current user: public




Query: VFG1643 (gi:11322961) sfaD - SfaD protein [Escherichia coli 536], from VFDB

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# E-value Template Links and tools%idFirst MKISKMAVMLFLLPPAALAGNHWHVMLPGGNMRFQGKIIAEACSLALSDRQMTVDMGQLSSNRFHAAGEYGDPVGFDIHLQDCSTVVSQRVGISFYGVSDIHEPELLSVEEENDASDGIAIALFNESGELVKLNQPPENWVHLTRGDMKLHMQARYKATHYPVAGGKANGQVWFSLTYLLast
1 8.000e-63gi|300416219|gb|EFJ99529.1| fimbrial protein, partial [Escherichia coli MS 115-1]  clstr ali  55  53MKRKRLFLLASLLPMFALAGNKWNTTLPGGNMQFQGVIIAETCRIEAGDKQMTVNMGQISSNRFHAVGEDSAPVPFVIHLRECSTVVSERVGVAFHGVADGKNPDVLSVGEGPGIATNIGVALFDDEGNLVPINRPPANWKRLYSGSTSLHFIAKYRATGRRVTGGIANAQAWFSLTY. 230
2 9.000e-62gi|502671229|ref|WP_012907055.1| fimbrin fimI [Citrobacter rodentium]  clstr ali  57  1MQRMKACLLLLLSPACALAGNKWNVTLPGGNMRFQGVIIAESCRIEAGDRQMTVQMGQISSQRFHAPGEDASPVPFDIHLQECSTAVSQRVGIAFHGVADGKNPDVLSVGEGPGIATGVGIALFDKDGDLLPLNHPPVSWTRLYAGPTTLHFVAKYRATGHQVTGGLANAQAWFSLTY. 178
3 7.000e-61gi|501411004|ref|WP_012442570.1| fimbrin fimI [Erwinia tasmaniensis]  clstr ali  51  1MLKIRLGLFLMLLAPLSMAGNKWNVTLPGGQMRFQGELIAEACTVDIGDRQLIVHMGQVSSNRFKAVGDDADPVPFTLHLQDCNTNVSERVGIVFHGVADGKNPDVLSVGEGEGTATGVGIALFDDTGKMIPVNSVPQAWKPLVNGARELQFVARYRATGHAVNGGKADAQAWFSLTY. 178
4 2.000e-60T2D.3937626 [KEGG:K07351] fimbrial protein;|[COG3539] P pilus assembly protein, pilin FimA  ali  57  1MQGVKTGLLMFLFPPLALAGNHWNVTVAGGNMRFQGVIIAESCRVEAGDQQMTVNMGQISSNRFHSAGEDANPVPFDIHLQDCSTAVSQHVGVSFRGVADGKNPDVLSVGEGPGIATGVGIALFDNEDQLIPLNSPPGAWRRLYTGPTTLHFVAKYRATGNQVTGGAANAQVWFSLTY. 178
5 6.000e-60gi|376393308|gb|EHT05968.1| fimbrin-like protein fimI [Klebsiella oxytoca 10-5246]  clstr ali  57  4MQGMKSGLLFFLLSPLALAGNQWNVTLPGGNMRFQGVIIAESCRVEAGDQQLTVNMGQISSNRFHSPGEDTDPVPFDIHLQDCSTAVSQRVGVAFHGVADGKNPDVLSVGEGPGIATGIGVALFDKEDRLIPLNSPPGAWSRLYTGPTTLHFVAKYRATGHQVTGGAANAQAWFSLTY. 181
6 1.000e-59gi|490992227|ref|WP_004853960.1| MULTISPECIES: fimbrin fimI [Klebsiella]  clstr ali  55  1MHKMRSALFIFLLPTLALAGNRWNVTLPGGNMRFQGEIIAESCRVEAGDRQMVVTMGQIASNRFHATGEDAISVPFDIHLQECNTAVSQHVGVAFTGVADGKNPDVLSVGEGPGIATGIGIALFDKDNSLIPLNQPPRRWMQIYTGPTTLHFVAKYRATGKQVTGGVANAQASFSLTY. 178
7 1.000e-59gi|668996225|gb|KFD07849.1| FimI family fimbrial protein [Kluyvera ascorbata ATCC 33433]  clstr ali  58  1MQWMKWGLLVSLLPTVAQAGNHWNVTVPGGSMRFQGVIIAEACSVAASDRLMTVKMGQVSSHRFHAAGEESNPIAFDIHLEDCSTEVSQRVGVSFQGVASGKDPDVLSVGEGAGIATGIGIALFDAQGELIPLNQEPRRWVRLNDGANTLHFVAKYRSTDRQVVGGTANAQAWFALTY. 178
8 2.000e-59CGD_mc16a.204387 FOM5TJD02R7WBU|FOM5TJD02R7WBU|metagene|gene_2  ali  95  1.........................................................................VGFDIHLQDCSTVVSQRVGISFYGVSDIHEPELLSVDEENDASDGIAIALFNESGELVKLNQPPENWVHLTRGDMKLHMQARYKATHYPVDRGKG........... 95
9 3.000e-59gi|495729743|ref|WP_008454322.1| fimbrin fimI [Enterobacter sp. Ag1]  clstr ali  53  1MRGIKLILLSVLLPSLALAGNRTHVMLPGGNMRFQGTIVAESCRVEAGDRQMTVEMGRISSNRFHAPGEDSDPVPFALHLQDCNTNVSRHVGVAFMGVADGKNPAVLSVGEGPGIAEGVGVALFDAEERQIPLNAPAKAWTRIYAGPNTLHFIAKYRATGHQVTGGLANAQAWFSLTYL 179
10 3.000e-59gi|562747209|ref|WP_023654324.1| Fimbrin-like protein fimI [Erwinia piriflorinigrans]  clstr ali  50  1MLKIRLGLFLMALAPLSIAGNKWNSTLPGGQMRFQGELIAEACTVEAGDRQLTVYMGQVSSNRFSAAGDLADPVPFVLHLQDCNPNVSERVGIEFHGVADGKNPDVLSVGEGEGIATGVGIALFDDNGQIIPINSVPQAWRPLIHGSRVLQFVAKYRATGNLVTGGAANAQAWFSLTY. 178
11 1.000e-58gi|499797417|ref|WP_011478151.1| fimbrin fimI [Escherichia coli]  clstr ali  98  4MKISKMAVMLFLLSPAALAGNHWHVMLPGGNMRFQGKIIAEACSLALSDRQMTVDMGQLSSNRFHAAGEYGDPVGFDIHLQDCSTVVSQRVGISFYGVSDIHEPELLSVEEENDASDGIAIALFNESGELVKLNQPPENWVHLTRGDMKLHMQARYKATHYPVTGGKANGQVWFSLTYL 182
12 2.000e-58gi|550552343|ref|WP_022631439.1| fimbrin fimI [Klebsiella pneumoniae]  clstr ali  56  1MQGMKTGFLMFLLPPLALAGDHWNVMVAGGSLQFHGVIIAESCRVEVGDQQMTVNMGQVSSNRFHSTGEDASPVPFDIHLQDCSTKVSQQVGVSFRGVADGKNPDVLSVGEGPGIATGIGIAFFNKEDQLIPLNGPPSLWQRLYTGPTTLHFVAKYRATGKQVTGGMANAQVWFSLTY. 178
13 4.000e-58T2D.2691342 [KEGG:K07351] fimbrial protein;|[COG3539] P pilus assembly protein, pilin FimA  ali  96  1MKISKMAIMLFLLSPAALAGNHWHVMLPGGNMRFQGKIIAEACSLALSDRQMTVDMGQLSSNRFHAAGEYGDSVGFDIHLQGCSTVVSQRVGISFYGVSDIHEPELLSVDEENDASDGIAIALFNESGELVKLNQPPENWVHLTRGDMKLHMQARYKATHYPVTGGKANGQVWFSLTYL 179
14 7.000e-58gi|639192200|ref|WP_024531355.1| fimbrial protein [Serratia fonticola]  clstr ali  51  1MLKMQSAFFLMLLPPVVFAGNQWNVTVAGGNMRFQGEIIAEACRVEAGSHNMTVIMGQVSSNRFHAVGEDAGPTPFEINLLDCSTAVSQRVSVAFHGIADGKNPELLSVGEGNGVASGVGVAIFDEKNQLIPVNGPVRSWTTLNDGPLSVHFVAKYRATGHTVTGGAANAEAWFSLTY. 179
15 4.000e-56gi|490990598|ref|WP_004852331.1| fimbrin fimI [Klebsiella oxytoca]  clstr ali  56  1MQRMKSGXXXXXXXXXXXXGNQWDTMLPGGNMRFQGIVIAESCRVEVGDRQMTVKMGQISSNRFHSAGEDTNPVPFDIHLQECSTAVSQRVGVAFHGVADGKNPDVLSVGEGPGIATGIGVALFDNTGSQIPLNAPPGAWTQLHTGPTTLHFVAKYRSTGNQVTGGAANAQAWFSLTY. 178
16 8.000e-56gi|668993751|gb|KFD05459.1| type 1 fimbriae major subunit [Kluyvera ascorbata ATCC 33433]  clstr ali  37  1MKLSQLALLLNALIPLAWAGNHHVVTVPGGDVHFTGAVVEAACAVDTNSDAQTVDMGQVRSSLFSGTGTWGNPQPFTIVLKDCDITISQQVGVAFNGVTDESDPTVLAVTSGAGSAAHVGIGIFDSSGSVIVPNTSPQLFTTLKDDTNVLNFVAKYRATAENVSPGEADAQTWFTLTYM 181
17 3.000e-55gi|506355425|ref|WP_015875144.1| fimbrin fimI [Klebsiella pneumoniae]  clstr ali  55  52...................GNHWNVTLPGGSMRFQGLIMASSCRVEAGDRQMTVNLGQISSNRFHAVGEDSNPIPFAIHLQDCSTAVSQHVGVTFHGVADGKNPDVLSVGEGPGIASGIGIALFDSQGQQLPLNRPADRWISLYRGPTTLNFVAKYRATGRQVTGGAANAQAWFSLTY. 210
18 9.000e-55gi|515951823|ref|WP_017382406.1| MULTISPECIES: ferrous iron transporter B [Enterobacter cloacae complex]  clstr ali  37  8.........ALLIAGTALFAVLPAAAKDDGSVTFQGQVVNAACSVSMDSQDQIVHMGQVRNSQFIAAGDWAKPVPFFITLEACDTSVSQRAGVLFSGESDGNDPQVFRAGYGPGAATGIGIGLFDAMGNLVKPDTAPPWYRPLQDGENRLSYIARYRATEDSVNAGTANAQVWFIVFY. 176
19 2.000e-54gi|491095550|ref|WP_004957154.1| fimbria A protein [Serratia odorifera]  clstr ali  25  35MKLNKVMMAAVIAFGATSFAHAAVKDQGHGKVNFIGSIIDAPCSIAPESIDQTVDLGQVSNVALKDGG-TSNPRPFDIKLEQCDTTTLKSVSVTFTGTESTGNKDLLAI---AGTAKGAGIAIS-YDGKPITLGDATPSQNLNNN-NNTLHFAAYLQGEGAAVVPGDFTAVADFTLAY. 208
20 1.000e-53gi|674725670|gb|KFK95653.1| fimbrial protein [Serratia sp. Ag1]  clstr ali  45  18................AIAENLWHDQLPGGVMRFQGEVIAETCSVETRDRHLVVTMGHITTDRFQSVGDESGAIPFDLHLQNCNPAVSRNVGVMFHGMADSNNPDMLSVGDGPGVAKGVAVALFDDQGRFVPLNTAPRYWVPVQDGPLTLHFVAKYRATGQAVNDGQANAQAWFALTY. 179
21 1.000e-53gi|323189294|gb|EFZ74577.1| type-1 fimbrial protein subunit [Escherichia coli RN587/1]  clstr ali  31  1MEFFMKKVIFALSALALTSGSVFAADSGDGTVKFTGEIVDAACVLSVDSQNQEVVLGQVQKSVFAAVGDKSPSKPFEIKLEDCDITTLKKAKVSFSGVGDTDKPELISVSTEAGAAKGVGIGIYDNSNTLVAMNS-GESSTDLKKGQTVLYFTANYVSTLAAVTTGYGNAQVDFNLSY. 177
22 4.000e-53gi|695774968|ref|WP_032697819.1| fimbrial protein [Raoultella planticola]  clstr ali  66  1MKISILVLILFLLSPAALAGNRWHVTLPGGNMRFQGEVIAEACRVVLEDQQMTVSMGQISSAHFHSAGEYAEPVAFDIHLTDCSTAVSQRVGVSLRGVADSREPDLLAVNDDKEASDSVAIAFFDKSGELIKLNHPPEIWKSLVSGMVTLHFLARYKAIHYPVTGGKANGQAWFFLTY. 180
23 4.000e-53gi|544752535|ref|WP_021179445.1| type 1 fimbriae protein FimI [Serratia fonticola]  clstr ali  47  30............................GGLMRFQGEVIAETCSVEAGDRNLTVSMGNITTDRFRMPGDEADPVPFDLHLQNCTSTVSRNVGVMFHGMADSNNPQVLSVGDGPGVASGVAVALFDDRGRFIPLNTAPRYWVPLQEGPVILHFVAKYRATGQPVNNGLANAQAWFALTY. 179
24 5.000e-53gi|546165487|ref|WP_021807339.1| type 1 fimbriae protein FimI [Serratia fonticola]  clstr ali  44  3.KKQLCAGIVLLLMASALAGDRHHVVIDGGITHFRGSLTAEACTVATDSQNQTVDMGQLRSNQFSGVGSLTSPVGFSIRLTECSTAVSDQVGVTFFGVTDGKDPLVLKAGEGVNAATGVGLALFDEQGQIIAPNTQPRVWSRLHEGDNSLRFHARYRATSRQVTGGNADVFTWFALTY. 181
25 5.000e-53T2D.3697449 [KEGG:K07351] fimbrial protein;|[COG3539] P pilus assembly protein, pilin FimA  ali  31  1MEFFMKKVVFALTALALTSGSAFAAESGDGTVKFTGEIVDSPCVLSVDSQNQEVVLGQVQKSVFAAVGDKSPAKPFEIKLEDCDTTTMKKANVSFTGVGDADKSDLISVSTEAGAAKGVGIGIYDNSNTLVALNG-GKASVDLKTGQTVLYFTANYVSTLATVTTGYGNAQVDFNLSY. 177
