 fimbrial protein subunit A [Enterobacter sp. Ag1]  clstr ali  25  1MKLSKIASSLIATVALVSSAANAAVTVNGGTVHFQGELVNAACAVSTQSDGQIVKLGQYRTAAFTKVGDTSSQIPFNIVLTDCDSTVAATASVAFTGQTDATDPTLLAVNGNATTAKGVGIEILDRTSKTLPNGSTFSTAQTLNDGENTIPFTARYKXXXXXXXXXXXXXXXXFVMKY. 183
359 6.000e-35gi|359795494|ref|ZP_09298113.1| type-1 fimbrial protein [Achromobacter arsenitoxydans SY8]  clstr ali  29  1MKK----LVLNTLIASTLVAVAGIASADTGNISFQGEITTSPCSIGGGGSDMVVSMGSISTNYFAAVGDKGPQSPFSIALLNCDTEIMHTAAISFRAGAGSVVNTRLLGLENGSGAQGVAVGLVDERGNEVVVGGAGVSYT-LAEGTNIINFKAFYESTAATVTAGPANARAVFEVTY. 175
360 7.000e-35gi|423142824|ref|ZP_17130462.1| fimbrial protein [Salmonella enterica subsp. houtenae str. ATCC BAA-1581]  clstr ali  23  1MGKVKLFVAICMAGSVGTAWAAAPADFGHGTLHFTGSVINSPCSIAPGDENIDVPLGQVANKVLEAGAGYSTVQPITIHLQNCDLTAQNKVSVTFAGSPDAKNADLYAN---TGTAQGVGVRLMDAGNVPLKANDASSDY-ALTSGDNELKFGARLEKNGDAVTTGTIVTDVTYAMNY. 193
361 9.000e-35gi|421491769|ref|ZP_15939132.1| MRPG [Morganella morganii subsp. morganii KT]  clstr ali  19  1MNETIRRFFISTCGVFLLSLPGADAGAVPDNLYFHGTLVDEPCTIHPGDETVELPFGNIPDKNLYAY-QRTPSKDFRIRLSECDTSIGRRVTVMFAGDENPFISGALAISPGSQ-AEGIAVGLENADGTALAVNEVS-PQITLNDGLTLLNFRAYVQGENKTIKRGPFSAIATFHLNY. 180
362 9.000e-35gi|417447895|ref|ZP_12162535.1| Fimbriae-like adhesin SfmA [Salmonella enterica subsp. enterica serovar Montevideo str. S5-403]  clstr ali  26  5...........ILYGIGMLLAASGVQAHDGRVYVSGTITDNTCSLSPDSENINVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTASG-VTVSFSGAGDSRNTDLLALTAGESDASGIGIALYDQNKTLIPLGQESDVVTLSPGQSAHLQFYA......................... 147
363 9.000e-35gi|22127933|ref|NP_671356.1| fimbrial protein [Yersinia pestis KIM10+]  clstr ali  26  30MSNVKKSTFIIALATLSVIYQALAADAGNGRIKFTGTVINAPCSIALDSTDINVDLGQVANRVLETGNKYSQSVRYNINLQDCSLTAQSKVNVTFSGIADAAAPALLAN---TGSAKGVGVRLIGTDDALLKVGDTS-PDINLTSGPNQIVFSARIEATSAPVTTGTVVSQATYALNY. 213
364 9.000e-35gi|317493894|ref|ZP_07952311.1| fimbrial protein [Enterobacteriaceae bacterium 9_2_54FAA]  clstr ali  19  1..MFIRSWLYIAIGVIPILAHAQTGNITPGSLSMKGELIEAACVIDPLYREQWIEFGNISARDIAQGSGVLLTKNFNIKLTGCPGSYYHSANVTFTGIPDSSDNQLLAID---GEARGFAIQLADTHGEILTLGKNTPDY-ALMDGDNILNFSASLVSTGRNIRAGDFYATARFFMDYL 180
365 9.000e-35gi|422020774|ref|ZP_16367302.1| hypothetical protein OO9_18761 [Providencia alcalifaciens Dmel2]  clstr ali  23  1MKKTILSTLIFSAMGT----SAMDVDAGSGTVIFSGSIIEAPCSIAPGEENQEVPLGQVSNMILDN-GDELSAQPFQIKLEGCNLKGDNQVAVTFKGTDAGKNTGYIQITGDTSGA---AVKIMNASGSHIKIN--SSAKQNYVEGSNTLRFQASLIGVQQPVKPGKFQAMTNFTLAY. 176
366 9.000e-35gi|322831116|ref|YP_004211143.1| fimbrial protein domain-containing protein [Rahnella sp. Y9602]  clstr ali  26  5...KRKTLVIALSAFISASAFATGADQGSGRIHFTGTVINAPCSIAAGDEDINVNMGQVANKVLESGNKYSQNVNYTIHLQDCDLTAQSKVAVSFAGTPDSSAAELLAN---TGSAKGAGIRLIDANGDLLKVGDTSKD-INLVTGNNELVFAARVEANSQPVSTGTIVSQATYALNY. 191
367 9.000e-35gi|422015456|ref|ZP_16362054.1| fimbrial protein domain-containing protein [Providencia burhodogranariea DSM 19968]  clstr ali  27  1MKLSKIALVTIIASSFAAGIANAAVDQGSGVINFTGKVINAPCSI-PGDGTINVDLGQVANKVLESGNKFSQSVQYTIALENCDLAAATKVKVTFSGTPDTTKTELLAN---TGTSKGVGVRLINADGAVMKVGDTS-VDLPLVEGPNKLSFSARVEANGNAVETGSIISQATYALNYL 189
368 1.000e-34gi|295097592|emb|CBK86682.1| P pilus assembly protein, pilin FimA [Enterobacter cloacae subsp. cloacae NCTC 9394]  clstr ali  24  1..MTISWKNTVWLSVALLNPPLVKADDTSFNVQFIGTIVGESCNVDTNSAEQTIDLGEFTTEEFPRVGATTPEKQFAITLKNCTRAIGGT-TVWFTGDADANDPTLLALDTGKGTATGLAVELLDSARASVPINNTESPLYPLLPGDNTLTFFLRYKSTLPTVTTGNATAVMYFDLLY. 180
369 1.000e-34gi|188532804|ref|YP_001906601.1| fimbrial protein [Erwinia tasmaniensis Et1/99]  clstr ali  27  1MKKSLLSVASVALVLAAVNAQAESVNNPGGNISFLGSLVASTCVIDSGDQSKSVTLGQYATSIFKNIGDQTPDVPFTIRLTGC-AKAANNYGLRFEGTTVNSSPNLLALKSTSDL--GVGIEILGAGDKVINLNQPADDTTWQAAQAATFNLKAHYKSFAQKVSSGDAASNVKFVIAY. 181
370 1.000e-34gi|345297387|ref|YP_004826745.1| fimbrial protein domain-containing protein [Enterobacter asburiae LF7a]  clstr ali  22  1...MLKKTLLATVVTSLFAFNASAADEGHGVVNFTGTVISSPCSVIPGDDKIDVDLGQVADDVLNSTND-ATSAEFKIHLQDCGGTTIDKVKVTFTSANDSTDSSLMTNTASSNSATGVGVRILDASDKKISLNSATTVTFPNTDANQELTFRARMEKTGGTVAPGNVYAQANYVLSY. 180
371 1.000e-34gi|238023627|ref|YP_002907859.1| Fimbrial protein [Burkholderia glumae BGR1]  clstr ali  20  1MKSKYKKITIALAGLFVLSSTYGQTAPGTGRITFNGELTANTCSINGGDVDQTVQLPKVSTSSLSTAGAIAGSRMFQIRVEKCAADVTNIAAHFETFNIDAATGNARNVADAAGAAKNVTVQLVDGDGTAVKLGDAGKYVAVSGTGDARLDYGGQYYATGAT-TAGIVQAVVKYTIAY. 181
372 1.000e-34gi|197284434|ref|YP_002150306.1| major fimbrial subunit [Proteus mirabilis HI4320]  clstr ali  19  1MKRKVIALATILSAAFAGSS-----MAYDGTITFTGKVVDQTCSVDTQSKNLAVILPTVSVATLNNVATTAGLTPFTIKLTGCDKDGAKNVKVYFEPSADTDLTTNLKNTATGTKANNVQVQLLNSDATTIQLGTDVNSQVQIDNADVNLPYFAQYYATGSS-TAGDVKATVHYTIAY. 180
373 1.000e-34gi|308189036|ref|YP_003933167.1| Fimbrin-like protein fimI precursor [Pantoea vagans C9-1]  clstr ali  21  7...........LVCIVLFFAGSLPVRGYDVLVSVTGNLIANTCVVAADSLEKNVPLGDIGTRQLSKAGAVSNKTPFTLTLEACGPTFSG-VKIRFSGTPDEIDPRLIKV--AEGGATGVAVQILDQEGALVPLDTQTTAYGVAGNDSVQMNFYARLTATGPEVTAGGVSAIATWTTEY. 171
374 1.000e-34gi|188532559|ref|YP_001906356.1| major fimbrial subunit MrfA [Erwinia tasmaniensis Et1/99]  clstr ali  23  1MKLNKLS-AVLGLGFVLASGAAFAADQGHGTVTFKGSIIDSPCSITPETANQTVDMGQISNKALQNTGK-STARPFYIKLENCDVSTNKTVTTTFTGTASKAQPKNLALV---GQASGAALVITNGDGAAIDLGSASLP-TSVQTGNNTLSYAAYLQGDSAAVVPGDFSSVANFTLAY. 176
375 1.000e-34gi|398879114|ref|ZP_10634216.1| P pilus assembly protein, pilin FimA [Pseudomonas sp. GM67]  clstr ali  23  1MVKNICKCTALCGSSLLILMAAVSAQASDGQVEFTGSINDNACTISTENVKKSVDLGQVRVGDFANVGATAGSVPFSISLENCSSATLKNAAITFRGQQSSSDPTILGMTGANQVA-GVGIQINDATGAKLPLNTASTDYV-LRPQSNTFDFTASYVADGKPIGTGQVNALASFDVTY. 190
376 2.000e-34gi|403051359|ref|ZP_10905843.1| type-1 fimbrial protein subunit A [Acinetobacter bereziniae LMG 1003]  clstr ali  25  1MKFSTLGLIAISTLGVSASALAAAVEVKGGTVNFKGDLVNAACAVSTSSTNQTVTLGQIRTASFTKAGDKTTAVPFEIKLVDCDTAVQATAAVAFQGNAVGGTAGVSAADANGTAAKNVGIEIADHTAKVLGLGADYSTAKTLITGDNTLQFSARYVATDAATTPGQANANATFTVKY. 184