26 1.000e-52gi|503993401|ref|WP_014227395.1| ferrous iron transporter B [Klebsiella oxytoca]  clstr ali  37  9..KAFSLAGAFLFPALAQAGNHHVVTVKGGDVEFQGAVVNAACAVDAGSEDLTVEMGQVRSNEFHGLGSWTDPQAFTITLKDCDTTVSQQVSVAFRGLTDGKDPGVLAVTDGAQSAQGVGLGIFDNQGNQIIPNTQPMNFTAIQDNTTVLNFVAKYRATSRTVVAGDANAQTWFTLTYL 185
27 2.000e-52gi|727164938|ref|WP_033635977.1| fimbria A protein [Serratia marcescens]  clstr ali  24  1MKLNKIMMAAVVAFGMTSVAHAAVQDQGHGKITFNGAIIDAACSISPESIDQTVELGQISKVALKDSG-TSTPRNFAIELENCGEDEANKVQVTFTGMEANGSNGLLGI---TGTAKGAGVAIVDSSGKKVTLGEPTKAQ-ELQNGNNTLNFSAYLQASGAAVVAGDFQAVADFTLAY. 178
28 2.000e-52gi|647322016|ref|WP_025759182.1| long polar fimbrial protein LpfA [Enterobacter cloacae]  clstr ali  26  1..MKKIIALFPVLAVMSSSVFAAAS--GDGTIKFTGEIVDSPCVISVDSQNQEVVLGQVKKSVFTAVGDKSSSRPFEIKLEECDISRKTKVNVSFSGIADETNDSLLSVNTEAGSASGVGIGIYDNANKLIDVNT-GKATTTLQAGQTVLYYTANYVATKAAVTTGYGNAEVDFNLTY. 173
29 3.000e-52gi|668724171|gb|KFC09649.1| type 1 fimbriae major subunit [Trabulsiella guamensis ATCC 49490]  clstr ali  32  1...MKKVLLSAALLPFAVVVTMQTANASDGTIRFNGSIVDSPCVISSNSQNQEVDMGAVKSSTFSTAGDKSTATPFQIRLEECDLTAGKTVNVVFNGIGDDDDTTLLSVDNGAGSATGVGIGLFDAKGEAIALND-GASLEALSEGETVLNYDARYVSTKDAVTVGSASGQVDFSLTY. 175
30 5.000e-52gi|501082908|ref|WP_012133455.1| type-1 fimbrial protein subunit A [Citrobacter koseri]  clstr ali  28  24MKLKLMTSVIAGLMFAAGAAHADPVSVSGGTVHFEGELVNAACAVSTKSADQTVTLGQYRTASFTAVGDTSAQIPFTIVLNDCDPSVAATAAVAFSGQADGTNDSLLAVVSGDNTAGGVGIEILDNTSSPLKPGATFSTAQALVEGSNTLRFTARYKATAADTTPGQANADATFIMKY. 205
31 6.000e-52gi|493711469|ref|WP_006661100.1| fimbrial subunit FimI [Providencia alcalifaciens]  clstr ali  43  4....LLAVSLLLFSPFLQAGNKWKVQLPGGGMRFQGELIAEGCTVETSDRNLVVNMGQVRTNAFKAPGQDSAPTAFDLHLRECSNAVSEYVSITFNGVANERNPDIFSIGDGPNTARGVGVAIFDSKNTLIPVNSAPRKVANLRDGDMTLHFVAKYRSTSENIMGGKANTQALFSLTY. 177
32 7.000e-52gi|639216395|ref|WP_024554136.1| fimbrial protein [Cronobacter helveticus]  clstr ali  26  1MKRFITSACAALLSGLILICS---AQAHDGTVYVSGKINETTCAVSPDSKNFTVDLGSVASKQFNNVGDGSDYRPFVIKLENC-AAAAQTVSVHFDGTPDSKNADLLAITSDTASAAGVGIAIYNQDKSIIPLGDESVKFPLTPDASATLNFYARYIANGDAIVAGTANASATFILTY. 175
33 2.000e-51gi|640474022|ref|WP_024914523.1| fimbrial protein [Serratia fonticola]  clstr ali  42  3...KMGAGILLTLLLGPKAIADWNDRPLGGLMRFQGEVIAETCTVETKDQHLMVSMGHVTTDRFQLAGDEADPVLFDLHLQNCNPTVSRNVGVIFHGMADKNNPEMLSVGDEPGVATGVAVALFDNRGRFIPLNTAPRYWVPLQDGPLTLHFVAKYRATGQPVSDGLVNAQAWFALTY. 177
34 4.000e-51gi|546163224|ref|WP_021805087.1| Fimbrial protein [Serratia fonticola]  clstr ali  28  1MKMNKIVMAMVMASGISAFGAMAATDQGSGNITFTGSIIDAPCSITPESSNQTVDLGQVSNSLLAKAG-TSTPRNFTIDLEKCDTTTKKNVVITFGGSKDTENDKLLGI---TGTAKGAGVALTDGSGTQITLGVPSTARGLL-AGNNKLNFSAYLQGNKATVTPGEFSSVANFTLTY. 184
35 4.000e-51gi|661295770|ref|WP_029988843.1| fimbrial protein [Serratia marcescens]  clstr ali  38  14.....VLALLSMSGGSALAGNRHHVIIDGGMVHLRGALTEAACSVSTESAHQIIDMGQFRSNQFGDLGSFASPVEFNIRLTECSTAVSNTVGVAFYGVTDGKDPQVLKAGEGENAATGVGLALFDRNGVIIPPNTPPRIGMALHEGENILRFMARYRATSRQVVAGNADASTWFALTY. 186
36 5.000e-51gi|668973533|gb|KFC88795.1| type 1 fimbriae major subunit [Hafnia alvei ATCC 13337]  clstr ali  30  1MSLNKSVLCLALSL----AAFSQCSMAKDGTINFTGSIVESPCVVSRDTQYQDVNLGEVQSSTFVQAKDTSAFKDFNIDLEECNTTTLKNANVTFRGTSDDIDTDLLAVGGEAGAAKGVGIEITDQSGAIVSMNKASSD-MSLVNGQNILYFKARYKATKVPVVSGHANAQADFQIAY. 173
37 7.000e-51gi|521292581|ref|WP_020456849.1| type-1 fimbrial protein subunit A [Enterobacter sp. R4-368]  clstr ali  26  1MKMKLMASSVA-AGLMLMAGAVQADTVSGGNIHFDGELVNAACAVSTASADQTVTLGQYRTASFPDVGATSGSVPFNIVLNDCDPAIFPTASVAFSGQADAADNTLLAVTSSSATASGVGIEILDNASKTLSPDGASSTAQALLEGTNTLHFSARYKATSATATPGQANADATFIMKY. 180
38 7.000e-51gi|701202662|gb|KGP41803.1| fimbrial protein [Morganella morganii]  clstr ali  26  1MKLKNITLIMVSVLALTSAVYAAVITVNGGTVHFKGEVVNAACAIDSESVNQTVELGQVRSARLTNAGDTSSAVGFNIKLNDCDPEISGTAAVAFLGTTITGNDDTLALNSAAGAAKNVGIQILDRAGQVLALGATFSAKTDLINGTNVLPFQARYYATGQSV-AGTANADATFKVQY. 186
39 9.000e-51gi|490209955|ref|WP_004108358.1| fimbrial protein BcfF [Klebsiella oxytoca]  clstr ali  28  8............ACMACCLLTTATADAHDGRVYVTGTITDNTCTLSPDSENINVEMGSVSNRQFYQAGDGSAWQPFAIDLQNCGSTVSG-VTVSFSGTANQRNTDLLALIDAADDATGIGIGLYDQDKHLIPPGQTS-EVIALSPGSAHLQFYARYIADGSAVTAGKANASATFILAY. 173
40 9.000e-51gi|119351637|gb|ABL63534.1| FimA [Salmonella enterica subsp. enterica serovar Enteritidis]  clstr ali  29  24MKHKLMTSTIASLMFVAGAAVAAPVSVSGGTIHFEGKLVNAACAVSTKSADQTVTLGQYRTASFTAIGNTTAQVPFSIVLNDCDPKVAATAAVAFSGQADNTNPNLLAVSSASTTATGVGIEILDNTSSPLKPGATFSAKQALVEGTNTLRFTARYKATATATTPGQANADATFIMKY. 207
41 9.000e-51gi|486394505|ref|WP_001604058.1| long polar fimbria protein A [Escherichia coli]  clstr ali  32  1MKK----VVFALTALALTSGSVFAADSGDGTVKFTGEIVDSPCVLSVDSQNQEVVLGQVQKSIFAADGDKSPAKPFEIKLEDCDNSTLKKANVSFSGVGDAIKSDLVSVSTEAGAAKGVGIGIYDNKNTLVALNG-GKASVDLSKGQTVLYFTANYVATQIPVSTGYGNAQVDFNLTY. 173
42 1.000e-50gi|446690872|ref|WP_000768218.1| type-1 fimbrial protein subunit A [Escherichia coli]  clstr ali  26  1MKLKFISMAVALTLGVATSASAAPATVNGGTVHFKGEVVNAACAVNMNSVDQTVLLGQVRTKKLANLDDVSGPVGFNIQLDECDSTTSGSVKILFSGTPVAGKNNALAIQSSSGAATNVGIQILDSSGNPVTLNSDQSAVYTLTDGTNNIPFQARYIATGQS-TAGTANADATFKVQY. 180
43 1.000e-50gi|493361084|ref|WP_006317526.1| MULTISPECIES: fimbria A protein [Serratia]  clstr ali  26  1MKLNKLMLATVIAFASASVAHAAS-NQGSGKVTFTGEIIDAPCSVAPESVDQTVPMGQISSRLLAKEGK-SSSEPFSIELKDCSIATMKNVQVTFTGTPDPDNSKLLAL---SGTATGAGIMIYDNHSKDVELGTATDGQG-LTEGNNSLKFAAYLQGSSAAVVPGEFTSVANFTLAYL 176
44 2.000e-50gi|506356545|ref|WP_015876264.1| fimbrial major protein [Burkholderia glumae]  clstr ali  23  165...........VAGALLALAVSTSAHAFDGTVNFNGNVVDAPCTISTDGKNLQVSMQDISTGAVLDG--SAPKTPFSIKLNNCSTAIKKTVQVTFSGTKAGD--GMLALTSESGAAKNVAIQLY-QDGKALKLDTTSAS-VKLKTGDNDIPFAAQYTSNGGTPVAGKANAIAQFTLSY. 325
45 2.000e-50gi|386198579|gb|EIH97571.1| fimbrial protein [Escherichia coli 96.154]  clstr ali  41  3.KKKLCAAVTLWLSVFASAGNRHHVVIDGGITHFRGILTAEACTISTDSRSQTVNLGQFRSNQFNGVGSLTSPVGFSIRLTECSTAVSDQVKVAFYGVTDGKDPQVFKAGEGVNAASGIGLALFNELGQIIEPNTHSGFLSRLHEGDNTLRFHARYRATSREVTGGNANAFTWFALTY. 181
46 2.000e-50METAHIT V1 GL0022199 [Complete] locus=scaffold6741_1:3761:4363:+  ali  27  14MKLSNIATVIATLALVAGAAHAAPVSVNGGTVHFKGELVNAACSVNTDSSEQTVNLGQYRTAKFTKVGDTTSNIPFTIELNDCDPAVAKTAAVAFTGQIDATDKTLLAVSSGDNSAKGVGIEILDSKSSTLTPGATFSAAQNLIEGTNTLNFTARYKATAATTEPGQANADATFVMKY. 199
47 3.000e-50gi|397745163|gb|EJK92371.1| fimbrial protein [Klebsiella pneumoniae subsp. pneumoniae DSM 30104]  clstr ali  25  12MKLNKIVMALVLAFSTVSG--AQAADQGHGKVTFTGSIIDAPCSITPQSIDQTVDLGQISKEALLSGGK-STPRNFSIGLENCSPATKNKVQVTFTGMESAAKNGLLGI---TGTAKGASVAITQADGQIIKLGVPTKEQV-LQDGNNTLSFAAYLQGDGDSVTEGEFQAVTDFTLAY. 188
48 3.000e-50gi|727187253|ref|WP_033649096.1| fimbria A protein [Serratia marcescens]  clstr ali  22  1MKLNKIMLAAVMAFGVSSVAHAAVKDQGHGKVTFSGSIIDAPCSIAPESIDQTVELGAISNVALKNGGK-STPRNFQIKLENCELTTNNTVSLTFSGSASEADSKLLGI---TGTAKGAGIAITDGAGTNIELGKASKAR-DLQNGANTLSFSAYLQASNATIVPGEFQSVADFTLAY. 181
49 4.000e-50gi|640473867|ref|WP_024914402.1| fimbrial protein [Serratia fonticola]  clstr ali  43  3.KMGAGILLTLLLGPKAIANNPRDEPSLGGLMHFQGEVIAETCSVETKDRNLMVSMGHITTDRFQLASDESGAVPFDLHLQGCNPTVSRNVGIMFHGMADKNNPEMLSVGEGPDVATGVAVALFDDRGQFVPLNTAPRYWIPLQDGPLTLHFVAKYRATGLSVNDGLANAQAWFALTY. 179
50 4.000e-50gi|518283248|ref|WP_019453456.1| fimbria A protein [Serratia marcescens]  clstr ali  25  1MKLNKIMLTAVLAFGV--SSLAHAADQGHGKVTFTGSIIDAPCSISPETVDQTVDMGQVSNVALKNGGK-SAPRQFDIKLEQCDNSTLKTVTTTFEGKASTANKDLLGI---VGTASGASIAITDTASNPIKLGTATAPQ-NLGTGTNTLRFAAYLQGDGAAVVPGDFTAVADFKLAY. 173
51 4.000e-50gi|569537959|gb|AHE60266.1| fimbrial protein [Escherichia albertii KF1]  clstr ali  30  1MEFLMKKVVFALSALALTSGSVFAADSGDGTVKFTGEIVDTPCVLSVDSQKQEVVLGQVQKSVFTAAGAKSPSKPFEIKLEDCDTGSGKTVKVGFNGVGDSDSNGELSVSTEAGAATGVGIGIYDNTNTLIKLNS-GEAETALKDGQTVLYFTANYVSTKDTVTTGYGNAEVDFNLSY. 179