377 2.000e-34gi|365837593|ref|ZP_09378957.1| fimbrial protein [Hafnia alvei ATCC 51873]  clstr ali  21  14......LVFLAATGSAFAASGSTAQTVQGGTINFTGSVVDAACAVDVNSESQNISLGQVRLAELDSKGATSAEVPVKIQLDDCDSSVATTASFGFNGQTDENDPTSLNNTSTAGAAKGVGVQMKDSVSGIVPFDGSFGDGSKLTDGTNVASFSAYMIATSDTPTAGAVASAVNFNIKY. 188
378 2.000e-34gi|375258220|ref|YP_005017390.1| fimbrial protein BcfF [Klebsiella oxytoca KCTC 1686]  clstr ali  26  21............................DGTVNITGTIQGNTCTVTTDTANQQVTLGDIAAKQFTAAGSASQPVAFTIGLENCG-SAASAVSLTFTGEADTTNSALLALTSQAGSAAGVGVAILDSQRTLVPLNSTSRQYTLDPQQTQNLTFYGEMVATSSPVTAGSVDATTTFSLTY. 170
379 2.000e-34gi|345298446|ref|YP_004827804.1| fimbrial protein domain-containing protein [Enterobacter asburiae LF7a]  clstr ali  22  1..MKKIILFVAM-------GVMAQANADDIQVQMVGNIYANTCVIDSASKNLTVDLGQAASSNFKDVGDTGEWKDFSLSVSHCPKTLT-LATAFFYGQADSVHPTKFANV---GSAKGLALELADQDKILIAPQASFSALINPSAHTATFPLAARYYATSMPVSAGTFSSLVQVTFTY. 166
380 2.000e-34gi|300716397|ref|YP_003741200.1| major fimbrial subunit [Erwinia billingiae Eb661]  clstr ali  22  8...........LIALLAGSAFVCVAQAADGSVNFTGNIIDNTCAVSTGSKTVTVPLGDVQATAFSGVGSTASPTNFSILLEACPVAIT-TAAVKFDGPKDPINSELLQLTENAGAADGVAVGIYEQDTTTLIP-IASKSKNEDVATTATFNFVAKYVATKATIRPGTAGAVSEFTITY. 173
381 2.000e-34gi|288550414|ref|ZP_05970336.2| type-1 fimbrial protein, A chain [Enterobacter cancerogenus ATCC 35316]  clstr ali  21  1MKKDIKKALLAVSMATIISGSAFADEQGSGKIKFKGVVINAPCSIAPDSVDKEVDLGEV-TTAMINANRKSAPVAVDINLQNCSATPITKVDVKFTSTATNAADTSLMANTYADGAQNVGVRLLDDAEAKITLGSPKEVVLQTGSDTQVLHFKAQMVPTGATATAGQVEATANYVLQY. 191
382 2.000e-34gi|365835990|ref|ZP_09377398.1| putative PRS fimbrial major pilin protein [Hafnia alvei ATCC 51873]  clstr ali  25  5MKLNKLAVALVMTMGIASAAANAATVGGNGTVKFHGFIVDAACSIAPGNSEQTVDLGSIAIKALK-DGAKSTPANFKIVLDNCDGGAAPKASITFNGSNAGGSSNLLGIT--SSTASGVGVGIADANGKDFELGKETEVKTLIS-GTNELDFTAYVQATGASITAGEFNSQTDFVISY. 184
383 2.000e-34gi|317491335|ref|ZP_07949771.1| fimbrial protein [Enterobacteriaceae bacterium 9_2_54FAA]  clstr ali  19  1MFKKTLLAGITGVVLSGVVFNASAANQGSGKITFTGEVIEAPCSIKPGDEDLKVNLGEVATNVLNST-QQSLAEDFTIHLQDCILTVTDKVKITFTPNTDTTDTSLMANTGNIGAASNVGVRILDSGNNKLTLGSAVTVTFPDSSSYQELNFKARMEKIGTTVTPGNVQAQANYMLDY. 190
384 2.000e-34gi|296100464|ref|YP_003610610.1| fimbrial protein FimI [Enterobacter cloacae subsp. cloacae ATCC 13047]  clstr ali  26  1MKFKTKTLLAVAVAAVLPAGSAFAATTSGGTVNFSGKVVTSACAISAGSANIDVDMGEVRTATLAAAGSESTAKAFSITLEDCNPIAATTVAVTFTGTPDAADANSLAVNGGANSAQHVAIRLYDEQGKVVKLGEP-AAAIPLRAGANTLNFSAKYYSPQGNATAGDASAVATYTVTY. 193
385 2.000e-34gi|146310649|ref|YP_001175723.1| fimbrial protein [Enterobacter sp. 638]  clstr ali  26  1..MTRLRQLFLLLLSVVTPVMAHTVVVDGGKVHMKGELVNGGCAVAPDSQNLRIEMGQYRTNSFAGVGSFSTNVPFILRLVECSVDVSRTVGVMFEGVTPTEDPQVFLATSQPGESSGVGLALFDSQKRQIIPNAAANNWRPIESSELDLHFSARYRVISEHLVPGNIQSDVWFALIY. 180
386 2.000e-34gi|401765242|ref|YP_006580249.1| fimbrial-like protein [Enterobacter cloacae subsp. cloacae ENHKU01]  clstr ali  19  5.....KKALLAVAMATIVSGSAFAADQGSGKIKFKGVVIDAPCSIAPDSVDKEVDLGEVTTAVI-NANKKSTPVAVDINLQNCTATPITKVEVTFSSTATYASDTSLLSNTYASGAENVGVRLLDNDEANITLGSAKTVDLLPNSDTQTLHFKARMVPTGTTATAGQVEANANYVLMY. 185
387 3.000e-34gi|261339544|ref|ZP_05967402.1| fimbrial subunit type 1 [Enterobacter cancerogenus ATCC 35316]  clstr ali  27  24........................VFAAAGTVNFAGNILDSACDVDVASQNQVVVLGDYYKTEFTATGARTAATKFNIVLKNCPVTVT-SAKVRFDGTPDISNSNLLAIDSSAGAATGIAINLMTADKADLPLGTNGYTYMLSSTADNTLDFYAQYISTAATVVAGPANSVANFSVVY. 178
388 3.000e-34gi|304397360|ref|ZP_07379238.1| Fimbrial protein [Pantoea sp. aB]  clstr ali  22  1MKKVILASLLPVLMAGSFASYAAAISIDGGKINFTGAVVAAPCAVDNSTNGQNVPLGQIATNQLPKKGSTGSAVPFSIKLIGCDLSPQTKASITFTGPTVDATTQVTANGAGQQPAKNVGIQIMQANKAVHVDGTASTEASNILVGENEIPFTATYVATAETVTAGAANSSVNFTVNY. 195
389 3.000e-34gi|375257411|ref|YP_005016581.1| putative fimbrial protein [Klebsiella oxytoca KCTC 1686]  clstr ali  21  1MFKKTLLAVATTAVFSATVFNASAEDQGHGIVTFSGTVITSPCSVTPESAQIDVDLGQVADSVLNG-GQYSQPADFSIKLRDCVKTTTDKVSVTFTSANDSSDASLMVNTKESGGATGVGVRIMDAGYNTVTLGSAVPVVFTDTNPTQNLDFHARMESKGKNATEGDVYAQANYVLAY. 189
390 3.000e-34gi|308189408|ref|YP_003933538.1| type-1 fimbrial protein, a chain precursor [Pantoea vagans C9-1]  clstr ali  20  1..MKKISLIAVALAAAGISSMASAA---DGTVNFTGTIRDTACTVDTASANQTVNLGTVAATSFGSSGATASSSRFTINLTGCPAAVT-SANIRFDGPLSSGNSDLLAL-SSDQTATNVGVGIYQQDSTTIPVGRASAPVTLSTTGTNALNFIAKYVSTAATVGAGSANAVATFTVAY. 172
391 3.000e-34gi|27461951|gb|AAN52118.1| fimbrial subunit [Xenorhabdus nematophila]  clstr ali  25  1MKLNTIGDGFRFWCGFNPGAANAAPTQGDGAVKFTGSIINAACSIKNN--NIEVNMGQINNVVLKDGGE-SKPEHFKIELKDCVLDTLKGVKTMFTGPAEGTMPGLLALD---GGAQGAAIMITNHGNKHIPLGQASDMMT-LHDGSKDLNFSARLKGLKGTVKTGEFTAIANFTLNYL 179
392 3.000e-34gi|383318181|ref|YP_005379023.1| P pilus assembly protein, pilin FimA [Frateuria aurantia DSM 6220]  clstr ali  17  1..MKTLTLAATAVAAFGLSALSTPSRAADGLINFNGQITAQTCDINGGGVDFTVTLPTVSQQTLSAAGQWAGRTPFNIALSNCSPATGNVAVYFEPGSTVDLRTGQLLNDTGDGQATNVELQLLNQDTTAITLGATNSKSVALEDGAATLNYYVQYVAVNGASTDGLVASRINYTIAY. 183
393 3.000e-34gi|312881645|ref|ZP_07741423.1| P pilus assembly protein [Vibrio caribbenthicus ATCC BAA-2122]  clstr ali  20  1MRAKYTRSSIAATLLFGLISTKSAFAENTTNVYFKGEIVESACGLSPDSLNQTIELGQHPIHKFKEKGDRSTPVPFRVKLTDCDNSALTKAVFRFESNPDTTGD----LFNVEGGATGIGVRIL-HNGNPIKNGE-IAATNVLVDGTNIASFSAAYEAGSDAVKAGNAESWALLRVSYL 177
394 3.000e-34gi|283787093|ref|YP_003366958.1| fimbrial subunit [Citrobacter rodentium ICC168]  clstr ali  29  1.MQNRFPCIALLAMGVTFSGQALQAGEDSGIVRFHGSVFASPCVLMTEGRIQDVELGEISAQRFHQAGDRSQPVRFTLHLKDCLKGASQSVQLTFVGEADINNTQLLR---TTGVSRGAGIRLLDENGKALDVGQTHAPW-LINNGDSELNLMAALESTGPHVSAGEFSSLVRLKMEYL 207
395 3.000e-34gi|333929635|ref|YP_004503214.1| fimbrial protein domain-containing protein [Serratia sp. AS12]  clstr ali  24  1MSMNNMRTVLIGLSVGSLLNTALAATTPDVSVMYRGNLVAEPCTLLPEDESILLDFGTVIDKYLY-LNTRTHSKPFQLHLIDCDTRLGKTVKMTFSGTESVALPGLLALDAAS-EAKGVAIGLETQDGQALALNQQSRGQ-EITDGNNTLTLQAYVKGENKAIERGMFTAVATFALEY. 181
396 4.000e-34gi|157371118|ref|YP_001479107.1| fimbrial protein [Serratia proteamaculans 568]  clstr ali  23  1MHMVALKTARALLTLMLCSGAVWADDAS---VNITGRVLSAACEPTVDP--LAVDLGTLSRSILSSKGVTGSHTDFTLRLKSCPAEVSQ-VQVQFDGVAATGDNSALALT-GSSVAKGVGVQLLDNAKKVLAPGTRSPLMSIIGGNSNSLAFSARYIATSDTVTAGSANASATFTIWY. 173
397 4.000e-34gi|161612526|ref|YP_001586491.1| hypothetical protein SPAB_00216 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]  clstr ali  23  1MKLTLKTLAVALAAITL-SPAALADTAKDGTVHITGLIQQNACTVKTDSVLIEVTLQNEFASLFTAAGQTARDKGFTIDLENCDANIYSNVQARFEGTLDGTDATILKNEAD---AQNIGVQILDKTGTPVTFNDSSAVALPTEEGVTTLPFTARYIATAVPVGSGNVDASATFYLQY. 182
398 4.000e-34gi|293606348|ref|ZP_06688708.1| fimbrial protein [Achromobacter piechaudii ATCC 43553]  clstr ali  29  2.....TKTILSTLLAASFMVAAGTAAADSGNISFQGDITQSACSIGGGGADMVVKMGSISTNMFSGVGSKGPETNFTIALLGCDTTVSTSASIAFRPGAGSVISNRLRSLENGSGAKGVAVGLVAEDGTAIAVGGTGVSY-NLVKGTNNFNFKAFYEATDAAVTAGKANAQALFEVQY. 175
399 4.000e-34gi|417225785|ref|ZP_12028954.1| fimbrial protein [Escherichia coli 96.154]  clstr ali  21  24......LIFFGMLFMTTDVFTQSRADLGVTNLYMRATLIHPACVLSTDSINKTVSLGVWSARQFEQTPSALPMTRFTINLENCGPTPA--VKVSWTGKADIINSKLFSLTEDS-TAKNVAVELLDWNRNRIPPGYTTPYYFEMNASAVSIPFYVRYVRTGNNVTAGTANSLATFTLDYL 194
400 4.000e-34gi|284007934|emb|CBA73895.1| long polar fimbria protein A [Arsenophonus nasoniae]  clstr ali  23  1.....MRKLLMALSLSVTFLSQFSAYGSSGSIILNGQLIGSTCQVTANTKNQTVILDTLSINNFQKKNDTSIGKSFNIALSQCQPTDNISV-VFHDAKNGLTEDGLIANQTGNDYAKGIAIGIYDNDNNPIKMNEKIAVDVDNNNSTRNLALIAKYVATGNEVEAGKVTSTVNFTITY. 172
401 5.000e-34gi|170699253|ref|ZP_02890304.1| Fimbrial protein [Burkholderia ambifaria IOP40-10]  clstr ali  22  7..........IVLLVIGICLYIAQARAADGTVTFTGVINSETCQVTTG--NVQVSLPNVQAATLKTDGATAGDTRFDIRLTGCDPQINQSVRAAFASDTHMDSTGNLTIDHGNGDADHIEIALRNLDHTQIHLGDPGAAFPISQDGNAMLTYIAQYVATGGAAQVGTVKSNATFTLNY. 175
402 5.000e-34gi|295681056|ref|YP_003609630.1| fimbrial protein [Burkholderia sp. CCGE1002]  clstr ali  19  1MKKQVTQLMIALAGLSVTPMVFAQAVPGAGQVTFNGELYDDTCVINSGDEDQTVTLPRVSSQTLPAAGSVGGSTPFNISVSNCPATLTQ-VAAHFETTNMNPVTRNAVNQATTSPAGNVEVQLLDHNASVLPLGSTGEFVNVGTDGTATMYYAGQYYATNKA-TAGYVTAVVRYTLAY. 181
403 5.000e-34gi|183597671|ref|ZP_02959164.1| hypothetical protein PROSTU_00962 [Providencia stuartii ATCC 25827]  clstr ali  25  1MKFVKTILATTIVASCATGVANAAIDQGSGVINFTGKVINAPCSL-PGDGTVNVDLGQVANKVLETGNKFSQSVQYTIALENCDLAAVSKVKVTFSGTPDTTKKDLLAN---TGTSKGVGVRLINADGAVMKVGDTS-VEMPLVNGANKLTFSARVEANGNKVETGSIISQATYALNYL 186
404 5.000e-34gi|33151518|ref|NP_872871.1| fimbrial major pilin protein [Haemophilus ducreyi 35000HP]  clstr ali  26  1MKK---SILAALISGTISISAMAAPPAGEGVVNFKGTIVEAACSVDPSFTNQTVDLGQTAAAKLVKGG-TSRPVPFTIKLVDCETGGKKKANIAFTGNIDKKVENGLAIL---GQAKGAAIQITGLDGKPVKLDG-SKTNVNIQDGDNSLQFSAYLKGTGKAIVAGEFTSLVNFTMSY. 187
405 5.000e-34gi|3603345|gb|AAC35825.1| HifD [Haemophilus influenzae]  clstr ali  18  31.............IALFACFIAPPLYAHDGRVTFEGEILDGTCKIETDSKNRTVTLPTVGKANLSHPGQTAAPVPFSITLKECNAVDAKKANLLFSGAVTGQI--YLSNATGSGKATNVGIQIVDGAGTPIKVDGSQANSEKAQNGTVIFDYFAHYYAIGAA-TAGDVEATATFQVQY. 204
406 5.000e-34gi|398808360|ref|ZP_10567224.1| P pilus assembly protein, pilin FimA [Variovorax sp. CF313]  clstr ali  25  189....................................TIAAPSCSVDLGSRNVSVQFGRVPQSNFKGRGSTTGDRNFNIKLS-CQAGTQNTVYLRMDATQDPSNQGVLKITGGSGTATGVGIQVVDNQGVPVKFGEDTLVG-PSKNGDYVLPYTARYYQTGNKVTPGRADGTATFTLDY. 332
407 6.000e-34gi|296100743|ref|YP_003610889.1| Putative minor fimbrial subunit PmfF [Enterobacter cloacae subsp. cloacae ATCC 13047]  clstr ali  26  1..MHRMIIILTCYLTVFAAAPAWAGELIGGDLSFKGVVMAYPCSIAPESGRILVDFGEISTKSLYIKGKTT-PVPFAIKLQDCNPNVFNAVTVTFSGIANANMADRLAINATAGNAGGVGIGLLEEDDTPVRLNVATRP-TLINDTLLRLSFQAFVEAEPDAVTTGPFTATAHYTLDY. 181
408 6.000e-34gi|90578264|ref|ZP_01234075.1| major type 1 subunit fimbrin (pilin) [Photobacterium angustum S14]  clstr ali  23  1MNKKILLSSLAILASFGVASAAFAITVNGGTVNFKGEITDGACAVDPDSIDQTVQMGQVKAATLQTAGAKSSSHSFNIKLDDCSTATYKNVAMSFLGATDAN--GSLVLTDAAGSAKNVGIDIYDGANKKVTFNSTSTTAVQFHNGTNVIPFTANYVSNIXXXXXXXXXXXXXFNIIY. 182
409 6.000e-34gi|386744213|ref|YP_006217392.1| fimbrial major pilin protein [Providencia stuartii MRSN 2154]  clstr ali  22  1..MKKILLATLISGAMSASAMAAPVSAGQGTVTFYGSIIEAACGIAPESTDQTVNLGQVASAQLADGG-TSRPVPFTIELVDTTTLTDNTATVTFTGGVNPNLADSLAIQ---GQASGAGVQIAGLGGVPVKLDGSAGTDLKIQNGDNSLLFSAYLKGDGKTIVPGEFTALANFTMSY. 174
410 6.000e-34gi|383813539|ref|ZP_09968964.1| fimbrial-like adhesin protein SfmF [Serratia sp. M24T3]  clstr ali  27  3..............................NVRFSANIVTWSCTISSASQNITVNLGQWNTRSYKSSGITTTPTYFSISLNNC---ANSSVTTTFSGKSDPTNDQYLALDS-TSTVENVAIELLDSDKTELPLNKESHAVVVGSSGNATLGFYARYITTAKAVQAGTADAQATFVINY. 146
411 6.000e-34gi|188535445|ref|YP_001909242.1| major fimbrial subunit protein [Erwinia tasmaniensis Et1/99]  clstr ali  24  1MKK-----ILLTFXXXXXXXXXXXXQAANGTVKFTGSIVKSACDVTSGDASKEVFIGKYPTSAFKKVGDVTASKAFTINLANCETG---NYTLRFDGPTVSGNPNLLAVNG----AAGVGIEILDNNEKTLPINQSSDANSPSANGSAAFNLKARYKSYNTAVTAGDANASSSFTIEY. 176
412 7.000e-34gi|254251103|ref|ZP_04944421.1| P pilus assembly protein pilin FimA [Burkholderia dolosa AUO158]  clstr ali  21  18MKKKVLAVSAAMLLGSWVALPAFAQTSGQGKVTFDGELTASTCSIAAGDEDKKVTLPKVSTVALAKSGDTAGSTSFEINVTKCSADVKKVAAHFEMTNMDPATGYLKNLLTGTTAAKNVVVQLVNSDGTGIRAGSTGHYFDVAGTAPNTLIYGGQYYATGAT-TAGKVNTFARFTLAYL 212
413 7.000e-34gi|423106824|ref|ZP_17094519.1| hypothetical protein HMPREF9687_00070 [Klebsiella oxytoca 10-5243]  clstr ali  20  9..........SAVVLILMTMIPGTLLAADSTITIKGNIKDNTCAVAPSSQYITVDLMNNAVKQLYAVGKTTPEIPFSIELAPCGASV-IAVKVGFVGIANAYNTNLLAIDAGGTAASGVGIQILDSDKNQIAINADSSATPLTANTSNTLNFYARLMASNMPVVAGLTNSTATFTLEY. 179