52 5.000e-50gi|493583881|ref|WP_006536896.1| fimbria A protein [Proteus penneri]  clstr ali  24  1MKLNKI-MIAAITFGMVSIANAAPTDQGHGTVKFEGSIIDAPCSITPDTVDQTVNLGQISNVILKDGGK-SSPKNFYIKLENCDTSLKKSVTVAFSGANSAGNPDLLGI---TGTAKGASIAITDGSGSVIKLGQSSNPQGIL-DINNTLAFSAYLQGTGAVIVPGEFSSIANFTMSY. 178
53 6.000e-50gi|544754735|ref|WP_021181632.1| Fimbriae-like adhesin SfmA [Serratia fonticola]  clstr ali  27  3.NKQRFIKSVLGLALLSVGTVASAAIVSGGTVHFTGQIVNAACAVSADSLDQTVKMGQFRTANFTSVGARSNAVPFTIKLEDCDTKVSTTAAASFYGNQDANDPTVLNVGGAAGTASGVGIEISDHTGKVLTPGSMFSTAQTLVDGSNVLNFTARYKSTKADVTPGEADADATFKMQY. 184
54 6.000e-50gi|490200743|ref|WP_004099235.1| fimbrin fimI [Klebsiella oxytoca]  clstr ali  50  15...............ALEAGEYWETMLPGGAMRFQGELLAEACSVEISDRSLTVNMGQIRTNMLHAPGEDADPVEFDIHLRDCNRNVSQYVGVTFNGVADGKNPDVISVGEGPGIAQDIGVAIFDASNTLIPLNSPPRRVASVVNGETILHFVAKYRATGHHVMGGKADAQAWFSLTY. 177
55 8.000e-50gi|493362782|ref|WP_006319214.1| fimbria A protein [Serratia plymuthica]  clstr ali  27  1MKLNKIMLATVLAFGV--SSMAHAADQGQGKVTFTGSIIDAPCSIAPESVDQTVDMGQISNVALKNGGK-SMPRQFEIKLEQCDTTTMKTVTTTFNGDSSSANPDLLGII---GNASGASIAITDMASNLIKLGEATPPQT-LNDGNNTLRFAAYLQGDGAAIVPGDFTAIADFKLAY. 173
56 8.000e-50gi|505181234|ref|WP_015368336.1| fimbrial protein BcfF [Enterobacter aerogenes]  clstr ali  31  5...........LYLCWGLALVASGALAHDGRVYVTGTITDNTCTLSPDSENIQVDMGTVSNRQFYQAGAGAEWQPFSITLQNCGSTASG-VTVSFSGTSDPQDGDLFAVNTGADTASGIGIALYDKNKQQIAPGAQS-DVLALTAGAASLQFYARYVADGAPVAPGAADASATFVLSY. 171
57 9.000e-50gi|333391207|gb|EGK62327.1| type-1 fimbrial protein [Enterobacter hormaechei ATCC 49162]  clstr ali  28  14MKLSNIATVIATLALVAGAAHAAPVSVNGGTVHFKGELVNAACSVNTDSSEQTVNLGQYRTAKFTKVGDTTSNIPFTIELNDCDPAVAKTAAVAFTGQIDATDKTLLAVSSGDNSAKGVGIEILDSKSTTLTPGATFSAAQSLIEGTNTLNFTARYKATAATTAPGQANADATFVMKY. 199
58 9.000e-50gi|639138767|ref|WP_024484219.1| fimbria A protein [Serratia fonticola]  clstr ali  21  1MKLNKIMMAAVIALGVSSVAHAAVKDQGHGKVTFTGSIIDAPCSITPDSIDQTIELGQISKVALKDGGK-STPRNFSIDLENCEVGNNNKVTVTFTGMESMATNGLLGI---TGTAKGASVAITDGTGKVIELGKATKAQ-LLQNGNNTLSFAAYMQGDGAAVTEGEFQTVADFTLAY. 177
59 1.000e-49T2D.2923154 [KEGG:K07351] fimbrial protein;|[COG3539] P pilus assembly protein, pilin FimA  ali  30  1MKK----VLFALSALALTSTSVFAADAGDGTVKFTGEIVDAACVVSPDTQKQEVVLGQVNKSVFTAMGDKSTATPFKIKLENCDISTFKNVEISFNGVGDADNSKLVSVSTEPGAATGVGIGIYDNTNTLVDLNT-GKSATVLKEGQTVLYFTANYVSTKDAVTTGYGNAEVDFNLTY. 173
60 1.000e-49gi|687256486|gb|KGD79646.1| type-1 fimbrial protein subunit A [Tatumella morbirosei]  clstr ali  24  1MKLNKIILAMLTSASLLAAASVQAVTVQGGVVHFNGSLVNAACAVSTESANQTVNLGQYRTASFQSVGDTSATIPFKIVLNDCDSTVASTAKVAFSGQTEASDDTLLAINSGSNTATGVGIEILDEDSSVMTPGATFSKGHSLIDGTNTLNFAARYKATSAEPTPGQANADAVFTMQY. 195
61 1.000e-49gi|639138408|ref|WP_024483865.1| fimbria A protein [Serratia fonticola]  clstr ali  22  1..MNLNKTLLAAVIAFGSASMAHAADQGHGKVTFTGSIIDAPCSISPDTVDQTVELGQISNAALKNGGK-STARNFNIQLENCDPAAKNKVAVTFTGMESAAGNGLLGI---TGTAKGASIAITQGDGEVIKLGKPTKQQ-LLQDGNNTLSFGAYMQGDGAAITEGNFQSVADFTLAY. 176
62 2.000e-49gi|545295469|ref|WP_021575757.1| type-1 fimbrial protein, C chain [Escherichia coli]  clstr ali  27  1MKLKFISMAVALTLGVATSASAAPATVNGGTVHFKGEVVNAACAVNMNSVDQTVLLGQVRSATLGSDGKTSGSVGFTIQLDDCDLTTTQSAKIIFSGTPVTGKTNVLALNSASGAATNVGIQILDSKGQPVELNSDAASEYTLTDGTNKIPFQARYYATGQA-TAGIANADATFKVQY. 182
63 2.000e-49gi|727190836|ref|WP_033652621.1| fimbria A protein [Serratia marcescens]  clstr ali  25  1MKLNKI--MLAAVMALGVSSLAHAADEGHGKVTFTGSIIDAPCSIAPDSLDQTVELGAISNVALKNGGG-SNPRPFSIKLENCELTDAKKVALTFSGAKSAADETLLGI---TGSAKGAGIAITDGAGTIITLGTPSKAQGLL-NGSNTLAFSAYLKASGAVITPGDFQSVADFTLAY. 175
64 2.000e-49gi|490196879|ref|WP_004095415.1| fimbrial protein [Hafnia alvei]  clstr ali  27  19.KTCLICVVTGLFCRDVIAGNHHVVTVYGGQLNYKGAVVSAPCSVSIDSQNQLVTMGQVRVKEFDGIGSWSQSQAFTIKLEDCDTDLAPTAGVLLKGITDGKDPQVFATEHSQGSAKGVGIGIFDSQGNLIIPNSAPITFMSLIDGNNTISFSAKYRATENTVLAGSANAAISFEMVY. 195
65 3.000e-49gi|573012720|dbj|BAO36072.1| fimbrial protein [Serratia marcescens SM39]  clstr ali  24  1MKLNKLMLATAIAFSTASVAHAAPTNQGSGTVTFSGEIIDAPCSITPDSVDQTVPMGQISSRILAKEGK-SSAEPFSIELKDCALNTMKNVKVTFTGTPDAVNSKLLAL---SGSASGAGIVIYDQHAKEVELGTATDGQG-LNEGNNALKFAAYLQGNSAAVVPGKFTSVANFTLAY. 177
66 4.000e-49METAHIT MH0025 GL0054416 [Complete] locus=scaffold33438_1:15992:16555:+  ali  27  1MKLKHVGMIVVSVLAMSSAAVSVTTTVNGGVIHFKGEVVNAACAIDSESMNQTVELGQVRSSRLAKAGDLSSAVGFNIKLNDCDTNVSSNAAVAFLGTTVTSNDDTLALQSSAGSAQNVGIQILDRTGEVLILGATFSAKTDLIDGTNILPFQARYIALGQSV-AGTANADATFKVQYL 187
67 4.000e-49gi|490365263|ref|WP_004244927.1| fimbria A protein [Proteus mirabilis]  clstr ali  25  30MKLNKLALVLG-LGLSVVAGSALAADQGHGTVKFVGSIIDAPCSITPDTENQTVPLGQISTAALKDGG-RSNSRDFKISLENCTTETYKTVQTTFTGSEATELEGSLGIE---GIAKNAAVVITDAGGKQIKLGTPSAAQ-NLRDGNNDLNFAAYLQGSASAAVPGDFTAIATFALTY. 203
68 5.000e-49gi|490843316|ref|WP_004705388.1| fimbrial protein [Yersinia aldovae]  clstr ali  30  1MKK------LILAALVAASFSAPVYAAPPGTIRFEGEIVTGACGIDADSLDQTVNLGQVPSHMFKAIGDRSTAVPFEIVLTDCDTTTSKNATVTFTGTGHAEKSAILGV---TGAATHVGIRLQGGSNEYLDLGTVSKP-TLLSNGDNHLKFSAMYESTAANVTAGDADATAQFTVNYL 169
69 5.000e-49gi|516502766|ref|WP_017891204.1| hypothetical protein [Serratia sp. S4]  clstr ali  27  3.NKQRVFKSVLGLALLSAGTMASAAIVTGGTVHFTGQIVNAACAVSADSTNQTVNMGQYRTAHFTGVGTRSNAVPFTIKLEDCDTTVSTQASTAFSGSADATDPTVLTVSNTSGTASGVGIEISDRIGQVLKPGANFSNAQKLIDGANVLAFNARYKSVAAAVTPGQANADATFTMQY. 184
70 7.000e-49gi|573012243|dbj|BAO35595.1| fimbrial protein [Serratia marcescens SM39]  clstr ali  23  1MKLNKI--MLAAVMAFGVSSLAHAANQGSGTVTFSGSIIDAPCSIAPESIDQTVELGAISNVALKNGSKASTPRDFHIQLEGCDLKTNNTVTLTFNGTASETDKKLLAI---TGEAKGAGIAITDANKNLIELGKASNA-IELQNGRNKLSFAAYLQGSSASIVPGEFQAVADFTLAY. 180
71 8.000e-49gi|668963983|gb|KFC81419.1| fimbrial subunit [Buttiauxella agrestis ATCC 33320]  clstr ali  31  5..........FLLTAALSAGSIFAALAHDGTMNITGTITDNTCVVSADSQNLTVEMGNVSSKQFYRAGAATRYEPFTIHLERCDAAASR-VSITFIGTPNSVNSQLLAVTTQAQSAQGVGIGLYDSDKTLVPVNNLSGGTALTSRQANTLPFFARYVADGSNVSPGAANATITFTLTY. 172
72 8.000e-49gi|471241595|gb|EMR19020.1| hypothetical protein KP700603_14879 [Klebsiella pneumoniae 700603]  clstr ali  48  20..................ANNIWTVTLGGGDVRFRGVIIAESCRVEAGDKHMIVDMGQISSNRFHHVGEDVNPVPFSIHLQECNTAVSDRVSVTFHGIADEKYPEVLSIGDKQDSAKGVSIALFDNEDRLIPLNSTPISWNRLYKGPKTLNFVAKYRATSNVVTGGIAKAHAWFALTY. 179
73 9.000e-49gi|518286010|ref|WP_019456218.1| hypothetical protein [Serratia marcescens]  clstr ali  27  4.KQRVIKSVLAAVLLSAGTMATAATTVPGGTVHFTGQIVNAACAVSAGSTDQTVNLGQYRTANFKAVGDRSGAVPFKIQLQDCDTSVSTQASVAFSGTAVSSDANVLAVSNXXXXXXXVGIEIGDHAGKVLPPGSVFSTAQTLIDGVNVLNFTARYKATAASVTPGQADADATFTMQY. 185
74 1.000e-48gi|491077109|ref|WP_004938731.1| P pilus assembly protein, pilin FimA [Serratia marcescens]  clstr ali  25  1MKLNKIMMAAVIAFGA--SSFAQAADQGHGKVTFTGSIIDAPCSIAPESIDQTVDLGQVSNVALKNGGK-SNPRPFEIKLEQCDTTTLKTVKTTFSGIASSTNKDLLGI---AGTASGAGVAI-TYGGQPIKLGQATAAQT-LNTGNNSLNFAAYLQGEGAAIVPGDFTAVADFTLAY. 172
75 1.000e-48gi|291070313|gb|EFE08422.1| fimbrial protein [Citrobacter youngae ATCC 29220]  clstr ali  25  24MKHKLIASSVIASLMLVXXXXXXPVSVSGGTVHFEGELVNAACAVSTQSSDQVVTLGQYRTASFTAVGDTTAQIPFTIVLNDCDPKVAATAAVAFSGQTDITNNNLLAVSSSSTTAGGVGIEILDNTSTALKPGATFSTAQALVEGTNTLRFSARYKATATSATPGQANADATFIMKY. 211
76 1.000e-48gi|648450392|ref|WP_026142143.1| fimbrial protein [Serratia sp. S4]  clstr ali  40  1......MALLIIAGGTAMAGNRHHVIIDGGRVHLRGVLTAAACSVSTESANQVIDMGPLSSNQFGDLGSYAPPIEFIIRLTECSTAVSNTVGITFFGVTDGKDPQVLKAGEGENAASGVGLALFDYKGDIILPNTAPLSWANLHEGENILRFMARYRATSRQVVGGNADASTWFALTY. 172
77 2.000e-48gi|668975022|gb|KFC89915.1| type 1 fimbriae major subunit [Hafnia alvei ATCC 13337]  clstr ali  30  15.........ACLLLTSSMALSQSMAKVDGGSVHFKGTVVNAGCAVDTNSIEQEVSMGQIRRDAFTGVGSWVDPVGFTITLTDCDISVSQSAGVAFQGPSDIHDPLVFAVANGPGSAIGVGLGIYDEQSNLIVPNSAPRAYKTLIDGTNVLHFIAKYRATEQLPVAGDASVTANFIVLY. 183
78 2.000e-48gi|353634460|gb|EHC81031.1| Long polar fimbria protein A precursor [Salmonella enterica subsp. enterica serovar Senftenberg str. A4-543]  clstr ali  28  1MEFLMKKVVFALSALAVVSTSAFAAESGDGTIHFTGEIVDAPCVVSTDSQNQEVVLGQVKKNIFKAIGDKSVSKPFQIKLEDCDITSQTKVNVSFAGVGDADDATLVSVNTEAGAATGVGIGIYDNANKLVEMNT-GKSTTTLAAGQTVLYYTANYVATKDTVTTGYGNAEVDFNLSY. 190