414 7.000e-34gi|384376602|gb|AFH78428.1| putative minor fimbrial subunit [Klebsiella pneumoniae]  clstr ali  25  7............LLRAALILICANAFAADSTISISGYVRDNACAVAIESKEFTVDLMNNAVKQFSAVGSVTPALPFRIVLSPCGSSAT-AVKVGFTGTPDSNNDKLLKIDSDAFAASGMAVQILDNQQTMLPINAASIAWTNLTPGTNILGFYARLMATRVPVTAGHVYATATFTLE.. 173
415 7.000e-34gi|416950067|ref|ZP_11935372.1| fimbrial protein [Burkholderia sp. TJI49]  clstr ali  21  1...........MSAAGLAFFAMNAAHASDGTITFTGSVVASTCKINGGTNDLTVPLPRAATNQLSSVGATSGRTPFTLALSGCTPAPVKKVSVAFEPGPNVNLESGRLKLTGADAATGVEIGILNDKYQPVKIGAESSTQALDGSGTATLQFSAQYVAVG-PVTAGPANSFVTYSLTY. 187
416 7.000e-34gi|270260824|ref|ZP_06189097.1| PAP fimbrial minor pilin protein [Serratia odorifera 4Rx13]  clstr ali  17  7...KRILHSAVLVNLLLCSSLAQSANQGRGEVTVNGRIIASACAIDTESLDQTITLATLPVSQIIRDGQ-GELHEFTIKLVNCTLDDWRYFAVTFDGREDAG------LFGIDGNAKGIALQISDKRGNVAAPGMP-MAKNEIQPGTMEFNYGLRLIGNNQVMKAGSYYSTVRFKMDY. 180
417 8.000e-34gi|296104700|ref|YP_003614846.1| putative fimbrial protein [Enterobacter cloacae subsp. cloacae ATCC 13047]  clstr ali  22  3.NKTILAVATTALLSGLSFTAMAADNQGSGKITFTGEVISAPCSITPGDENQTIELGEVADSVLNS-GKNSLPVDVNIHLQDCILSSTDKVKVTFSASTDSTDTSLMKNTGNIGGATGVGVRLLDSGSNKVTLGTPIEVSFPTTNAYQELNFKARMEPVAGSATPGNVQAQANYILEY. 190
418 8.000e-34gi|331674463|ref|ZP_08375223.1| KS71A fimbrillin (P-fimbrial antigen) [Escherichia coli TA280]  clstr ali  23  36MKMIKT-VMAGAVAMALVSFGANAANQGQGVVNFKGTVIDAPCGIAPESADQSIDFGQISKSHLNNSG-ISVKKNVDIKLVNCDLTEGNTVKVTFSGTS-LGDGTELGTSGGTGTA----IKMSSADGSLVKFGATAAGAYDLKQGDNTMRYSAWVESVADAVSEGQFAAVTNFNLTY. 210
419 8.000e-34gi|110643126|ref|YP_670856.1| PixA protein [Escherichia coli 536]  clstr ali  20  2.....LKSTLGIAIAFSLCAVAHAANQGQGVVNFKGTVIDAPCGIAPESADQTIDFGQISKSHLKNDG-ISVKKDLDIKLVNCDPTAKKTVSVTFSGTPVNGHTDELGTAGDTGTA----VVVSASDGSMVKFGTTSSNATQLQDGDNTLKYTTWVKKSSAAVKEGDFTAVANFNLSY. 176
420 8.000e-34gi|317490927|ref|ZP_07949363.1| fimbrial protein [Enterobacteriaceae bacterium 9_2_54FAA]  clstr ali  20  6..........LCAFMVFFVTTAWAMGEQQGRVKMTGTLVATACSISSESLEQVIDLGSMPISELAKNGQ-GPEKEFVIKLENCELTSQKSVHLTFDGTRD----EIANLLSLQGEASGIGLVLKDEAGNIIVPGQN-LPDIPLNVGSMVLNYKLAIQRNNHELRAGNYRAIVKFKVEYL 175
421 9.000e-34gi|383318178|ref|YP_005379020.1| P pilus assembly protein, pilin FimA [Frateuria aurantia DSM 6220]  clstr ali  27  195....................................SIVAPSCTVDPGSKTIAVDFGSVPAGAFHGVGSTAAEREFTIRL-NCNRSV-DTVDVRLDASTDPGQPGVLQLSPTTPVAAGIGIQLLDGSDTPVSFGGDGLELGTATDGSMSLPLKARYYQTGTPIRAGPGNGTATFTLQY. 336
422 9.000e-34gi|145639930|ref|ZP_01795530.1| putative F17-like fimbrial subunit [Haemophilus influenzae PittII]  clstr ali  25  6..MKKTLLGSLILLAFAGNVQAAANAETSGKVTFFGKVVENTCKVKTENRDMSVVLNDVGKSHFKNKGDTAMPTPFTITLTDCATTKAKKVGVYFYSNADKENDYTLKNTMGADKANNVNIQLFKDNGDPIKVGKETNDFTHNSSANSTLHFVAQYYSTGNDVTAGKVQSSVDFQIAY. 211
423 9.000e-34Oral.Meta HOMD ehor_c_2_963 Enterobacter hormaechei ATCC 49162 [320686 - 321291] fimbrial protein  ali  17  17.MYMGKKVLLAVAMAAIVSGSAFAEEQGSGKITFKGVVIDAPCSIAPDSVDKEIDLGEVTTAVI-NANKKSTPVPVEINLENCTDTPVSKVDVTFTSAATDATDTNLMTNTYANGAQNVGVRLLDNAETNLPLGAGQTIDLLAGSTTQTLHFKAVMVLTGKTATAGQVEATANYVLMY. 201
424 1.000e-33gi|237730208|ref|ZP_04560689.1| fimbrial protein [Citrobacter sp. 30_2]  clstr ali  24  1...MRFSALFATSMLLLGGMAQADTKLVGGDMYFHGTIRALACSLAPGGDKIEVDFKQIATQDLYLSG-RSKPEKFSIQLRDCNPEVFRGISVTFSGREDAELTDHLALDSSQGGASGIGIGMSEEDGTAIRL-DESTSVKEITEGSMTLNFLAWVAAEPSAIKYGPFSASGTWTLNY. 179
425 1.000e-33gi|395232535|ref|ZP_10410785.1| frimbrial protein [Enterobacter sp. Ag1]  clstr ali  19  1..MRNFKMTLCAMALAAVSTSALAADETQGTVTFNGQLIAETCTIASDSVDRQVQLPKVSIQTLNASGTTAGSKGFDLNVENCPTGITQVAAHFEASSGVNSQTGNLTNSATTGAATKVEVRLYNSDEQQLKLGETGAPA-PVTGGKATMRYYGGYYATDAT-TAGLVQAKASYTLAY. 176
426 1.000e-33gi|395231255|ref|ZP_10409547.1| fimbrial protein [Citrobacter sp. A1]  clstr ali  21  1MFKKTLLAVAATSLLSSMAFNASAADQGHGKISFEGIVISAPCSIAPGDEDQTISLGEVADTALNG-GKFSLPVPVQIHLQDCTPTTITKAKVTFSSANADADSLLKNTAEGNGGAEHVGVRLLTEGNEKVVMGTAVEFALMADNSYQVLNFKARMESPTTNATAGNVASDVNYVLAYL 187
427 1.000e-33gi|187478271|ref|YP_786295.1| fimbrial subunit [Bordetella avium 197N]  clstr ali  26  1MKNAIIKTLVAASLAVMAGG----AMADTGKIAFQGVITQGACTLGAGGTNMVVDMPQVPANKFTAAGDRSPAADFSITLLDCDVTTLNTAAFSFRPDAGSVVGTGLLSLENAGGAQNIAIRLEDDAGTQILFGGAAKSFTLVK-GNNVLNFKAYFEATATGVTAGNARARAFFDVTY. 175
428 1.000e-33gi|254254082|ref|ZP_04947399.1| Fimbrial protein [Burkholderia dolosa AUO158]  clstr ali  24  1MKKTIRLIVIAAAPLATVNL----AHASDGTINFTGSVVSSTCKVSGGS-DLSVALPKASTSQFTGVGSTAGRTPFKLTVSGCATDKAKKVSIAFEPGPNVDIGTGRLNLTGTDAAKGIQIAVLNDKYEDIKLGAESSAQNVQTTGSATLQFAAQYVATSDTVTAGSANSFVTYSLVY. 192
429 1.000e-33gi|425094725|ref|ZP_18497807.1| hypothetical protein HMPREF1308_05043 [Klebsiella pneumoniae subsp. pneumoniae WGLW5]  clstr ali  20  1MNMFIKGMASAAVVMMF---SPIAAQAADGKVTFNGEIITNTCTVISGDKDKIVTLPTVQVSALSAANQTAGTTPFTIGLENC--ASASDVSVYFEPNEYVSTEGRLKNSGSDNGADNVDIELLNNNHGVIDLANQTSTIVTPVDGSATLPFYARYFATNAA-EAGKVSSYVNFTIVY. 188
430 1.000e-33gi|422834507|ref|ZP_16882568.1| hypothetical protein ESOG_02169 [Escherichia coli E101]  clstr ali  22  1.MKTKTGCMLLTGLLLAASGTTLAAD----NLHFYGNLLSKSCTLVVDGELLEVHFPTVSSQDLMVAGQ-SSRVPVVFKLKDCKGPADYQVKVTLTGTEDSEQPGFLALDPTSG-AQGVGIGMEKSDGTLVPLNDTTGATFNLSDGANSLNFNAWLQASGRDVTSGEFSASLTATFEYI 174
431 1.000e-33gi|1103612|emb|CAA54703.1| ucaA [Proteus mirabilis]  clstr ali  22  1MKRKVIALATILSAAFAGSS-----MAYDGTITFTGKVVAQTCSVNTNDKNLAVTLPTVSTTTLNENAATAGLTPFTIHLTGCAIGGAQSVKTYFEPSSDIDVTTHNLKNTAQTKADNVQVQLLNSDATTIQLGTDSATQVQIDNANVNLPYFAQYYATGQS-TAGDVKATVHYTIAY. 179
432 1.000e-33gi|38201763|ref|NP_938130.1| SefF [Serratia entomophila]  clstr ali  26  12.............LLPVFFILLNHASWADTDIHFSGILVAEPCQLATDSEDQIVDFGPIAARQFINNSQTSPN-SFNLRLIDCDLSIGQSVIFTFTGDEDADQPGLFAV---AGEAKGIAIVLMDDEGNKVQPGKAMS-ASSLAEAENSFSFQA---AVSGPVSAGSFTSTVMFSLEY. 172
433 1.000e-33gi|386744540|ref|YP_006217719.1| fimbrial protein [Providencia stuartii MRSN 2154]  clstr ali  21  1MSKKII-----LAALISGVMSSSVFAAGSGTVSFQGEIIDAPCGISADTASQIVPMGKISNASLADGGK-STAQNFNIQLVDCDVSTLKTVDVSFTGGAIGTDSDMLAIQ---GSASGAGVVVIGMNGEKVKFDGSSVTNQNLLTGRNTLNFSAYLQGSGQAIVPGDFTAVSNFLLEY. 170
434 1.000e-33gi|422021047|ref|ZP_16367561.1| putative exported fimbrial protein [Providencia sneebia DSM 19967]  clstr ali  21  12....KESILMMFLGCLFFSAVSPAKNGQIGEIRIRGLLVAETCTVRPGDENIAVNFRSILDTDLY-INKKPSSENFYIHLEDCDESVLKTVTVKFTGSENSNLPGLLAVDNGS-MASGIGVEITELGGKKIPINS-VTPAYKLQKGSNTLSFSANIQATNKSIGLGNYTATSTFTLNY. 187
435 1.000e-33gi|296104704|ref|YP_003614850.1| putative fimbrial protein [Enterobacter cloacae subsp. cloacae ATCC 13047]  clstr ali  15  1.MRNISKTLLAVALGSFISGNALASDQGSGKITFKGIIIDAPCNIAPDSIDKEIELGQF-TTAVMNVNKKSTAVPVDINLENCTATPVTKVDVTFSSTATDATDTSLMSNTYAGGAQNVGVRLLDNAESPITLGTAQTVDLSAGSATQTLHFKAQMVVDGKTATAGQVESTANYILLY. 184
436 2.000e-33gi|296101468|ref|YP_003611614.1| hypothetical protein ECL_01104 [Enterobacter cloacae subsp. cloacae ATCC 13047]  clstr ali  24  1MKMNKLFTALVLA--SGMAAFGAQADQGSGVVTFTGSVIDAPCSIAAGDEDQTISLGQVSSSAVANGG-TSTPVPFYIHLENCSVETATTVTTTFSGADSSVDGAVL---GVTGNATDVGIVMTDGDSNTITLGEATSGQ-NVVNGDNTLTYSAYIIG-GEAPTEGDFTAVTNWTLAY. 170
437 2.000e-33gi|168239099|ref|ZP_02664157.1| fimbrial protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480]  clstr ali  27  5.........FAAAVLFTAMGLASTAMAQDGQVNFTGKIIEAGCKINGSTSSQDVKLGEVSKTAFTAAGSTAATTKFSLVLTACPADLGKPVSVKYDGMPDTLNNDYLQITGTTGVAKGVAIQLLNSDTSELPLGTESKSVTIASDAETNLDFFARYIATEDSVSGGDANGVVNFTLTY. 179
438 2.000e-33gi|300715712|ref|YP_003740515.1| fimbrial major subunit [Erwinia billingiae Eb661]  clstr ali  23  1MKKHIIASLIPALAIFSFSTLAAPVTVDGGKINFTGSVVAAPCAVDNVTDGQTVKLGQVPTNRLASKGDSSSAVPFTIKLTGCDTASYTSASIIFNGATTGEATTLNGAGDTTTAAQNVGIQILQNNKAVNVNGSTATDVQRILAGTNEIPFSAVYVATADGVVAGSANSTVNFQVSY. 197
439 2.000e-33gi|110643927|ref|YP_671657.1| F17 fimbrial protein [Escherichia coli 536]  clstr ali  23  1MKIKVIALATFVSAVFVGS-----AMAYDGTITFTGKVVAQTCNVTTGDGNFTVTLPTVSNKALASPGETTGLTPFSINLTGCTSTVAGHVKAFFEPGSSTDFTNNLKNIASDNAAGDVQIQLLNSDGTSTIFGQDVHSETIGGDGNATLRYMAQYYATGAS-TPGNVKTTVNYTIAY. 182
440 2.000e-33gi|423122124|ref|ZP_17109808.1| hypothetical protein HMPREF9690_04130 [Klebsiella oxytoca 10-5246]  clstr ali  19  9.............AIALFVVLTVPAYGYDVLVSVSGHLIGNTCIVSADSKEQSVPLGTIGIKQFREAGAVSNIKSFTLKLEECGPTFTG-AKIRFSGTPDELNPQLIKV--ADGGATGVAVQILDKDGIQVPLESQTTAYGVSGDESVQMTFYARLVATGAAVNTGEVSAFATWTTEY. 171
441 2.000e-33gi|311281149|ref|YP_003943380.1| fimbrial protein domain-containing protein [Enterobacter cloacae SCF1]  clstr ali  22  7..LTVLATAAMLSGTNAFADPPTSGPFGQGTIFFHGTVTNSPCNIAPGDDALKVEFGQVSYRALKTADATTASQPIVIHLTDCPEGLMSKVKVTFTGDATSNNKGYV----NTGSATNVAVQLLNDNSTPIPPGYTDADAQQLQPGNNELRFFARLLALGAA-TPGEVKSQVTYTLTYL 193
442 2.000e-33gi|421081400|ref|ZP_15542313.1| Fimbrial-like protein SfmF [Pectobacterium wasabiae CFBP 3304]  clstr ali  25  19....TVRFCLVFSIATVCALIPARADLGLTNVRLTATLLANSCSVSAGTQEQTVDLGTWPSKQFAVGSQNSNPTRFEIVLENCGVAASG-VEVTFYGSAPAVDNTLLALNAGS-SATNIAVAILDSERRRLALGQPMPLYALSANAAVALVFYGQYVAIGTPVTVGSANADATFTLTYL 192
443 2.000e-33gi|188026000|ref|ZP_02960502.2| hypothetical protein PROSTU_02453 [Providencia stuartii ATCC 25827]  clstr ali  28  31..MSILKKSLTALGVALAVTTAPAVFA-SGTIDFTGEITDSACAVDSSSQNLTVDLGKVSVKSLAAAGQIAGLKDFTIKLIDCPENA--KVAVRFGGSRDNDDRDILQIAQAGGHATKVGIALFEKDTTQIKLFEDSKEFKNAAGDSVELNYVARYKATGAATAG-KADGTAVYSIQY. 205
444 2.000e-33gi|421727245|ref|ZP_16166409.1| fimbrial protein domain-containing protein [Klebsiella oxytoca M5al]  clstr ali  26  17.....................SGAALADDGQVKFIGDIIDAGCDVVNDSNPLEVQMGQIAKTAFTGTGSTAAEQGFDIQLKNCPTTVTK-ASVLFSGTNVGGDNSKLQLTAEPNVVTGVALQLYGSTNSTLPLFTRSTSLTIPSTGDIDLPFRVRYIQTDTTVVAGKANGSANFTISY. 174
445 2.000e-33gi|290476515|ref|YP_003469420.1| major MR/P fimbria protein [Xenorhabdus bovienii SS-2004]  clstr ali  25  1MKLNKLAMVLGF-GVALTAGAASAANQGSGTVKFSGSIIDAPCSIK--NTNIDVDLGAVSNSILEKGG-RSASKAFKIELQNCTTETKNGVKTTFTGAEADEKG----LLGIEGTASGAAIAITNAGGKIIPLGTES-DKFSLHEGSNDLNFAAHLKKNQNEIKPGEFTAIANFTLNYL 180
446 2.000e-33gi|418763388|ref|ZP_13319511.1| fimbrial protein [Salmonella enterica subsp. enterica serovar Newport str. CVM 35185]  clstr ali  20  15MEKIPLFMTVILLTAINIPGAAVARTMGWGTVSMQGSIVETACAIEMNSREQIVDLQVVPVSLLASKGA-GVPRPFKIRLINCNLPPWHSFSVTFDAVSDGD------LIRVDGDAEGVGLQIVDEWGNVARPGKE-MPMNDIKPGNYDLHYTMHLLANNKPLRAGFFRSVVRFKMDY. 191
447 2.000e-33gi|238797040|ref|ZP_04640543.1| P pilus assembly protein, pilin FimA [Yersinia mollaretii ATCC 43969]  clstr ali  25  1.........MSLLTILALSFLPPPVLAYDVLVSVTGKLIGNTCTVSTDSKMLTVPLGNIGTQQFGNRGVSNIKTPFFINLEECGPTFTG-VKVRFVGTPDGDATHLLKVDG--GGATGVAVELLNKGEEPLALNRQTEVLGIPGADSVQMKFHARLAATGSPVSPGPISAIATWVLEY. 167
448 3.000e-33gi|365970330|ref|YP_004951891.1| type-1 fimbrial protein subunit [Enterobacter cloacae EcWSU1]  clstr ali  24  56..MKKIFAVASISTMIMVSPYTFAANEGTSTVTFTGSIKENTCVLANGSLGQVVQLGDVESSVFASAGSASQPVNFTIALEQCDSA---NASITFSGTTATD--EVLSVTGSGTVASGLGIQIL-ENGTPLKVGSAASAIKAVGAGSADFNFSARYFALDNSVSAGEANATAQFTVKY. 228
449 3.000e-33gi|386743984|ref|YP_006217163.1| fimbrial protein domain-containing protein [Providencia stuartii MRSN 2154]  clstr ali  23  28..............................TVQFDGTLVEDACEVYPGDENIELDFGTIVDKYLY-LNTRTHSQPFTIRLINCDLVLGKEVQVTFKGTESLALPGLLALNGGSQ-ASGIAIGLEAENGTPILLNKAKNYTQKLHSGNNNLNLKAYVQGETKTIGRGAFEATTTFMLEY. 179
450 3.000e-33Oral.Meta HOMD esak_c_1_7026 Cronobacter sakazakii ATCC BAA-894 [2495481 - 2496038] fimbrial protein  ali  23  18MKK--------LLLLIMFALGAHRALADDINLQVNGAIIASACDVESASKNKTVDMGIATADAFSQPSTYGPWVPFELSVMNCPVATT-AVDATFSGELDPTNSTAYR---STGTGKGLALQLVDGKNNMLPGGDKYTETVDEATHSATFQLRARYVRTTEPLVPGTFESAVQVTFTY. 185
451 3.000e-33gi|188532558|ref|YP_001906355.1| Fimbrial anchor (mannose-resistance fimbriae), MrfB protein [Erwinia tasmaniensis Et1/99]  clstr ali  20  9.......FLLCLMLMPSAVFADRQADQGHGLVEMQGSIIDTPCAIDVADRNQSIDMSVIPVSQIMRDGQ-GPTRPFTIRLINCVLTVVSRFSVTFDGATTNDN-----LFAVSGEGKGVGLQIADANGNLADPGQPLAGG-KLQPGNSSLDYTLRLVSNRQTLRAGTYAATIRFKLDY. 179