79 2.000e-48gi|727159123|ref|WP_033631557.1| fimbria A protein [Serratia nematodiphila]  clstr ali  24  1MKLNKIMMAAVLAFGVTSVAHAAVKDQGHGTVTFKGAIIDAPCSITPETVDQTVNLGQISNVALKNGGQ-STPKNFQIKLENCELNAGNAVAITFTGAASVEDAKLLGI---TGTAKGAGIAITDGSGKVIELGKASSAQA-LGDGNNTLSFSAYLQASTAVITPGDFQSVADFTLAY. 184
80 2.000e-48gi|529987337|ref|YP_007990723.1| fimA [Klebsiella pneumoniae]  clstr ali  26  61MKIKTLAMIVVALSLSSTAALADTTTVNGGTVHFKGEVVNAACAVDAGSIDQTVQLGQVRSAKLATAGSTSSAVGFNIQLDDCDTTVATKASVAFAGTADSSNTTVLALNSAAGSATNVGVQILDNTGTPLALGATFSAATTLNDGPNIIPFQARYYATGAATAG-IANADATFKVQY. 241
81 2.000e-48gi|501097383|ref|WP_012147399.1| fimbria A protein [Serratia proteamaculans]  clstr ali  26  1MKLNKIMMAAVLAFGATSMMAQAAVNQGSGTVTFKGAIIDAPCSITPETEDQTVSLGQISNVALKDGGQ-STPKNFQIKLENCELSAGNAVSITFSGASSVDDNNLLGI---TGTAKGAGIAITDGSGKLIELGKASSAQT-LQNGNNTLSFAAYLQASGAVVTPGEFQSVADFTLAY. 186
82 3.000e-48gi|639138621|ref|WP_024484075.1| fimbria A protein [Serratia fonticola]  clstr ali  25  1MKANK--TLLAAVAVFGLSSLAHAADQGNGKVTFTGSIIDAPCSIAPDSADQTIELGQISKVALKDGGK-STPRNFDIQLENCSVSSQNKVQITFTGMKSPAKNGLLGI---TGSAKGASVAVTDGSGAVIELGKPSTAQ-ELSDGTNTLSFAAYVQGDGAAITEGEFQAVADFTLAY. 176
83 3.000e-48gi|496196483|ref|WP_008916320.1| fimbrial subunit FimI [Providencia sneebia]  clstr ali  47  1.MKGLMLGLLLLVSPLMEAGNKWQVQLPGGGMRFQGELIAEACSVEISDRNLTVNMGQLRTNMLNAPGQDTDPVIFDIHLRECSDAVSQYVSITFSGVANDQNPQIFSVGNGPDTATGVGLAIFDSKNTLIPINSAPQKIARTSNGDMTLHFTAKYRATSYQVTGGKADVQALFLLTY. 177
84 3.000e-48gi|697053892|ref|WP_033146498.1| hypothetical protein [Enterobacter cloacae]  clstr ali  29  32.............................GKVHFYGAVVNSSCSIDTQSFDQSVMMGQVRTGSFLGPGSWAEPVTFWIKLENCATSTSESASVTFNGLADLKDPQVFQAGFGSGAAKGVGIGIFDMRGNQVIPDSQPLAKMPLIAGENTLLFTARYRSVSMPVTAGDASAAVTFSVIY. 180
85 3.000e-48gi|491047659|ref|WP_004909312.1| fimbrial protein domain-containing protein [Providencia rettgeri]  clstr ali  28  1MKMNKLLLVAITASSFAAINASAAVDQGSGTVTFVGSIIDAPCSISPESSNQTVDLGQVSNALLSKAGS-STPRNFSIDLEKCDTTTKKNVTITFGGSKDSVNDKLLGI---TGSAKGAGVVLTDGSGTQITLDAPSAARNLL-AGNNKLVFSAYLQGNTAEVTPGEFTSVANFTLTY. 177
86 4.000e-48gi|602777592|gb|AHO21858.1| fimbrial protein [Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121180]  clstr ali  28  1MKHKLMTSTIASLMFVAGAAVAAPVSVSGGTIHFEGKLVNAACAVSTKSADQTVTLGQYRTASFTAIGNTTAQVPFSIVLNDCDPKVAATAAVAFSGQADNTNPNLLAVSSASTTATGVGIEILDNTSSPLKPGATFSAKQALVEGTNTLRFTARYKAXXESPGLGTA........... 174
87 4.000e-48gi|514233570|ref|WP_016536219.1| fimbrial protein [Cedecea davisae]  clstr ali  24  1...MKKQLHALALLSVISGAAVSTANAADGTIQFNGEIIDAACTVSPASASQTVTLGQVSDKAFAAQGDTAGATAFQIDLTSCPATV-TSATVKFDGTAYQGDNSALALTQAPGAATGVGIQIRNADNSVLPLFTPSQSIALAQTGTNTLKFNAAYVAKAATVTAGPANATATFSVVY. 174
88 4.000e-48gi|501082615|ref|WP_012133172.1| ferrous iron transporter B [Citrobacter koseri]  clstr ali  27  1.MMNKVALGLFIAATVGCSASAFAATNGEGQINFTGEIIDSACQVVNGSNPLNVELGRVSKTVFSGAGSTSTPTKFDIQLKDCPEMV-TSAAINFGGTPDTDNSTTLALTPDTETATGVAIQLLDSSEQPVSLYTPSRQYPLTAGSTNDLEFAARYIQTQAAVTAGPANSVSTFTVIY. 178
89 6.000e-48gi|505156963|ref|WP_015344065.1| P pilus assembly protein, pilin FimA [Serratia marcescens]  clstr ali  27  1MKLNKI--MLAAVMAFGATSFAQAADQGHGKVSFTGSIIDAPCSIAPESIDQTIDLGQVSSIALKDGG-TSNPRSFDIKLEQCDITTIKNVTTTFTGAASPTNQDLLGI---VGTASGAGVAI-TYGGKTVKLGEATAAQ-DLNEGNNTLHFAAYLQGEGAAVVPGDFSAVADFTLAY. 172
90 6.000e-48gi|503129998|ref|WP_013364659.1| ferrous iron transporter B [Enterobacter lignolyticus]  clstr ali  37  12......LLLSLVAAPSAYAGNHHYVNIHGGDVHFFGQVVNAACSVSADSRNQTVQMGQVRSNQFASLGDWEDPQPFQIALEDCDTAVSQNVGVLFTGESDGKDPLVFRAGYGAGAAHGVGIGIFDGAGNLLVPDTRPPWFAPLQEGETVLSYTARYRATDRRVKAGSASAQVWFNVIY. 183
91 6.000e-48gi|490860408|ref|WP_004722450.1| fimbrial protein [Yersinia ruckeri]  clstr ali  31  1MKKVLLTVMIAVSFSAAI-QAAPPVSGSPGTIRFEGEIVTGACGIDSDSLDQKVDLGQVPSHLFTAKGDRSTAAKFDIVLTDCDTTTSKNATVTFTGASHSENAALLGI---TGAATHVGIRLQSGSNEYLALGTATKP-ILLSNGDNRLQFAAMYEATDAGVTAGDADSTAQFTVNYL 174
92 6.000e-48gi|695828121|ref|WP_032741660.1| hypothetical protein [Klebsiella pneumoniae]  clstr ali  25  1MNMKKVVIAIGAVMAMSAGSAYAAGDASGGTVHFKGSLVDAACSVSTDSADQIVDLGQHPLHDFKAVGDKSELRPFTIKLEDCDTTVATTAAVAFSGSVDSTNTDLLAVDSSGSSATGVGIQILDEASAVVKPGSTFSTAHKLIDGENILNFKSRYVSTVASPTAGQANADATFIMQY. 189
93 7.000e-48gi|499457340|ref|WP_011144804.1| fimbria A protein [Photorhabdus luminescens]  clstr ali  26  1MKLNKLVMVLGLGATLAAGSVNAATNQGHGKVTFEGSIIDAPCSIHPGDDDQTVKLGQISNKALAGGGK-STPVPFNIRLLDCDANGKRTVTATFSGTPSAVNKDLLAI---VGSASGAAIGITNDNAKLIKLGQPSSPTIITDDSDSTMRFAAFLQGDGATIVPGDFTAVANFTLTY. 187
94 7.000e-48gi|498117681|ref|WP_010431837.1| ferrous iron transporter B [Enterobacter mori]  clstr ali  26  1MKKNIIAAAIVATAALSMS----NAFAAAGTVNFNGEILDAACTVDVGSQNQTVELGKYNKSEFAAAGDVTAATKFDIVLKDCPATV-TSASVRFDGTPDATDSTLLAIDSSAGAATGVGINLMTADKAQLPLGSNGYSYALSSTADNTLDFYAQYKSTVDSVTAGPANSVANFSVVY. 175
95 7.000e-48gi|575848346|emb|CDL81904.1| Similar to fimbrial subunit type 1 [Xenorhabdus szentirmaii DSM 16338]  clstr ali  26  1MKIKLI-----ISSLLVSSVFMSAVHAADGAIKFTGKITASACKVDSGSMDQPVNMGTVSSNSFNGMGSTSSPTRFNIKLTDCPKE-YKNAYVKFDGQTDRTNNRYLALQNNGSAAQGVALAIYELNNSPLAITQRSMAYPLIENQSNVLSFVAKYIATGDKVTAGSGNSLANFTITY. 176
96 8.000e-48gi|490363504|ref|WP_004243225.1| type-1 fimbrial protein subunit A [Proteus mirabilis]  clstr ali  26  4.KKMLVKALFTVSVLSLSGVASAATIVNGGKINFTGEIVNAACVVSTKSIDQTVNIGQYRTAQFDSVGKTVGNTDFYINLEACDTTVAQNASVSFSGVSDSNDKTVLAVSNGAGAATGVGIEITDHTGKVLPPGSVFSTAKQLIDGSNTLNFVARYKSTLDTVTPGHADADVTFKMQY. 185
97 8.000e-48gi|658548614|ref|WP_029741073.1| hypothetical protein [Enterobacter asburiae]  clstr ali  25  1MRLNMFRLIAVIIFTQIIFIFPETVLSAAGNVHFYGAVVNGACAINTQSLDQSVMMGQVRTSTFTETGSWAEPTAFWIKLENCDAGTSESASVAFNGLADSKDPQVFQAGFGSGAAKGVGIGIFDMKGNQVVPDTQPLAKMPLITGENALLFTARYRSVSTPVTAGDASAAVTFSVIY. 182
98 9.000e-48gi|491055798|ref|WP_004917443.1| fimbrin fimI [Providencia stuartii]  clstr ali  44  15...............LMEAGNKWQVQLPGGGMRFQGELIAEACSVETSDRSLIVNMGQLRTNMLNASGQDTDPVIFDIHLRECSAVASEYVSITFAGIANDKNPAIFAIDNGPNTATGVGLAIFDSKDTLIPINSSPRKIERVSNGDMTLHFVAKYRATSDQITGGKADAQALFSLTY. 177
99 1.000e-47gi|639209483|ref|WP_024547667.1| MULTISPECIES: fimbria A protein [Cronobacter]  clstr ali  26  1MKINKLASAIILTMGMVAAG-ANAADQGHGKVTFTGSIIDAPCSITPESADQTVALGQVAAHTLKDGG-TSAPKSFTIDLENCGNTIGNSVSVTFSGTASTLDAKLLGL---TGEAAGAGIAIEDESGKVVDLGTPSSLY-KLTGTNPSLGFTAYLKGISDTITTGDFESVANFTMDY. 179
100 1.000e-47gi|685170880|gb|KGA58549.1| fimbria A protein [Proteus vulgaris]  clstr ali  29  1MKLNKFLSSLALTTSIVAFGASAAKEQGSGSVTFTGSIIDSPCSIAPESSNQTVDLGQVSSVLLSNAGN-STPRNFTIELEKCDTATKKNVTITFDGTKDAINNKLLGV---TGSAKGAGVVVTDGSGTQITLGTPSAARSLL-NGNNKLVFSAYLQGSSATVTPGEFSSVANFTLAY. 183
101 1.000e-47gi|490383255|ref|WP_004262766.1| ferrous iron transporter B [Providencia rettgeri]  clstr ali  26  1MKKNLLASLIAATSIFAV----NNALAADGTIDFTGEIIDQACELAAGSDALKVNLGQVSKKALPNAGSTAAATKFTIKLINCPATV-TTASVKFDADSYIGDDEVIKLKEE----TGVGIQITDDTNKIVPLFTASKAYPLQQNVENNLDFRARYIAKSDTVTPGPANATATFTINY. 169
102 1.000e-47gi|693467954|dbj|GAL49696.1| putative fimbrial protein [Citrobacter farmeri GTC 1319]  clstr ali  25  1..MNKLFLVVAMASGLAL-GTANAADSGHGTITFTGSIIDAPCSITSETANQTVDLNEVSNVALKNGG-TSNPKSFVIKLEQCDITTLKTVKTTFSGAASAGNPDLLGI---TGTAKGASIAITDGSGTVIKLGQASKAQT-LMEGNNTLSFSAYLQGDGAAIVPGSFQSVADFRLDY. 172
103 1.000e-47gi|493867339|ref|WP_006813951.1| fimbrin fimI [Providencia rustigianii]  clstr ali  48  12............FSPFLQAGNKWKVQLPGGGMRFQGVLIAEACSVETSDRTLTVNMGQLRTNMLHAPGQDTAPVIFDIHLRECTQAVSEYVSITFSGVANDKNPDIFSVGDEPNTAQGVGLAIFDSTNTLIPINSTPRRIDRITNGDMTLHFVAKYRATSYEITGGKANAQALFSLTY. 177
104 1.000e-47gi|639223551|ref|WP_024560786.1| fimbrial protein [Cronobacter pulveris]  clstr ali  26  1MKRIMLVCTHLLLGLAGFS-----ATAHDGTINVLGKIVENSCAVTADSKTLTVDLGNVASKQFTRAGDGSVFKPFAINLEKCPTAV-KTITVHFEGTADSKNADLLALTTGASAAAGVGVGIYNADYSLIPFGDESAKFTPAGETTATLNFYARYVANGGTVTAGTANASATFVLTY. 173