452 3.000e-33gi|163858450|ref|YP_001632748.1| type-1 fimbrial protein [Bordetella petrii DSM 12804]  clstr ali  28  1...MKKAILSTLVSTCLXXXXXXXXXXDTGNIKFIGDITTSACAIGGGGADMTVYMGSIPSSYFAAIGDRGPMTDFSITLIGCDTTVSNTASLSFTPAAGSVVGTGLLSLENAAGAQGVAVGLAEQNGNDIVVGGPAVSY-NLVDGSNVLNFKAFYEATSATIVAGPANARAVFAVAY. 176
453 3.000e-33gi|221201895|ref|ZP_03574932.1| fimbrial protein [Burkholderia multivorans CGD2M]  clstr ali  19  9.....LPRALRAALLVAGICALPAAHAQDGTITVTGDISGTTCKISGNSPNFTVALPEIVASSLGSAGTRTGDTPFNIMLTNCQPGSGNVSTYFEPGTTVNAATGQLKN--ASGTAQNVEVGLLNKDRSVIKLGSQNTAKVAIASGSAKLEYIAQYVATGGAAGSGSVNTSVLYSLVY. 186
454 3.000e-33gi|421786097|ref|ZP_16222514.1| mrfH protein [Serratia plymuthica A30]  clstr ali  22  7.......LFPCVLVGWVVAVGTQPVAAATDNLKLHGALVAEPCTLQAGDENIQLDFGTVIDKYLY-LNTRTHSKPFQLRLMDCDTSLGKTMKMTFSGMESVALPGLLALDGGS-EAKGVAIGLETEAGQALTLNQKSRGQ-AITDGINTITLQAYVRGENKAIERGTFTAVATFALEY. 179
455 3.000e-33gi|26249427|ref|NP_755467.1| PapA protein [Escherichia coli CFT073]  clstr ali  24  12MIKSVIAGAVAMAVVSFGAYAAPTIPQGQGKVTFNGTVVDAPCGIDAQSADQSIDFGQVSKLFLENDGE-SQPKSFDIKLINCDITNTGTVSLTFSGVPSGPQSDMLQ----TVGATNTAIVVTDPHGKRVKFDGATATGVSLVDGDNTIHFTAAVRKDGNPVTEGAFSAVANFNLTY. 198
456 4.000e-33gi|423106820|ref|ZP_17094515.1| fimbrial subunit type 1 [Klebsiella oxytoca 10-5243]  clstr ali  27  1MKFKSLALVMTXXXXXXXXXXXXXXXXNGGTVHFKGELVNAACAVDAGSVDQTVQLGQYRTAKLAAAGDVSQNVGFNIQLNDCDTTVATTAKAFAGVAANAANPTVLSVSSAAGGATNVGIQILDSKSVPLGLGATFSTAVTLKDGVNILPFQARYYALGAT-TAGVANADATFAVQY. 181
457 4.000e-33gi|183601135|ref|ZP_02962628.1| hypothetical protein PROSTU_04764 [Providencia stuartii ATCC 25827]  clstr ali  21  1..MKAILVMLLVSQFATLPSVQAQASTLWGSVNMNGSIVDSACAIDTGSYEQVVDMGILPVGTIRQQGQ-GPVHPFSITLIGCTGSPWQAFTVTFDGPASGN------WFTVSGDARGVALLLQDADGKPIYPGKSTEKQT-IAPGNTVLNYGLRLVADKEPLRPGQYQSALRFKLDY. 173
458 4.000e-33gi|270264539|ref|ZP_06192805.1| fimbrial protein [Serratia odorifera 4Rx13]  clstr ali  20  27...KVMPPCILTLLLFFSSAQAAHQTQGWGRVNMQGAIIDTACAIAAGSREQVIDMETVPVADIIRDGQ-GISRPLSIELINCVLTDWKHFQVTFDGETDG------ALFGVRGEAKGVALQIADGKGNIATPGKP-LPLGDVSLGTMQLNYALRLVSNNQSLRAGAYSTAVRFKLDY. 200
459 4.000e-33gi|311277958|ref|YP_003940189.1| fimbrial protein domain-containing protein [Enterobacter cloacae SCF1]  clstr ali  23  1MKKHVLAMVVXXXXXXXXXXXXQATTVSGGTVNFVGQVVDAACAVSADSTDQTVTLSQVRTAKLTTAGMTANQKAFSIKLADCDTTVSQNAAVIFNGQQDSIQVGALANTAGAGSATNVALQLYGPDGQTLNVGDTSA-AIVLVDGSNTLPLSVDYIATGAA-TAGNVAATATFNMVY. 179
460 4.000e-33gi|90578261|ref|ZP_01234072.1| fimbrial morphology protein [Photobacterium angustum S14]  clstr ali  21  1MSVKLVLSFIFIFFVQSAYSITLVNEIKKTSINITGNVIDNSCEVVP--KNIDVNLFNNPLKQLSYKGAVTANVLFSINLIHCGDSV-KAIKVVYKGEEDNIDKNLLAINKVPGSTEGVAIQLLNSNKIQKPINQNNTQWIPLHPGSNVINYYARLKATTNKVTYGHVRSQAVFNIEYL 178
461 4.000e-33gi|260597004|ref|YP_003209575.1| F17 fimbrial protein [Cronobacter turicensis z3032]  clstr ali  18  1..MRKINLAYCALALGLISGYAEAVSQ--GTVTFNGKLIAETCEIDTGDVDKTVTLPTISTQTLAKAGDEAGSTIFTIKAVNCPAAITKVAAHFEALDSTGFDPGNLTNAAATGAAKNVEVRLYNTDSSVISVGETGAAFDVKSDQTAEMRYIGGYYASEAT-EAGDVTAKVNYTLSY. 175
462 4.000e-33gi|253688663|ref|YP_003017853.1| Fimbrial protein [Pectobacterium carotovorum subsp. carotovorum PC1]  clstr ali  25  25..........VSLLFMTCSVQPVRADLGLTNMRLTATLLANSCSVSTGTQEQTVDLGTWPSKQFAVGSQNPNPTRFEIVLENCGVAASG-VEITFHGSAPAGDSTLLALNASS-SATNVAVAILDSERRRLPLGQPTPVYALSANAARVLVFYGQYVAIGTPVTVGSANADATFTLTY. 191
463 4.000e-33gi|366157517|ref|ZP_09457379.1| PixA protein [Escherichia sp. TW09308]  clstr ali  24  1MKMVKTIMAGAVAMALVSFGAN--ANQGQGQVNFKGTVIDAPCGIAPESADQTIDFGQISKSHLADGG-TSQHKNVDIKLVNCDASQKKAVTITFSGSSVASDKEELGTSGGTGTA----IKMSTAAGDFVKFGSTPAGVYNLKDGDNTMRYSAWVQADSATVTEGDFAAVANFNLTY. 177
464 4.000e-33gi|188025661|ref|ZP_02959395.2| hypothetical protein PROSTU_01238 [Providencia stuartii ATCC 25827]  clstr ali  21  6.KRIGLLKAALLSIGALGLMPAHAAPGEWGKVSMQGSIVDTACAIDTGSYEQSIDMGILPIGLLRQVGH-GPIQPFSITLIGCQLTNWQTFSVTFDGPANGE------WFSVSGAAKGVALSLQDASGQIVRPGLATAKQ-DIKPGNYILNYGLRLVSDETPLRPGEYQTAIRFKLDY. 180
465 5.000e-33gi|298717264|ref|YP_003729906.1| fimbrin-like protein FimI [Pantoea vagans C9-1]  clstr ali  22  1MNIRKRILPVALAGLMISGSALAAAQGAGGEVKFTGEITDVSCDVSTASKKQSVDLGKWAKSYFESR-TETTQTPFTISVKDCPASVTK-VAVLFDGDKDAGDNTLLKV--ADGGATGVGIKLYEGDSTPIAIGSISKGVDKMVGGSADLIFYADYKSDGAEIAVGPANAVSNFVMVY. 196
466 5.000e-33gi|268592406|ref|ZP_06126627.1| MrfG protein [Providencia rettgeri DSM 1131]  clstr ali  23  10..KFKKIIXXXXXXXXXXXXQSHAKNGQIGEIKIRGQLVAEACTVRTGDENIIVDFGTIVNKYLY-INQKTPIENFNIHLDDCDNSIFRTVTVKFTGNENINLPGLLALDSGS-MASGIGIEILEYSGKKIPINSTTPAY-NLENGTNILSFNANVQGEPDAIKNGHFTATAIFSLIY. 187
467 5.000e-33gi|423104712|ref|ZP_17092414.1| protein fimF [Klebsiella oxytoca 10-5242]  clstr ali  23  1MMKTPVYLLGALLSLVVAC-----ASAADSTITISGYVRDNACAVAGESKDFTVDLMDNAAKQFRAVGATTPLVPFRIVLSPCGNSVT-AVKVGFVGVADSINTDLLQLDGGASAAAGMGVQILGAQQTALPLNAASSATTLTPGQTNTLNLYARLMATRVPVTAGHVNATATFTLE.. 174
468 5.000e-33gi|386826008|ref|ZP_10113123.1| fimbrial regulatory protein papH [Serratia plymuthica PRI-2C]  clstr ali  17  7...KWILLSVLSAQIMLHSPPSLSANQGRGEVAMNGRIIDSACAIDTESIDQTIKMATLPVSQIMRDGQ-SNRQKFSITLINCGLNNWRYFEVTFDGREDGGN------FGIDGSASGIALQISDEGGNVATPGLPMNKK-EIHAGEMTFNYGLRLVGNRRVLKAGEYSSTVRFKIDY. 180
469 5.000e-33gi|311280325|ref|YP_003942556.1| fimbrial protein domain-containing protein [Enterobacter cloacae SCF1]  clstr ali  23  1..............MLTVCTLLLCASASAIDVQMTGNIYANTCAVDGASQSLTVDLGQDSASNFSSIGDTGEWKDFDLTLSQCPATVT-LATAQFKGQADGKHPNKFAN---TGTAGGLALELADQDKILLAPQASFSVLVNQSDHTADFPLSARYYATSEPVTAGTFSATVQVTFTY. 161
470 6.000e-33gi|15800799|ref|NP_286813.1| fimbrial-like protein [Escherichia coli O157:H7 str. EDL933]  clstr ali  21  4MKKSVLTAFITVVCATSSVMAADDNAITDGSVTFNGKVIAPACTLVAATKDSVVTLPDVSATKLQTNGQVSGQTDVPIELKDCDTTVTKNATFTFNGTADTTQITAFANQASSDAATNVALQMYMNDGTTAIKPDTETGNILLQDGDQTLTFKVDYIATGKA-TSGNVNAVTNFHINY. 181
471 6.000e-33gi|402701654|ref|ZP_10849633.1| fimbrial protein domain-containing protein [Pseudomonas fragi A22]  clstr ali  23  1MKLNKIALAAALVLGTITTV--QAADEGNGVVRFTGSIIDAPCSIDPNSVDQTVELGSVSNVVLVDGGN-SAPKPFEIRLEKCSLDTAATVKTTFNGAAGQGGLLGI-----TGDARGAGIALTDGNGTAITLGTATAGQVSIGASNATLTFSAYLKGNGGDATPGEFSSVANFMLSY. 174
472 6.000e-33gi|167576581|ref|ZP_02369455.1| frimbrial protein [Burkholderia thailandensis TXDOH]  clstr ali  19  1MKKNVVSFAAAALLGLGAAAFAQTVGAAQGKVTFNGELITSTCTVDAGSKDQIVQLPKVSTNTLTTAGQTAGSRPFDIKVIDCPKEVKVAAHFEMD-NMHPESRTLKNLDETDKGAKNVSVQLVEADGTPLDVGSTSKNFVEVSDNGATLTYGGQYYALGKT-DPGLVNTFTRFTLAY. 183
473 6.000e-33gi|388470339|ref|ZP_10144548.1| fimbrial protein MrfH [Pseudomonas synxantha BG33R]  clstr ali  22  1MGYKRIHPVWACAALVLSLGLIAEGNAAD-NLSFRGNLVEEACTIRPGDEAITLELWDLTSKYLY-LNTRSLGKVFKLHLEDCDTTVGNTVTITFGGRENPELPGLLALDGGSG-ASGIAVGLETPANNPLPLNTVSDRQV-LSDGNNVIELKAYVQGEPQTIGHGAYTVTSTFTLDY. 179
474 6.000e-33gi|188532555|ref|YP_001906352.1| Adaptor/initiator (mannose-resistance fimbriae), MrfE protein [Erwinia tasmaniensis Et1/99]  clstr ali  24  21.....IAMLLLCPAIALATVDNWDVEGENGVLHVTGALSAAACRLDMQSARQEVAMGTTPLSSLRRVGDRGTPVAFQLYLRDCMMSGGSQVTLSFSGNSDMQKPELIQLKGTS----GVGLRILDDQNRDIRLGSRGMPLF-LTPWNAQLTYYAVPERTPATPIAGPYQAVVDFRLSY. 204
475 7.000e-33gi|420019495|ref|ZP_14533688.1| putative fimbrial-like protein [Klebsiella pneumoniae subsp. pneumoniae KPNIH10]  clstr ali  25  11.KQPRFITILIGTLLSGVALQATAANGAGGQVIFNGSITDSSCNVDSSSNGQKVDLGKWASNYFTGTGFETTKTPFHIKVKDCPASVT-TVAVLFDGARDQSDNSLLAIN---GGASGVAIKLYEHDSTAVSLGKTSTPGTSGGTGSADLEFYADYISTAATVTAGKADGTANFNMIY. 200
476 7.000e-33gi|290432|gb|AAA23737.1| major fimbrial subunit [Escherichia coli]  clstr ali  21  6...........FILGILAAASSSATLAYDGKINFTGKVVAQTCSVATGSESLSVVLPTVSTTTLSTDAKTAGLTPFTIQLTGCTVSAASKVNAYFEPNANTDYTTGNLTNTASSGASNVQIQLLNADGTPIKLGQDATTAVQIDNAAMKLRYNAQYYAT-APATAGDVSATVNYTIVY. 179
477 7.000e-33gi|327412939|emb|CAX67953.1| fimbrial protein precursor [Salmonella enterica subsp. VII]  clstr ali  19  6..MKKIFIATGMLSFIF----STSALSYDGTINFVGKILDQTCSVTTGSKNLTVTLPAVSKTLLDTPAKTASLTPFVIELNGCDAGTGQGVKAYFEPNATTDFTT--GNLKNTGTATNVQVQLLNADGTPVTLGSQNTTATRIDASDVKLRYNARYYATGAA-TAGDVAATVNYTIAY. 182
478 8.000e-33Gut.JP.Meta  ali  55  19...................VNQWNVTLPGGSMRFQGLIMASSCRVEAGDRQMTVNLGQISSNRFHDVGEDSNPIPFAIHLQDCSTAVSQHVGVAFHGVADGKNPDVLSVGEGPGIASGIGIALFDSQGQQLPLNRPPD......................................... 137
479 8.000e-33gi|291618279|ref|YP_003521021.1| SmfA [Pantoea ananatis LMG 20103]  clstr ali  23  1MKINKVAVVLMLALGMGATG-AHAANQGQGKITFHGHIIDAACSIGSDSEKQTVELGQISARQLEDQG-TSSPKVFTIDLENCTVITSPTVKVTFGGTAASDGSTDNNKFGIMGTASGAGVVITDASSAIIPVGGSSEARTLI-EGNNTLAFSAYLQGDNNAIKSGEFTSIADFTLAY. 190
480 8.000e-33gi|365837600|ref|ZP_09378964.1| fimbrial protein [Hafnia alvei ATCC 51873]  clstr ali  21  15............LLLVSLIVLPGMGRAHDLTVNISGSIQNNTCSVAADSVSKSVAMGNVAAKSFVHAGDTTLPIRFVLNLENCGEATLG-VAVELNGMANDNNNQLLALDKSTGNATGLGVAILDEDSKLIPINSISKTYSNTPPTNMSMVFYAQYMADGGAVQAGNASASTTFTLVY. 186
481 8.000e-33gi|212709436|ref|ZP_03317564.1| hypothetical protein PROVALCAL_00476 [Providencia alcalifaciens DSM 30120]  clstr ali  21  1MKNKFILFILCFFCFS--------AYSADVTLNINGAILGQSCNISSNDLIKNVNFQDLNPGDFNNIGDVSPEKSVSIHLENCSGNV-NNMMYQFSGEADANDTTLLKIIGKSGSATGLAIEILNKNKDRIKLNSKKFLNETITTTSYDFTFYLRYISTNQNVSSGDASSLLYLDIYY. 174
482 9.000e-33gi|221211986|ref|ZP_03584964.1| minor fimbrial subunit HifD [Burkholderia multivorans CGD1]  clstr ali  25  1..MTKYSLLTAAAGLAFVAMNA--AHASEGTITFQGSVVASTCKINGGTNDLTVQLPRAATNQLATVGATAGRTPFTLALSGCTPAPVKKVSVAFEPGPTVNGNGRLKLT-GDDAAKGVEIAILNDKYQPIKIGADTGDTALDGTGTATLQFAAQYVATG-PVTGGSANSNVTYSLTY. 193
483 1.000e-32Oral.Meta HOMD pmir_c_6_395 Proteus mirabilis ATCC 29906 [3153 - 2572] fimbrial protein  ali  23  17MILQRLSLSTAIFAAVIAMANA------DPNMRFHGELIDEPCVIKPGDEIIVITLDKVTDSAFYNGVERTKSQQFEIHLSECDLSMNNKVSITFKGDENKAMAGFLALSPIS-RASGIAIGLEDSDGVLLPINQPSKNMALLST-NNTLRLSAFIQAENQSIKRGPFSAIATFHLNY. 193
484 1.000e-32gi|375257004|ref|YP_005016174.1| fimbrial subunit [Klebsiella oxytoca KCTC 1686]  clstr ali  25  1.MRQFIASMVLLGLLSAATPAYASGELIGGDLTFKGTVAAHGCSIVPSSKNIAVDFGQISTRTLYAE-SKSQPKAFVIELKDCSTDVFNSVTVTFSGTENANMSDRLAITPVANSASGIGIGFEESNGTAISLNTPTT-AVAISDATMQLNFKAFVEGENKTLQTGAFQATAYYTLNY. 181
485 1.000e-32gi|268591083|ref|ZP_06125304.1| MrfB protein [Providencia rettgeri DSM 1131]  clstr ali  22  1.MNNSITSGVFSLILSIGTLTAVSTAYAQGSVSMNGSIIETACAIDVGSRDQTIDMGSIALTQIRRDGQ-GPARPFVIRLVNCDKPNWQYFRVTFDGSHDRG------LFGVNGQAQGVGLQIQREGDGEIAIPGQGMSVSSLTAGTKDLTYRLRLVANNRPLASGQYYSQLRFKLDY. 177
486 1.000e-32gi|170697007|ref|ZP_02888103.1| Fimbrial protein [Burkholderia ambifaria IOP40-10]  clstr ali  23  1MKIAKSTSALSLFVVXXXXXXXXXXXXSDGTINFTGSVVASTCKINEGVNDLTVTLPKAATNQLAAPGSTAGRTPFKLTLTGCTPAPVNKVSVAFEPGPNVNLATGRLTLTGADAAKNVEIGILNDKYLPIKVGAESSAQIDTTAGTATLQYSAQYVATGEA-TGGSANSFVTYSLIY. 193
487 1.000e-32gi|422006568|ref|ZP_16353557.1| fimbrial protein domain-containing protein [Providencia rettgeri Dmel1]  clstr ali  19  1MRINQWLYQAVSALGLSGLLFSTSIMAE--TVEFEGTLVEDACEVYPGDESIELDFGTVVDKYLY-LNTRTHSQPFTIRLINCDLVLGREVKVTFSGIENTILSGLLAIDAGSQ-ASGIAIGLETENGTALPINTGNYTQNLYAGNGNNLNFKAYVQGEPKTLGRGEFLATATFELNY. 179
488 1.000e-32gi|365833837|ref|ZP_09375289.1| putative Pap fimbrial major pilin protein [Hafnia alvei ATCC 51873]  clstr ali  24  8MSFKKTAVCVALALASFASAGVMAADTTAGKVHFDGSIVNTPCTITTKNADLTVTLGQVQKTVFAAIGDKSPDVSFDIVLDDCDVTTAKTAEVAFSG-AGVGDGSILALDG--GGATGVGIEFAENSGTAIKLGDKSAAQDLFSGAVNSLHYKAHYKSFAADIATGKATATADFTISY. 192
489 1.000e-32gi|365849835|ref|ZP_09390303.1| fimbrial protein [Yokenella regensburgei ATCC 43003]  clstr ali  20  12.....LLVWFVLSLISSGVLAKNAADQGHGKVSMQGSIIDTPCAIAVASREQVIDLMTIPLEQVIRDGA-GPSKPFSIHLENCNQQDWSHFMVTFDGP--VTDGELFALH---GGARGIGLEISDATGNRMHPGIASQAG-LLQPGAMRLDYSLRLVGNHQKLRAGAYSTTVRFKLDYF 185
490 1.000e-32Gut.JP.Meta  ali  24  1MKIKVIALATFVSAVFAGS-----AMAYDGTITFTGKVVAQTCTVNTSDKDLAVTLPTVATSSLKDNAATSGLTPFAIRLTGCATGSAQNVKAYFEPSSNIDLATNLKNTATPTKADNVQIQLLNSNGTSTILGQDVQSETIGSDGSATLRYMAQYYATGQS-TAGDV........... 171