105 1.000e-47gi|575848406|emb|CDL81788.1| putative fimbrial-like adhesin protein [Xenorhabdus szentirmaii DSM 16338]  clstr ali  28  1MKSK-----LLISSLFVTSLFAATANSADGVIRFEGEVIQNACKVHGDSADQTVDMEAVSVGAFKKVNDTASPRRFQIKLVDCPAEMKKNVTIRFDGPSDSHNRELLALTKVSNAATGVAIGIYEEDQTRVSVAGDSSKSPLHLGAEQELRFVAKYVATKDKVGPGSANAVTNFTVVY. 175
106 1.000e-47gi|526245239|ref|WP_020842593.1| type 1 fimbrae adaptor subunit FimF [Salmonella bongori]  clstr ali  32  6...........ILYGIGMLLAASGVQAHDGRVYVSGTITDNTCSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTASG-VTVSFSGASDRHNTDLLALTAGENDASGIGIALYDQNKTLIPLGQES-DVVTLTPGQASLQFYARYLADGGTVASGNANASATFILAY. 172
107 1.000e-47gi|553618106|gb|ESD37902.1| fimbrial protein, partial [Escherichia coli 908519]  clstr ali  29  10.........FALSALALTSTSVFAADAGDGSVKFTGEIVDAACVVSPDTQKQEVVLGQVNKSVFTTTGDKSAATPFKIKLENCDISTFKNVEISFNGVGDADNSKLISVSTEPGAATGVGIGIYDNTNTLVDLNT-GKSATVLKEGQTVLYFTANYVATKNAVTIGYGNAEVDFNLTY. 177
108 2.000e-47gi|516413669|ref|WP_017803067.1| hypothetical protein [Erwinia toletana]  clstr ali  23  1..MKFREKTVAAIMIMGYVFAANAADSGHGTVTFQGAIIDAPCSINPDSIDQTINLGQISAAALSASGKTSIPRPFQIKLENCTTATLSTVQTKFTGAASAYDKDSLAL---SGSASGASIVMLDGSNEKVKLNVATTPQT-LQDGHNTLNFNAYLQGSSATIVPGEFNSITNFTLAY. 176
109 2.000e-47gi|490229334|ref|WP_004127681.1| fimbrial protein [Klebsiella oxytoca]  clstr ali  22  1MKKNLLAVAL-----MATSVFASSAFASDGAVNFTGSITDAACTVDTASQNQDVFLGNIARTAFPVAGSLAAAKKFTLVLKNCPDTVTG-ATVRFDGAQVSGDNSVLALTAGSTTAKGVGVQISDDQNKVVPLYEDSSVYPLVSTADNKLSFSARYISLTDAVTVGDANAVTQFTVVY. 172
110 2.000e-47gi|491097486|ref|WP_004959087.1| fimbrin fimI [Serratia odorifera]  clstr ali  38  12...TIISAALMLSSAVALAGNRHHVIIDGGQVKLRGAITAAACSVSTGSEAQIVEMGDVRSNQFSGLGSYSPPVAFSIDLTGCNRAIYHAVGVSFWGVTDGKDPLVLKAGNGAQGGPGIGLALFDDHGDLMVPNAPPSRLAMINDRETRLHFSARYRATSRQVTGGEANSWAWFALTY. 186
111 2.000e-47gi|516438605|ref|WP_017827517.1| ferrous iron transporter B [Proteus mirabilis]  clstr ali  24  1MRKSFIAMLIATTSIFV----ANNALAADGTIDFTGEIIDNACELAAGSDALKVNLGKVSKTALPSAGVTAATTKFTIKLINCPATVS-TASVKFDAESYSGDDTVIALKQESGVATGVGIQIMDDANTVVPLFTASKTYPLKEGGENNLDFRARYIAKTDSVTAGLANANATFTINY. 173
112 2.000e-47gi|667745875|gb|KFA84173.1| hypothetical protein N037_22150 [Enterobacter sp. EGD-HP1]  clstr ali  22  14MNMKKLVLAVAMASGLGM-GAAHAADNGHGKITFTGTIIDAACSIDASSIDQTKELGAISMKQLSGGGQ-SSPINFNIQLHDCDTTTAKNATVTFNGVAGDGAAGLDGALAVTGQGSGVGVVITDMGKNVIKPNVASPD-IALNDGDNELQFQAYVQGSAGAVIPGAFTSVANFVMDY. 190
113 2.000e-47gi|544754482|ref|WP_021181380.1| putative mannose-resistant/Proteus-like fimbrial protein [Serratia fonticola]  clstr ali  25  1MKLNKIMMAAVLAFGTVSG--AQAADQGHGKVTFTGSIIDAPCSISPESIDQTVELGQISKVALLGGGK-STPRFFSIDLENCSPATRNKVQVTFTGMASAAKDGLL---GTTGTAKGANVAITQADGEIIKLGEPTKEQV-LQNGNNTLSFAAYMQASSAAIIEGEFKAVADFTLAY. 177
114 3.000e-47gi|503995722|ref|WP_014229716.1| MULTISPECIES: ferrous iron transporter B [Klebsiella]  clstr ali  25  1MKKKIVIAILAA----GSALSMTQAFAAAGTVNFNGNILDAACDIDVASQNQVVVLGDYYKTEFPVAGSRTAATKFDIILKNCPVTV-TNAKVRFDGTPDPDNSNLLAIDSSVGAATGVAINLMTADKADLPLGSNGYSYILSSTADNTLNFYAQYMSTAATVVAGPANSVANFSVVY. 175
115 3.000e-47JGI.Meta JGI_HUM.0735506 7045160403 C3751227__gene_286500 protein fimF [Human Stool microbiome from visit number 1 of subject 158337416]  ali  30  1MRNKPFYLLCAFLWLAV-----SHALAADSTITIRGYVRDNGCSVAAESTNFTVDLMENAAKQFNNIGATTPVVPFRILLSPCGNAVS-AVKVGFTGVADSHNANLLALENTVSAAAGLGIQLLNEQQNQIPLNAPSSAWTTLTPGKNTLNFYARLMATQVPVTAGHINATATFTLEY. 175
116 3.000e-47gi|639142895|ref|WP_024485840.1| fimbria A protein [Serratia fonticola]  clstr ali  24  1..MNLNKTLLAAVIAFGSASMAHAADQGHGKVTFTGSIIDAPCSIAPESIDQTVDLGQISNAALANSGQ-STPRNFDIKLEDCSFAAKNKVQVTFSGMESVAGNGLLGI---TGNAKGASVAITDGTGTVIELGKPTKEQT-LQDGNGTLTFAAYMQGDGATITEGDFQAVTDFTLAY. 176
117 3.000e-47gi|491415745|ref|WP_005273547.1| fimbrial protein [Yersinia bercovieri]  clstr ali  28  8..LTQKLLPFSLLALFPLATSSWAAEVAGGTINFNGSVVTTACAVSSDSANINVDMGQVRAATLSAAASEAPTKKFSIVLEDCDSSVSQDVAVTFSGTPDNDDPDSLAVNGGTGTAQNVAVRLYSEEGSVVKLGEASGA-VNLRDGINTLNFGAKYYSPKGGATAGDASTVATYTLTY. 185
118 3.000e-47gi|495031041|ref|WP_007756588.1| Type-1 fimbrial protein, A chain precursor [Cronobacter dublinensis]  clstr ali  25  1..MKKFVLTAVLAGAACWATSSFAAANGEGQVNFSGEIIDSACVVNTASSPLQVSMGKIAKSVFSSVGATSTPTLFKIQLKNCPETV-TSASITFGGTPDTNNNNVLALKSETGVASGVGVQILDSSESPLNLLTPSSDYTLSGDVTNDLQFGARYIATSATVTAGKANAVSTFTVVY. 177
119 3.000e-47gi|493873861|ref|WP_006820307.1| fimbria A protein [Yokenella regensburgei]  clstr ali  26  1MQLTKLVWVFGM-GAAVLAGQAQASDQGHGTVKFTGSIIDAPCSITPETIEQTVDLGEISNKSLLNGGK-SNPRPFDIKLESCDLSTDKTVTITFTGPESSAQPGYLAIVGSS--ASGAAIGITNDEGTNIPLGTASSA-TKTQQGDNTLTYSAYLKGNGTTVVPGSFTSVANFTLAY. 177
120 4.000e-47METAHIT V1 GL0098794 [Complete] locus=scaffold1226_28:1986:2510:-  ali  26  1..MNGKLFKSALVCSSLLLGWQAHAGNGNGTVHFTGEIIDSTCEVTAPTQTQTVDLGKVNKSAFSGAGSTASVQAFQIDLENCP-DTYKKATARFDGTEDGD--GYLKLN--AGGATGVAVAIYNADNTLLKLYNQSVSADIDADGKATLPFMARYIATSATVTPGVANADSEFTITY. 172
121 4.000e-47gi|491097488|ref|WP_004959089.1| type-1 fimbrial protein subunit A [Serratia odorifera]  clstr ali  29  3.KNLSRILIGTALLTTGASALAATATTYGGNIHFVGRIVNAACAVSADSTDQTVNLGQYRTAKFAAAGDYSGKVPFTIKLEDCDTAVSTKASVAFNGAADKTDNTVLGVSNXXXXXXXXXIEIRDHDNVLIPNGASYSAPFTLADGKNILHFTARYKATAKAVTPGEADADATFTMQY. 184
122 4.000e-47gi|674725446|gb|KFK95436.1| hypothetical protein JV45_08745 [Serratia sp. Ag2]  clstr ali  27  5.........IITAAFLFSAMSAPAVMAADGTINFVGEVTDAACVVDTNSQNLTVTLGKVSSSAFTGTGSTAAPTKFQLILKDCPVGASKAV-VKFDGTNVAGDNSMLALTSGADTAKGVAIQLSDATQQVVKLFESSQPYTLVTGSNNNLDFVARYKAIDNNVTAGIANASAQFTIVY. 174
123 4.000e-47gi|573509195|gb|ETT09283.1| fimbrial protein [Providencia alcalifaciens F90-2004]  clstr ali  23  1MNRNIFKSLFSVILLF----SSQSAVSVDGNIEFIGEIIDQACEVKTDSKNIQVPLGSIPKANLPNVGSKSTPVLFTITLINCPVTVTR-ASVLFDAIPYPGDNTVLALKADTGVATGVGIQLTDKSNAIITLLTPSNSYTLLPNVDNPLNFTANYIAKASPVTPGPANGAATFLIVY. 173
124 5.000e-47gi|704503222|ref|WP_033486364.1| ferrous iron transporter B [Enterobacter cloacae]  clstr ali  28  1..MNKVALGLFIAAAVGCSASAFAAINGEGQINFTGEIIDSACQVVNGSNPLDVQLGKVSKTVFTGAGSTSTLTKFDIKLTNCPETV-TSAAINFGGTPDANNNATLALTPDTGAATGVAIQLMDASGQPVTLYTPSMQY-PLVSGTNDLEFGARYIQTQTAVTAGPANSVSTFTVIY. 177
125 5.000e-47gi|499946493|ref|WP_011627227.1| ferrous iron transporter B [Shewanella sp. MR-7]  clstr ali  26  6.........ISLLALMAGLAISYNANASDGQINFTGTITDETCTVTNSSSPLSVTLGSVAKSAFSGVGSTAAATKFTIMLTGCPQSANNSVSVKFDGIADGTNKDVLALTAGEGVAEGVGIQLTEDNGTVLPLFSASSSFT-LADGDNKLNFIARYIATSATVTAGTANAVSNFTIIY. 175
126 5.000e-47gi|446690873|ref|WP_000768219.1| type-1 fimbrial protein subunit A [Escherichia coli]  clstr ali  26  1MKLKFISMAVFSALTLGVATSASAATVNGGTVHFKGEIVDAACAVSLNSFDQIVSLGQVRTAKLANDADKSAPVGFDIELSDCSTAALSNAAIIFSGSQMSGHNNILAVQGGAGTATNVGVQVTDYTGKPVVFGTTASTDYKLTDGTNKIPFQARYIAVDGQATAGTANADATFKVQY. 180
127 6.000e-47gi|504695998|ref|WP_014883100.1| ferrous iron transporter B [Enterobacter cloacae]  clstr ali  28  1..MNKIALGLFIASVIGCSASAFAATDGEGQINFTGEIIDSACQVVNGSNPLNVTLGKVSKTVFTGAGSTSTATKFDIELKNCPETV-TAAAINFGGTPDANNNSTLALTPDADAATGVAIQLIDSSEQPVSLYTPSKEY-PLASGTNDLQFAARYIQTGAAITAGPANSVSTFTVIY. 177
128 6.000e-47gi|504406422|ref|WP_014593524.1| putative FimI fimbrial protein [Pantoea ananatis]  clstr ali  40  21MGYRMLVALLSLACFPLMAGQKWNVTLPGGRLSFSGEAIVAACQVDG--VEKTVDMGQISSNRFRYAGEYSPAVPFDIRLVNCSPRASHHVSVAFRGLTDTRMPSALSVGDAEDTASGVAIALADDEGHPVSVNSPLEPVWTLLNGTLSLHFIARYVSTTASVKGGRVDATATFLITYF 197
129 6.000e-47gi|534623305|gb|EQN80109.1| major type 1 subunit fimbrin (pilin) [Escherichia coli HVH 21 (4-4517873)]  clstr ali  29  54.....................SVTTTVNGGVIHFKGEVVNAACAIDSESMNQTVELGQVRSSRLAKAGDLSSAVGFNIKLNDCDTNVSSNAAVAFLGTTVTSNDDTLALQSSAGSAQNVGIQILDRTGEVLVLGATFSAKTDLIDGTNILPFQARYIALGQSV-AGTANADATFKVQYL 212
130 7.000e-47gi|506490093|ref|WP_015965471.1| P pilus assembly protein, pilin FimA [Enterobacteriaceae bacterium strain FGI 57]  clstr ali  23  9..KMPRHFTFALTLLAMTSSVQAATPLGEVNIQLQGNIVDLSCVVNASDSAKEVQLGTWPTKQLQTAGSKTQAMPFSIRLTGCPPGA---VSITFAGTPDDQDNTLLALNGASQ-ASRVAVEILDEDKTRLPLQQESKEVAIDAQGDATLSFYANYISTADNPQPGSADADATFTLNY. 180
131 7.000e-47gi|578248851|gb|EUM08942.1| hypothetical protein L465_03034 [Enterobacter sp. BIDMC 29]  clstr ali  24  1MKLNKVMMATVLALGV--SSTAFAAEQGHGKVTFTGSIIDAPCSINPESADQTVELGQISNVALKNGGK-SNPRQFSIDLENCSFEAKNKVTATFTGMESSVVNGALSIN---GTAQGAGVVIAEADGNAVKLGQPTKAQV-LQDNNNSLNFSAYLQGASAAIVPGDFKAVADFTLAY. 181
132 7.000e-47gi|639137349|ref|WP_024482815.1| fimbria A protein [Serratia fonticola]  clstr ali  22  1MKLNKIMM--AAVMTLSTLSMAHAANQGAGTVTFNGSVIDAPCSIDPGSKDQTVELGDIATVQLKKGGK-STPQDFMIKLVGCEIETAQDVTTTFKGAESEALPGLLAMK---GSARGASIAINDTDGKLLPLTTASKKQKV-EDGLVTLRFSAHLQGDGAAITPGEFNTTADFTLAY. 173
133 7.000e-47gi|558084587|ref|WP_023479082.1| type-1 fimbrial protein, A chain [Enterobacter cloacae]  clstr ali  28  1MKTRPIVISLAASMMLFSGLAQARAPVPGGNIHFEGELVQVACAISVQSNSQTVAMGQYHTTLFSNVGDTTPPVPFTLTVNDCDRSVATQASVAFAGKADNVDPTLLALTAGASGATGIAIEILDSNSETLKPGATYSVAQNLASGNNTLQFAARYKATAAEVTPGSANADTMFIMKY. 183
134 8.000e-47gi|521253401|ref|WP_020439966.1| fimbria A protein [Serratia plymuthica]  clstr ali  27  1MKLNKFMLAAVLALGATSMMAQADINQGRGTVTFKGAIIDAPCSITPETVDQTVNLGQVSNVALKDGGK-STPKNFQIKLENCDLNPGNAVSITFSGAASSFDPNLLGI---TGVAKGASIAITDGSGEVIKLGQATKAQT-LQNGNNTLSFAAYLQASSAAVIPGEFQSVADFTLAY. 186
135 8.000e-47gi|503577745|ref|WP_013811821.1| MULTISPECIES: fimbrin fimI [Serratia]  clstr ali  61  15.............SATAQAGNRWHVILPGGNMQFQGEVIEEACSIALENKQMTVSMGQISSNNFHAAGAFSEPVHFDIHLQNCSTSVSQHVGISLHGVADSREPDLLAVNNEQDYSNNIAIAFFDEHERPIKLNHPPKFWKRIVDGPVTLHLLARYKAIQYPVMGGKANGQLWFFLTY. 179
136 8.000e-47gi|640469909|ref|WP_024910586.1| fimbria A protein [Serratia fonticola]  clstr ali  28  1MKLNKLMLATVIAFSAVSVAQAAP-NQGGGTVTFDGDIIDAPCSVAPESVEQTVPMGQISSKVLANEGK-SSSEAFNITLKDCNFSTQRSVKIAFTGLPADGNSELLGL---AGTARGAGIQLVHGTNEKIAIDGTQISVNNLNAGDNILRFAAYLQGSSATVEPGDFTSVVNFTLTY. 175
137 8.000e-47gi|505181235|ref|WP_015368337.1| fimbrial protein BcfE [Enterobacter aerogenes]  clstr ali  26  1MRLIRYFFLLILLCGSGC-----YADDSGYNLEFTGTIVAQTCDIEISSLSQSIDLGQFSVEDFPSTGTTTKFKPFNINLKNCSRGITGS-KIWFTGTADSDNPALLALSDTGMGASGVGVEILDEDQDAVSINNTSSVVYPLKTGRNTLSFYIRYKSTRPTVTSGNATAVMYFDLQY. 177
138 8.000e-47gi|493521961|ref|WP_006476057.1| fimbrial protein [Burkholderia cenocepacia]  clstr ali  30  28MKKSILSAVALAALSTSAFA------AGTGTINFTGEIVAGACGIDSNSVNQTVQLGKVPTNKFKQAGDKSDPVSFDIKLTDCDTSIAQNAYFTFTGTSSAGQPKLLA---TIGSATNVGIRLQAASGEYLDNGAEQKAPTLLQNGTNTARFAAMYEATAAGVTPGTADGVANFTVRY. 196
139 9.000e-47T2D.3762161 [KEGG:K07348] minor fimbrial subunit;|[COG3539] P pilus assembly protein, pilin FimA  ali  31  11.........TFLSSVRFFVLAVSHALAADSTITIRGYVRDNGCSVAAESTNFTVDLMENAAKQFNNIGATTPVVPFRILLSPCGNAVS-AVKVGFTGVADSHNANLLALENTVSAAAGLGIQLLNEQQNQIPLNAPSSAWTTLTPGKNTLNFYARLMATQVPVTAGHINATATFTLEY. 181
140 9.000e-47METAHIT O2 GL0034457 [Complete] locus=scaffold11862_2:4298:4840:-  ali  28  1MKLKFISMAVFSALTLGVATNASAVTVNGGTVHFKGEVVNAACAVNTNSFDQTVNLGQVRSERLKVDGAKSNPVGFTIELNDCDSQVSAGAGIVFSGPAVTGKTDVLALQSSAGSATNVGVQITDHTGKVVPLDGTASSTFTLTDGTNKIPFQAVYYATGQA-TAGIANADATFKVQY. 179
141 9.000e-47gi|486174387|ref|WP_001534670.1| S fimbriae major subunit SfaA [Escherichia coli]  clstr ali  26  1MKLKFISMAVFSALTLGVATNASAVTVNGGTVHFKGEVVDAACAVSLNSFDQTVSLGQVRSAKLKNDGDKSAPVGFNIELVDCDTQTSNNVSIIFSGAQPAGKDKVLAVQGGAGTATNVGIKVLDYKGQEVSFGTTPSSEYVASSNSASIPFQAFYVAVNGQATAGTANADATFKVQY. 180
142 9.000e-47gi|503580864|ref|WP_013814940.1| MULTISPECIES: fimbria A protein [Serratia]  clstr ali  25  1MKLNKIMMAAVLAFGATSMMANAAVDQGHGTVTFTGSIIDAPCSITPETVDQTVDLGQVSNVVLKDGGK-STPRNFQIDLENCELTKTNMVSLTFTGMESSAKNGRLGI---TGTAQGASIAITDGAGSVIKLGTPTQTQT-LQNGNNTLSFAAYLQGDNASVVPGDFQSIADFTLAY. 181
143 1.000e-46gi|546164300|ref|WP_021806160.1| Fimbrial protein [Serratia fonticola]  clstr ali  26  1MNKNLLAVAVL-----XXXXXXXXXXXXDGKVNFAGEIIDQACTVHSDSENQTVTLGKVFVGAFKGAGVTAASKDFSLILQDCPDTV-KAATVRFDGIQVAGNDAVLALTDEPGVATGVGVQIADNNNKVINLHTDSSVYPLSSTEDNVLGFVARYYATSATVTAGKANAVSNFTIIY. 173
144 1.000e-46gi|725511507|gb|KHE03904.1| ferrous iron transporter B [Citrobacter braakii]  clstr ali  28  1MKSKLLPLGVLISSLAGVS-----AMAADGEVNFNGEIIDAACKVTNSASPLTVTLGQVSKSAFTNAGSTAAPTKFTLQLTDCPVSATK-AAVKFDGSPVTGSPGVLALTAETGVAGGVGIQLYDDANTAIPLYNASKQY-PLTSGTNNLDFIARYIATSTTVTAGKANSMASFTIVY. 175
145 1.000e-46gi|502224345|ref|WP_012737267.1| ferrous iron transporter B [Klebsiella pneumoniae]  clstr ali  26  1MKKTITIVCFMLAAGS--------AMAADGTINFTGSITDQTCTVDSGSQNLNVNLGKVAQTALNAAGMKAAPTRFTLSLSDCPDTVTG-ANVKFDGTSDGVNQNLLALDNGTGIATGVGIEIADKNGTAIPLHTASPDYT-LAAGANSLDFIARYVSTGAAVTTGTANGTSQFTINY. 169
146 1.000e-46gi|446766292|ref|WP_000843548.1| type-1 fimbrial protein subunit A [Escherichia albertii]  clstr ali  22  1..MKSVFISSIIAVTLFATANTYAATTNGGVIHFEGELVNAACAVNTESADQVVSLGQYRTDLFNAVGATSASIPFTIELNDCDVSIAATAAVAFSGQADGNNDDLLAIVSGTNTATGVGIEILDNTSKTLKPGSVFSEAQSLITGTNVLHFSARYMGTGLSATAGQANADATFIMQY. 179
147 1.000e-46gi|660567641|gb|AID87561.1| fimbrial protein [Klebsiella oxytoca KONIH1]  clstr ali  29  10.................CIGWTFSAFAHDGTVNISGMIQNQTCTVAQESIDQTVSLGDIDSRQLSNIGAVSSAVAFVIDLQNCS-SVTKGVSFTFSGSVDGDNSDLLALSDEAGSASGLGIAIKDDDSTLIPLNKASKDYAIDSQADNRLVFYAQYMATSTNVTAGTANGTATFSLTY. 170
148 1.000e-46gi|689261525|gb|AIR02457.1| type-1 fimbrial protein subunit A [Pluralibacter gergoviae]  clstr ali  26  1..MNKLSLVFATALSVACTALADPVSVNGGKVHFRGEVVNTGCAVDAGSVDQTVQLGQVRSAKLAEAGATSTAVGFNIQLDDCDTTLVSKASIAFSGAADSTNTTVLALQSSAGGATNVGIQILDRTGTALKLDGESSAATTLNNGPNVLPFQARYYATGVA-TAGTANADATFKVQY. 179
149 1.000e-46gi|491055799|ref|WP_004917444.1| type-1 fimbrial protein subunit A [Providencia stuartii]  clstr ali  26  1MKVKSLALVIVALSLSSVAAVAETTTVNGGTVHFKGELVNAACAVDANSVEQTVRLGQFRTAKLAQAGDTSSPVGFNIQLNDCDTTVATSAKVAFRGAANAANPTVLAVSGSAGSATNVGIQILDSKSVPLELGATFSSAITLNDGNNVLPFQARYYALGAT-TAGIANADATFAVQY. 181
150 1.000e-46gi|495778591|ref|WP_008503170.1| ferrous iron transporter B [Enterobacter sp. SST3]  clstr ali  31  1MRQVTRQSVLFFSVLLCVALPASAID--DGSVHFQGQVVNTGCSVSAESQDQIVRMGQIRNNEFAATGDWAAPTAFQITLEDCDTSVSQRAGVLFSGESDAKDPQIFRAGYGAGAAQGIGVGIFDATGHLLIPDTAPPCYAPLQNGANVLRFMAKYRSTQPHVQAGTADAQVWFNVVY. 176
151 1.000e-46gi|487416254|ref|WP_001683632.1| fimbrial protein FimA [Escherichia coli]  clstr ali  29  1MKLKFISMAVFSALTLGVATNASAATVNGGTVHFKGEVVNAACAVNMNSADQTVQLGQVRAAKLATAGATSGAVGFNIQLDDCDFGNSQSVKVIFAGASLSNHDDILATQSSAGAASGVGIQILDSKGGVVTLNSDTAAEYTLTTGTNKIPFQARYIAPDGQVTAGTANADATFKVQY. 183
152 1.000e-46gi|490856805|ref|WP_004718848.1| fimbria A protein [Yersinia ruckeri]  clstr ali  27  3MKLNKLKMVLGMIVVMAAAANAAPKDQGHGTVTFNGSIIDSPCSITPDTIDQTVNLGQVSNVALKDGGK-SKPKNFQIKLENCDXXXXXXXXXXXXGATSTGNPDLLGI---TGTARGASIAITNGSGDVLKLGESGKPQT-IQDGNNSLAFSAYLQGDGASATPGEFQSIANFSLAY. 178
153 1.000e-46gi|518282078|ref|WP_019452286.1| hypothetical protein [Serratia marcescens]  clstr ali  23  1MKLNKIMMAAAVAFGL--SSTAFAADQGHGKVTFTGAIIDAPCSINPDSIDQTVELGQISKVALLNGGQ-STPRNFSIDLENCTFAVKNKVALTFTGMESNANPAN-GLLGITGTAKGASVAITDGSGAVIKLGKPTKTQ-ELQSGSNSLNFAAYLQGDSASITEGEFQAVADFTLAY. 183
154 2.000e-46gi|493365955|ref|WP_006322373.1| fimbria A protein [Serratia plymuthica]  clstr ali  21  1MKLNKIMLAAAMTLGTISM--ANAANQGSGSVTFKGTIIDAPCSIEPGSLDQTVKLGDIASGQLKNGGK-SIPQDILIKLVGCDVETAKTVTTTFSGTESDATPGLLAMK---GSARGASIAINDIDGKVLALGKASKGQQ-IEDGQATLRFSANLQGDGAAIVPGEFNSVADFKLAY. 173
155 2.000e-46gi|497340217|ref|WP_009654430.1| MULTISPECIES: ferrous iron transporter B [Enterobacteriaceae]  clstr ali  24  1MKKTMLSACFML--------AAANAMAADGTIHFTGSITDQTCKIDTGSQNLPVNLGNVAQTALNGAGMRAAPTQFTINVSECPETVTG-ANVKFDGTSDNNDQSLLALDSGTGIATGVGIQIADKNGTAIPLHSASSDYT-LAEGANALDFVARYVSTGPAVTTGTANGTSEFTIIY. 169