491 1.000e-32gi|317493891|ref|ZP_07952308.1| fimbrial protein [Enterobacteriaceae bacterium 9_2_54FAA]  clstr ali  25  1MKQFRLPIIVLAAMPLMLQAAPSHVEGENGVVHFSGNVYVAPCVLDPQSREQYIDLGDISARLFHQSGDRSKLIPFTLRLRDCLRGASQSVSLRLEGESSPINQDLLRIQ---GAVKGAGIRLLDDKGHALALNQKANTW-LLSPGDNELQLNAALESTQSSISAGDFRSLLRLIMEY. 202
492 1.000e-32gi|423121751|ref|ZP_17109435.1| hypothetical protein HMPREF9690_03757 [Klebsiella oxytoca 10-5246]  clstr ali  26  30............SALSVNPGASTGTQSTGGQIEFSGSITDTSCDIDSNSASQVIDLGKWASNFFTGAGSETTKTAFHIKVKDCPASVTK-VAVLFDGTRDSNNSNLLAVN---GGAQGVAIKLYEDDRTPINLGTVSRDQTVLATGTADLEFFADYISTSA-VSAGAANGTANFNMVY. 197
493 1.000e-32gi|22125762|ref|NP_669185.1| fimbrial protein [Yersinia pestis KIM10+]  clstr ali  16  1MKIKSSNVLIAAFAGLFI---AQSAFAADGTITINGKITDTTCSVNNGTKDGTVTLPVVSASALDGINSVAGTTPFNIVLTGCTGATMGNAYAHFEQGTTVEASTGRLNNSDIDGATGVQVRLLDKNSAPIVVGSQGNVVEDISGDGATLSYYAQYYANEANVEAGLVATNVDYTIVY. 179
494 1.000e-32gi|283832640|ref|ZP_06352381.1| S-fimbrial adhesin protein SfaS [Citrobacter youngae ATCC 29220]  clstr ali  22  2MDKFKLILFYISLCTSALA-------DDNFQINFTGTVSDATCEIQADSKNPEIKLGELYNKDLEVAGSTTDWVSFNITLLNCPSAV-KSVSARFSGTPDESDMTLYK---STGDAENIAVQLQDQNTQSVLSNGTVDTVNVISTGNAVFNLQARAKTPLGGVTAGTIESLIEMTFSY. 168
495 2.000e-32gi|4587125|dbj|BAA76627.1| EafA [Erwinia aphidicola]  clstr ali  22  1..MEIKKITAVALFALATTGVAHAADQGNGKVTFYGSIVNAPCSIAPGVDDQKIPLGQVSNSDLANGGEQ-KAVDFTIDLQNCDDATKHTVTATFTGMAGVDGR-----LGITGEAKGASILLRDGSGKKIELGTPTTAQT-LNGNANTLQFTAALKGDGTKIGTGAFTAVTNFTLAY. 174
496 2.000e-32gi|253988207|ref|YP_003039563.1| fimbrial regulatory protein papH [Photorhabdus asymbiotica]  clstr ali  22  22......MLMFSCIVVGAEAIAPRGAAQGHGRVSMQGAIIDTACAIDAGSRDQTIELATMPVSRVIRDGQ-GPKRPFSIRLINCGTPDWRHFQVTFDGAPDGNNFRLY------GVARGVALQITDTRGNQAYPGTP-LPVGALQEGHMTLNYAMRLVGNHQLLQVGQYRTTVRFRLDY. 192
497 2.000e-32gi|157369298|ref|YP_001477287.1| fimbrial protein [Serratia proteamaculans 568]  clstr ali  26  36............................DGTVNFTGSITADACKVDGGSTTLAVPMGKISTTSFTGAGTTSAASKFSLQLKTCPTAT--TATVKFDGIADGGDDKVLALTTGAGVATGVGIQLSDKSGAVLPLATNSTSYTTTKDVTNNLDFTARYIATAATVGAGTANATASFTINY. 192
498 2.000e-32gi|152986138|ref|YP_001346400.1| type I pilus biogensis protein FimA [Pseudomonas aeruginosa PA7]  clstr ali  21  1MNMFKRSVLAPLAVSGALLAMGSPAFAADGVVNFMGSISDVTCDINPGIGNVTVDLGTVAPGVFTAVGTASPFKNFDLVLSGAGCTDGKKASIAFDAVTNVDQSTGNLKLTSNSPAGGVQIQIYNNAGNKIPLGSASPQQAEIKNNTATLKYKASYVSTAATVTPGSGVSHIRYVLAY. 186
499 2.000e-32gi|115358771|ref|YP_775909.1| fimbrial protein [Burkholderia ambifaria AMMD]  clstr ali  19  1.MRFIKRSAIPFLLIXXXXXXXXXXXXXDGTVTFRGNIIASTCSVDGGS-DLTVPLPPVSTTALADVGSVAGRSAFSLALTGCTVGDDNPVKVFENGTNVDQSTGRLTIDSGAKAAEGVQINVLDSQQNHIPVGAQTGANTIDADGKAKVNYFAEYYA-ASAVKAGDVTSRVEYSLIY. 182
500 2.000e-32gi|375131772|ref|YP_004993872.1| fimbrial protein [Vibrio furnissii NCTC 11218]  clstr ali  26  6.NKSLLRVVAPSLFTALGVFSSSSVLADNVTVYFTGEIVESACGLASDSVHQTVQLGQYPTHVFKAKGDRTQPVPFTIRLTDCDTNIAQIASFTFYANPDSSG----KLFQVDGGAQGIGVRLF-YNHQPLDNG-AVATMKTLADGENVTHFAAAYEATTSPVTVGRAQSWALLKVAY. 181
501 2.000e-32gi|417630328|ref|ZP_12280564.1| F17 fimbrial protein [Escherichia coli STEC_MHI813]  clstr ali  23  6...........FILGILAAASSSATLAYDGTITFNGKVVAQTCSVSSGSKNLTVTLPTVSEASLAAATNTAGLTPFTIELTGCDTNAAQNVKAYFEPNATTDYDTGNLNIAASG-ANNVQIQLLNADGTPIKLGQDATTAVQIDNAAMKLRYNAQYYATAQA-TAGDVSATVNYTIAY. 178
502 2.000e-32gi|402565139|ref|YP_006614484.1| fimbrial protein [Burkholderia cepacia GG4]  clstr ali  18  1..MKLAFSSXXXXXXXXXXXXXXVSHAADGTITINGKIGTQTCTIDTGSKNFAVALPKVSTSALVNGGSTAGRTPFKISLKNCSPASGNVYTHFEAGTTVNSTTG--QLFNATGTAKNVEVGLLNGDSSNIALGDANSKAVALASGSAELPYYAQYVATGGSAGQGTVNTSVMYSIMY. 179
503 2.000e-32gi|300724597|ref|YP_003713922.1| Fimbrial adaptor, MrxG [Xenorhabdus nematophila ATCC 19061]  clstr ali  21  7.KLSKYVLPALFLFGIGSQQIAHAINAKDIDVRIKLTVLAPACSIKTEDKNIEVDFGNISNKDLYQH-HRTESRNFNLRLEKCDPRVTKSLKIKFSGETSKELPGLLAVKSTARTV-GVAIGMEKTDGTPIPFNKTSE-FPLLASRDNVIPFRAYVQAEGKKIGVGQFTAIATFEVNY. 189
504 2.000e-32gi|167588366|ref|ZP_02380754.1| Fimbrial protein [Burkholderia ubonensis Bu]  clstr ali  21  5.........IAFAMISAALALPMAAHASDGTITFNGAIEAQTCTINGGNQDATVQLPTVAASTLSTKGNTAGATNFTIALSDCAGKATQVRSFFEAGPNVDTASGNLRNN---GAAGNVQVQLLNSDGVVLQAGQRSNAASALTDGAATLVYGAQYYATGQA-TAGDVQTSVTYSIDYL 175
505 2.000e-32gi|317493327|ref|ZP_07951749.1| fimbrial protein [Enterobacteriaceae bacterium 9_2_54FAA]  clstr ali  24  1MSFKKTTFCLALSLAGLASAS---VMAADGTVNFKGKISDAPCSVSIPSSNQVVDLGTVPAADLNASGLKSTAKNFQIDLLNCSA-AAKSVTVTFGGSSPTGKDALFNISSPDGTATNVGIEVADSKGVDIKPNVASSSITLTPSASQSLYFTANYQAYG-VATTGDANATSDFTLTY. 179
506 2.000e-32gi|188535411|ref|YP_001909208.1| fimbrial major subunit [Erwinia tasmaniensis Et1/99]  clstr ali  24  8.....LASLVSLLTMSALPFYAKADPAAGGKIQFTGSVVSAPCVVDNDTDSQMVNLGQIAVNSLGKKGSTGSPVGFNIKLTGCDLTNYTKASIVFNGVPAGDDSTLSLNANGSGEAKNVGIQISQNNVPVKINGTTATSSNNLHVGSNLIPFAATYVATGDAVVAGSANAVVNFSVNY. 199
507 2.000e-32gi|386744214|ref|YP_006217393.1| MrfB protein [Providencia stuartii MRSN 2154]  clstr ali  20  9.......WSVLLLTTSFTSPLVHAAGQGVGTVTMNGEITDAACTIAMESRDQIIDMGVLPIGTIRQEGQ-GPKQDFEIQLVNCPTQTWRALRMTFDGPSDNGLFQVF------GEARGVGLLMQDAQSRQVVPGEASPEQDIVPP-SMRLAYQLRLVSDSRPLRAGYYQSLIRFKVDY. 178
508 2.000e-32gi|295098726|emb|CBK87816.1| P pilus assembly protein, pilin FimA [Enterobacter cloacae subsp. cloacae NCTC 9394]  clstr ali  23  38......................AGSQSTGGVINFTGKITLISCDITPASKSKTVDLGAWAKSYFDDH-SETTPREFKINVENCPETV-ESVAVLFDGTKDTVNDTLLQVTPGEGMATGVGVKLYNSDSTAIKPGTVSETTAPDAEGNAELTFYASLDKDGSEINAGDVNAVSNFLMVY. 192
509 2.000e-32gi|423095216|ref|ZP_17083012.1| fimbrial protein [Pseudomonas fluorescens Q2-87]  clstr ali  22  1MKKT----SLALCLGLATNLAGTAALANTGTIHFQGEITASTCVVNPGDGTITVYMGSVDASHFTQVGDELLGKDFVLRVSGCVIAPGQTATTTFNGAADSS-GDYFAVAPTPGHATGVSIAIRDKSGAAIAPGTSSVAYNLVAGGETDMLFHA