156 2.000e-46gi|446750565|ref|WP_000827821.1| MULTISPECIES: fimbrial protein [Escherichia]  clstr ali  23  1MKRNIIGGALTLASLML----AGNALAEDGVVHFVGEIVDSTCEVTSDTADQTVPLGKVNKSAFSGVGSLASPQQFSIKLEKCP-STYTEAAVRFDGTEAPGGDGDLKVTGAAIVATGVGIRIFNSDNSQVKLYNDSAYTAIDGDGKAEMKFIARYVATNATVTAGTANADSQFTIEY. 188
157 2.000e-46METAHIT V1 GL0019396 [Complete] locus=scaffold14526_9:346:882:+  ali  29  1..MNKVALGLFIATTVGCSASAFAETNGEGQINFTGEIIDSACQVVNGSNPLDVQLGKVSKTVFTGAGSTSTLTKFDIKLTNCPETV-TSAAINFGGTPDADNNATLALTPDTDAATGVAIQLMDASGQPVTLYTPSKQY-PLASGTNDLEFGARYIQTQAAVTAGPANSVSTFTVIY. 177
158 2.000e-46gi|639141560|ref|WP_024485046.1| fimbria A protein [Serratia fonticola]  clstr ali  24  1MKLNQLVMALGLGVVMV-AGGANAADQGHGSVTFKGSIIDAPCSIDPETIDQTVNLGQVSNVALQADNNTSIPKNFQIRLEGCNLSTAKTVLTTFSGAE--GANGLLGI---TGTAKGASIAITDGTGKLIELGQASKPQG-IQDGSNTLVFSAYLQGDGATIVPGDFSSVADFTLAY. 175
159 2.000e-46gi|498303364|ref|WP_010617520.1| fimbria A protein [Plautia stali symbiont]  clstr ali  25  1MNMNKIVVALGLSMSLV-AGSAMAAGEGNGTVTFKGAIVDAPCSIELGSVDQTVELGQISNLALKD-GDRSTPRPFQIKLENCDTATKKEVTVTFGGTGSQVIPGKLAI---TGTASGAAIGI-NFGDTEIELGTATPAQ-KLMDGNNQLSFAAFLQGGGATIVPGEFQSVADFALNY. 173
160 2.000e-46gi|490365276|ref|WP_004244940.1| fimbria A protein [Proteus mirabilis]  clstr ali  25  1MKLKKLHLVLGL-GLSIIAGSALAADQGHGTVEFYGSIIDAPCSIDPDSGAQRIPLGQVSSSALKDGG-RSASKMFKIKLLQCSTETYKTVKTTFTGAEA---PDVLGALGIEGIAKNAAVVITNAGGEQIKLGQASAAQT-LNDGNNDLNFAAYLQSSSKAAIPGDFTAIATFALSY. 174
161 3.000e-46gi|554683985|ref|WP_023183901.1| fimbrial protein [Salmonella enterica]  clstr ali  27  1..MNGKLFKSALVCSSLLLGWQAHAANGNGIVHFTGEIIDNTCEVSTTTKDQTVDLGKVSKSTFTGVGSTASVQAFQIDLINCP-DTYKKATARFDGTEDGD--GYLKLN--AGGASGVAIAIYNADNSLLKLYNQSASAAIGADGKATLPFLARYIATSAAVTSGVANADSEFTITY. 172
162 3.000e-46METAHIT MH0079 GL0017572 [Complete] locus=scaffold53628_1:2648:3253:+  ali  26  20MKIKTLAIVVXXXXXXXXXXXXXTTTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLKQAGATSSAVGFNIQLNDCDTTVATKAAVAFLGTADATRTDVLALQSSAGSATNVGVQILDRSGNALTLGATFSAQTTLNNGTNTIPFQARYYAIGEA-TPGAANADATFKVQY. 200
163 3.000e-46T2D.2692700 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  23  20MKIKTLAIVVLSALSLSSTAALAAATVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLDQDGATSSAVGFNIQLNDCDTDVASKAAVAFLGTTDTNHTNVLALQSSAGSATNVGVQILDKTGTALALDGASSAQTTLNNGTNTIPFQARYYAIGAA-TPGAANADATFKVQY. 200
164 3.000e-46METAHIT MH0008 GL0025811 [Complete] locus=scaffold13109_11:784:1311:+  ali  27  7............LLGALFTLGAPAAFAADSTITISGYVRDNACAVAGESKDFTVDLQDNAAKQFYAVGATTPPVPFRIVLSPCGTSV-TAVKVGFTGVADSVNTSLLKLDAGTSAAAGMGVEILDQQQSRLPVNAPSSTWTTLTPGTNILNFYARLMATQVPVTAGHVNATATFTLE.. 173
165 3.000e-46gi|640698518|ref|WP_025122546.1| MULTISPECIES: hypothetical protein [Serratia]  clstr ali  24  1MKKNLIAAAVLASSTLGMS-----AFAVDGQVNFTGEIVDVACQVTNSKANLKVNLGKVSKSTFKAAGDVASATKFSLQLTACPDTV-TSAQVKFDGTSVNGDNSVLALTQDAGVAEGVGIQLSDDSNNLLPLFENSRTYELKPNVANDLSFVARYVATEATVKAGPANSTASFTINY. 173
166 3.000e-46gi|501382422|ref|WP_012413988.1| fimbria A protein [Yersinia pseudotuberculosis]  clstr ali  24  3...NFKKSVLVAAVLSLSAFAAHAADQGKGKVTFTGSIIEAPCSITSEAADQVVELGQISTASLANMGS-SEPRSFSIGLEKCDVATMKNVSVTFDGTPDGVDAEMLKLI---GLADGAGIVITDEAGATIKRGVASVSKT-LDQGSNSLKFSAYLKGTSASVVPGEFSSVANFTLAY. 175
167 3.000e-46gi|669013064|gb|KFD23937.1| fimbriae-like periplasmic protein [Yokenella regensburgei ATCC 49455]  clstr ali  21  1MSIMTNRFAWFAGCWLLSAGVVQATPLGEINIELRGNVVDFTCVAEAGDSDKTVPLGTWATKQLRPTGSTTSQVPFSLKLTGCPP---GSASITFSGKPDPKDSTLLALNGNSQ-ASNVAVEIRDKDRSRLPLDQASQEVVVDAQGNVTLQFFANYIATAEDPQPGVADADATFMINY. 175
168 3.000e-46gi|506490098|ref|WP_015965476.1| P pilus assembly protein, pilin FimA [Enterobacteriaceae bacterium strain FGI 57]  clstr ali  27  1MKLSTIASTVMASFLMTGAAQAAAVSVNGGSVHFKGELVNAACAVNTESSDQIVELGQYRTAKFTAVGDTTTNMPFTIVLNDCDPSVSATAAVAFSGQADATDATLLAVNATNNAAKGVGIEILDSKSKTLSPGATFSSAQTLLQGTNTLNFTARYKATADTAEPGQANADATFVMKY. 182
169 3.000e-46gi|505192245|ref|WP_015379347.1| fimbrial protein [Serratia marcescens]  clstr ali  25  1MRLRALALLSCAPWWFAAMPAAANTELIGAPVQFHGTVVSRPCNIEPQSADQLVEMGTVIVKTLYRYGHTT-PVPFSIKLTDCKTTVFKSVSVTFSGAEDGELPGKLAINNG---ANGAAIALFDHQGADISLNKATSA-VALQNGPNNLNFTAYVQGRPSAITEGEFTSVANFVLAY. 178
170 3.000e-46gi|504470340|ref|WP_014657442.1| fimbrial protein [Providencia stuartii]  clstr ali  22  1MKK----LFLLALVSSAMSTSVLAADMGHGKVNFKGSIIDAPCSISPDSIDQTVELGQISNVALVGGGKSSPRT-FDIALENCDMTGFKGVQLTFSGAAASFDNTN-KTLGIVGTGAGAGVQITNGSGNIITLGEPT-PFQNIQDGNNTLRFSAYLVGNGDTITPGEFSSVADFTLSY. 175
171 4.000e-46gi|573497826|gb|ETS98372.1| fimbria A protein [Providencia alcalifaciens PAL-3]  clstr ali  25  1MKLNKTLMAIAATTLIGFGANAAPVNHGNGKVTFTGSIITAPCSIDPSSIDQTVDLGQIADVVLKNGGTQSSPVMFDIKLIDCTVETGDSVNITFSGAAATNDPKSL--LAITGTAAGAGIQIVDSNNDPIVLNEVTKSEHKLQGTTNTLQFAAYVKGLGSDIVAGEFQAVTDFVLSY. 187
172 4.000e-46gi|504406036|ref|WP_014593138.1| fimbria A protein [Pantoea ananatis]  clstr ali  24  1MKLNK-AVKSFGLCAMMVAFGATAADQGHGEINFKGSIVDAPCSITAESANQTVDLGEVTNAALKNGGK-STPKAFTVKLEQCDTATSESVTATFTGAASAGNKDLLGI---TGTASGASIAITNGAGQIIKLGEESPAQ-SIQDGTNSLAFSAYLQGDPVTIVPGDFTSVANFTLAY. 179
173 4.000e-46gi|695735181|ref|WP_032661653.1| hypothetical protein [Enterobacter sp. DC1]  clstr ali  20  1MMFKKTTLAVFFMLPIIS------AYAVDGSVNFTGEIVDAACKVDVGSSALSVDLGKVQKSALTGDGSTASATKFTLKLSSCPSTITK-AAVKFAGTPYDNDDSILALTSGTGVATGVGIQLLDAGNAVLPLFTDSTSYTLVADDENDLDFYARYIQKGTTVVAGKANATASFTIDY. 172
174 4.000e-46gi|446096412|ref|WP_000174267.1| fimbria A protein [Salmonella enterica]  clstr ali  23  1MTLNKLI-ATTIALGFICTANAAPLDSGHGTVKFKGSIIEAPCSITPDTVDQTVDLGQISNVVLKDGGK-SSPKNFYIKLENCDVSTVKTVSTTFTGAPSAGNPDLLGI---TGTARGASIAITDGAGSTIKLGDATKPQG-IQNINNTLAFSAYLQGTGADIVPGEFSSIANFTLAY. 179
175 4.000e-46gi|668965127|gb|KFC82527.1| fimbrial family protein [Ewingella americana ATCC 33852]  clstr ali  23  53MKRNITGLALLVASIVSTS-----AFAIDGTINFKGNVISNPCTVSAASKSLDVQLGKISATSFPTSGSLSAAQKFTLVLSGCPTTV-TSAKVRFDGNQVSGDNSILAVTSGTGKAGGIGIKIYDRNDNPVSLYQDSAAY-PLTTAANNLEFKARYVSLANTVTPGAADGAAQFTIIY. 223
176 4.000e-46gi|493872427|ref|WP_006818898.1| type-1 fimbrial protein subunit A [Yokenella regensburgei]  clstr ali  29  15MKLKTIAALVATLGLVATAANADAVSVNGGTVHFKGELVNAACAVSTASSNQTVELGQYRTATFTKTGDTSAKIPFSIVLNDCDPTVAATAAVAFTGQIDAQDKTLLAIASGDNTAGGVGIEILDSSGTLTPNGSVFSAAQNLIQGTNTLHFSARYKATADTTAPGQANADATFVMKY. 196
177 5.000e-46gi|502861993|ref|WP_013096969.1| ferrous iron transporter B [Enterobacter cloacae]  clstr ali  25  1MMKNKM---MITLLAVGSALTATHAFAAAGTVNFNGNILDSACDVDVASQNQVVVLGDYYKTEFPTTGARTAATQFNIVLKNCPVTV-TNAKVRFDGTPDATNSSLLAIDSSAGAATGVAINLMSADKADLPLGSNSYSYVLSSTADNTLSFYAQYISTAATVTAGPANSVANFSVVY. 176
178 5.000e-46gi|499198240|ref|WP_010895780.1| SefA [Serratia entomophila]  clstr ali  26  1MKINKIASVLLLASGL-TAFGANAADQGSGRVTFTGSIIEAACSVNPESSDQEVDLGQIAASQLADGGS-STPRNFEILLENCDADKANTVTVTFGGSAADSSNQLLGI---TGTASGAGVAVTDGSGNLITLGQATGAR-ELIEGSNTLNFSAYLQGISTEISTGEFQSVADFTLAY. 174
179 5.000e-46T2D.3274692 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  26  1MKKSLVLVALTATAALSMS----HAFAAAGTVNFVGNILDTACEVDVASQNQQVNLGNFYKTEFPSSGTKAAAKDFNIVLKNCPTTVTST-KVRFDGTPDLTNPNLLAITSTSSAASGVAINLMTADKVDLPLGENSYNYILSSTQDNTLKFYAQYISTTASVTPGTANSVANFSIVY. 175
180 5.000e-46gi|499458949|ref|WP_011146413.1| fimbrial protein [Photorhabdus luminescens]  clstr ali  24  1MKAKLI-----ISSLLASSVFISVANAADGKINFTGNIIANACKIDTDSANQNVNMGTISSNAFSGVDSTAAATPFSIKMSDCPPE-YTHAQVKFDGQIDNRNNNLLALSNDKGVADGVAIGIYEEDNTLIPLAKASKSQAFTDQKTAELKFIAKYVATAQAISPGSGDAVANFTIVY. 175
181 5.000e-46gi|569537117|gb|AHE59424.1| fimbrial protein FimF [Escherichia albertii KF1]  clstr ali  29  11..............CAFLWLVASSALAADSTITIRGYVRDNGCFVAAESTNFTVDLMENAAKQFNNIGATTPVVPFRILLSPCGNAV-TAVKVGFTGVADGNNANLLALESHSSSAAGVGIQLLNEQQNQIPLNAPSSSWTTLTPGKNTLNFYARLMATQVPVTAGHINATATFTLEY. 176
182 5.000e-46gi|668712366|gb|KFB98089.1| SfmA family fimbriae-like adhesin [Trabulsiella guamensis ATCC 49490]  clstr ali  26  1MKLKTLAAALVAMSGLATTAANAAVTVNGGTVHFEGELVNAACAVSTTSSNQTVELGQYRTASFTQTGDTSARIPFSIVLNDCDPTVAATAAVAFNGPVDADDNTLLAVTSGSTTAEGVGIEILDNTSSVLTPNGAFSVAQNLIQGTNTLHFSARYKSTTDTTTPGQANADATFVMKY. 182
183 6.000e-46gi|648277846|ref|WP_026058995.1| hypothetical protein [Enterobacteriaceae bacterium LSJC7]  clstr ali  26  7........................AWSYDVTININGIISESGCELDSRSKSFTVTLGDVVSTSLRGQGATSTAIPFSIFLINCN-SLANAVVVTFNGTPDATDSRLLRIFEEEGSASGVGIEILDHNNQAIAINSPAESHPLIPNADAQLQFYARYKSTG-AVTAGPANAVATFTLEY. 158
184 6.000e-46gi|504470871|ref|WP_014657973.1| fimbrial protein [Providencia stuartii]  clstr ali  23  1MKMKSIAMATFMALGLASA--ANAADQGHGKITFKGAIIDAPCSISPNSIDQTVELGQISNMALVDGGK-STPRPFEITLDNCDITLAKGVQLTFSGAAASFDNTN-KTLGIVGTGAGAGVQITNGSGNVVTLGTAT-PFQQIQNGNNTLNFAAYLKGNGDTITAGDFSSVADFTLSY. 177
185 6.000e-46gi|504694785|ref|WP_014881887.1| MULTISPECIES: fimbrial protein [Enterobacter cloacae complex]  clstr ali  27  1MKGNTLKSIVVLSSLFF--GAQTHAANGNGTVHFTGEIIDSTCEVSTGTKDQTVDLGKVNKSTFTGVGSMASVQAFQIDLLNCP-DTYKKASARFDGTEDGD--GYLKL--SSGGASGVAIAIYNADNSLLKLYNQSTPAT-ISSGKASLPFMARYIATSATVTAGTANADSEFTITY. 171
186 6.000e-46gi|595620999|gb|AHM77756.1| FimF protein precursor [Klebsiella pneumoniae 30684/NJST258_2]  clstr ali  27  41............LLGALFTLGAPAALAADSTIAISGYVRDNACTVAGESKDFTVDLQDNAAKQFYAVGATTPPVPFRIVLSPCGTSV-TAVKVGFTGVADSVNTSLLKLDAGTSAAAGMGVEILDQQQSRLPVNAPSSTWTTLTPGTNILNFYARLMATQVPVTAGHVNATATFTLE.. 207
187 6.000e-46gi|495230492|ref|WP_007955263.1| fimbrial protein [Pseudomonas sp. GM25]  clstr ali  28  1MKKIVAVTAATVVMGLAFANAASPASGNPGTVRFIGEIVSGACGIDANSLDQTVSLGQVPSNQFKAIGDRSTPTKFDIVLTDCDTATQKNARFTFSGVQDPAVPALFA---TTGLAQNVGIRLQASAGEMLDNGKEQVAPVVLQNGNNTVTFAAMYEATAATVTTGEADSVANFTVAY. 176
188 6.000e-46gi|486177647|ref|WP_001536563.1| S-fimbrial protein subunit SfaA [Escherichia coli]  clstr ali  27  1MKLKFISMAVFSALTLGVATNASAAPANGGTVHFKGEVVDAACAVNTNSANQTVLLGQVRSAKLANDGEKSSPVGFSIELNDCSSATAGHASIIFAGNVIATHNDVLSLNSAAGSATNVGIQILDHTGTAVQFGATASTQFTLTDGTNKIPFQAVYYATGKS-TPGIANADATFKVQY. 181
189 6.000e-46gi|575850200|emb|CDL87344.1| Similar to fimbrial subunit type 1 [Xenorhabdus cabanillasii JM26]  clstr ali  24  1MKTKLIISSLFVSSVFMSLAHAANGNIQDGEIRFTGKVIADACKIDPTSKNQTVNMGTISTNSFNGVNSTAAATHFSIKLTDCPK-INEYASVKFDGQLDNINNALLALDNSPGAADGIAVGIYEQNNTPIPMAKTSS-QKIIENQKIEMNFIAKYVATKQTITPGTGNAVANFTIVY. 178
190 6.000e-46gi|499644784|ref|WP_011325518.1| fimbrial protein [Burkholderia pseudomallei]  clstr ali  31  41MKK-------ALLSAVACAALSTSAFAAGGTLNFTGEIVAGACGIDAGSVDQTVRLGFVPANTFKAAGDKSTPQNFDIKLVDCDTSVAKNAYFTFTGTSNATQPKLIA---TVGSATNVGIRLQSASGEYLDNGAEQKGPVVLSNGTSVARFAAMYESTAASVTPGTADGVANFTVRY. 209
191 6.000e-46gi|669020477|emb|CDS56179.1| Fimbria A protein [Serratia symbiotica]  clstr ali  25  1MKFNKLMLPTVIAIALTSVAHAAASNQGHGKVTFNGEIINAPCSVAAESVDQTVAMGQISSNLLAKQGK-SHMEPFSIELKDCALSTMNNVKVTFTGTADPNNRKMLALI---GSASGAGIMIYDKHSKDVELGTETVGQA-LNKGDSSLKFAAYLQGSSATVVPGDFTSVANFTLAYL 184
192 7.000e-46gi|639223547|ref|WP_024560782.1| fimbrial protein [Cronobacter pulveris]  clstr ali  22  1MKKHVLALVVTALMAGGTVSAAQAADVAGGTVNFIGEVVNAACAVSADSVDQTVTLSQVRTVRLATAGQAAGQKDFQIKLEDCDTTVSTAAAVMFNGQEDADVAGTLANTAGAGAAKNVALQLYGPDGKVLPMGDKSSS-ITLVDGSNVVPLSVDYIATKAASTPGNVAAVATFNMIY. 180
193 8.000e-46gi|657888602|ref|WP_029592652.1| ferrous iron transporter B [Cronobacter pulveris]  clstr ali  27  16...................LSASCAFANAGTVNFQGKIIDAACDVDVGTQNQTVQLGAYNKSEFTQAGDKTAATKFNIVLKNCPATVTG-AKVRFDGTPETKDSTLLAIDSSAGAATNVAINLMTADKADLPLGTNSYVYNLTDAGDNTLNFYAQYEATAAGVTAGPANAVANFSVDY. 175
194 8.000e-46METAHIT V1 GL0118531 [Complete] locus=scaffold6741_3:1187:1708:+  ali  23  8.........LAVALFALCSPAHAETALGEINIQLYGNIVDFTCVAEGDDSNKTVTLGTWPTKQLRTTGSRTQPVPFTLKLTGCPPGA---ASVTFTGKMDGHDNSLLALNDAS-AASNVAVEILDRDKTRLALQQASQTVAVDAQGNAELSFYANYIATADNPQPGRADADATFMINY. 172
195 1.000e-45gi|493863061|ref|WP_006809811.1| adhesin [Enterobacter hormaechei]  clstr ali  21  1..MRNGMRCLAVALFALCPHAYAETALGEINIQLYGNIVDFTCVAEGDDSNKTVTLGTWPTKQLRTTGSRTQPVPFTLKLTGCPPGA---ASVTFTGKVDGHDNSLLALNDAS-AASNVAVEILDRDKTRLALQQASQTVSVDAQGNAELSFYANYIATADNPQPGRADADATFMINY. 172
196 1.000e-45gi|577076939|gb|EUD12932.1| fimbrial protein [Providencia alcalifaciens 205/92]  clstr ali  22  1MKKNLLASLIAASSIFAV----NSALAADGTIDFTGEITDQACELAAGSDALKVNLGKVSKKALPSAGSTAAATKFTIKLINCPTTV-TSASVKFDATSYPGDDSVLKNAGQSGVAKGVGIQITDDVNTVIPLFTASKAYPLKDGVENNLDFRARYIAQTDSVDVGLANANATFTINY. 175
197 1.000e-45gi|501083974|ref|WP_012134485.1| fimbrial protein FimF [Citrobacter koseri]  clstr ali  26  1MMMKKPLYFLGAVLTLACV----NVFAADSTITISGYVRDNACAVAGESKDFTVDLMNNAAKQFNAVGATTPLVPFRIVLSPCGNSV-TAVKVGFTGTEDSSNTCLLKIDSGASAAAGMGVQILNNQQTMLPLNAASSAWTTLTPGTNILNFYARLMATQIPVTAGHVNATATFTLE.. 175
198 1.000e-45gi|489143349|ref|WP_003053114.1| Fimbrial protein [Comamonas testosteroni]  clstr ali  24  9.RLKYIHSLAAFALGLLMAGMALPALALDGIATFKGNLINAPCTLRPADEDLKVDLGQIFQNDFYQTG-RSDSKPFTIHLDDCDAGLASSVKVKFSGSENTSLPGLLALDTGGGT-RGVAIAIENAAG-VLPINTQTSA-LPLNAGSNDLHFTAYVQGESKTIVPGPFVATATFTFQY. 187
199 1.000e-45gi|516438115|ref|WP_017827027.1| type-1 fimbrial protein, A chain [Proteus mirabilis]  clstr ali  30  1..MSKLNKSLCALGVTLSIFSAPAALA-SGTINFTGEITDQACTVDGSSKNLTVDLGKVSSKSLATKGEVAGLKDFTIKLIDCP--VDTTVAVRFGGTRDASDRDILAIEQVSGGATNVGIALFEKDASQIKLYDDSQD-VQITGTEINLDYVARYKAT-DAATPGPANGSAVYSIQY. 172
200 1.000e-45gi|639141210|ref|WP_024484706.1| fimbria A protein [Serratia fonticola]  clstr ali  23  1MTMNKTLLAVAVIFGM--SSLAHAADQGHGKVTFTGSIIDAPCSIAPESSDQTVELGQISNVALQDGGM-SKPKSFDIKLDGCSPAAKNKVAVTFAGIESVAGNGLLGI---TGGAKGASVAITDGAGTVIELGKPTKEHV-LQGDNNTLTFAAYMQGDGAAATEGDFQAVTDFTLAY. 176
201 1.000e-45gi|503132337|ref|WP_013366998.1| ferrous iron transporter B [Enterobacter lignolyticus]  clstr ali  22  1..MKKIVIGALIASSLCGSVSVFAATNGEGQVNFTGEILDSACEVVNNSNPLNVNLGKVSKTAFSGIGSTADTTQFAIQLKNCPETVS-TAAITFGGTPDTDNNNVLALTAGTGVAAGVGIQLLDSSQQPLSLYTASQPYTLQSTATNNLEFAARYIQTQSTISAGPANAVSTFTVVY. 177
202 1.000e-45gi|502386190|ref|WP_012776913.1| fimbria A protein [Photorhabdus asymbiotica]  clstr ali  27  33MKLNKLVMALGLVVLAVGSVNAANPSQGHGTVTFTGSIIDAPCSITPETVDQVVPMGAISNAALKNGG-RSSSRSFKISLENCTTDTISTVTTTFVGAKSNGGDGLLGIE---GTAKGAGIAITDAGGNKIKLGTPSPA-VALHDGNNDLNFAAYLQGTPDAVVPGEFTGIANFQLAY. 210
203 1.000e-45gi|490223914|ref|WP_004122273.1| type-1 fimbrial protein subunit A [Klebsiella oxytoca]  clstr ali  28  1MNKLAVIVFXXXXXXXXXXXXXDPVTVNGGTVHFKGEVVNAACAVDAGSLDQTVQLGQVRSAKLAAAGNTSAPVGFNIQLNDCDITVSEKAAIAFAGTANSTNPTVLALQGSAGGATNVGVQILDRTGTPLALGATFGAQTTLSNGTNVIPFQARYFATGVA-TAGTANADATFKVQY. 180
204 1.000e-45gi|503580247|ref|WP_013814323.1| MULTISPECIES: fimbrial protein [Serratia]  clstr ali  24  1MKKNLLALAVVSASVFTTS-----AFAADGVVNFKGSITDQSCTVDTTSKNKEVVLGKVSKDAF-TAGKTAGAKQFSLVLKNCPKTVSG-ATVRFDGTKVVGQAGLLTLTEATDAATGVGVQLLDDQNSVINLGVDSRIYTLVSTGDNTLDFMARYYAY-AAVGTGSANATANFTVVY. 170
205 1.000e-45T2D.2919414 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  24  1MKRNIIGGAFTLASLML----AGHALAEDGVVHFVGEIVDTTCEVTSDTADQIVPLGKVSKNAFSGVGSLASPQKFSIKLENCPAT-YTQAAVRFDGTEAPGGDGDLKVTGQAIAATGVGIRIFNSDNSQVKLYNDSAYTAIDAEGKAEMKFIARYVATNATVTAGTANADSQFTVEY. 188
206 1.000e-45gi|727171692|ref|WP_033638936.1| fimbria A protein [Serratia marcescens]  clstr ali  24  1MKLNKI--MLAAVMAFGVSSLANAADQGHGKVTFSGSIIDAPCSISPESMDQTVELGAISNVALKNGGK-STPRNFDIKLENCELTTANTVSLTFTGAVSAIDSKLLGI---TGTAKGAGIAITDGSGNDIVLGTKTNAQT-LQNGANTLSFAAYLQGVNASVVPGEFQSVADFTLAY. 178
207 1.000e-45gi|490216814|ref|WP_004115193.1| MULTISPECIES: fimbrial protein FimF [Klebsiella]  clstr ali  24  1MMRKNLYLLGAILSLVSFS-----TPAADSTITISGYVRDNTCAVAGESKDFTVDLMNNAAKQFNAVGTTTPLVPFRIVLSPCGGSV-TAVKVGFTGIADSDNTSLLKLDSGVSAASGIGVQILNGSRAPLVLNAPSSAWTTLKPGTNTLNFYARLMAARVPITAGHVNATATFTLE.. 174
208 1.000e-45gi|639216401|ref|WP_024554142.1| fimbrial protein [Cronobacter helveticus]  clstr ali  34  4.KKRPDLCSTLILSGFLLSLPVQAITDYDGDVRFFGEVVNAACAVAVDSQDQTVLMGQVRSNSFTDLGEWTDPHPFRIKLEDCSTNVSQNVGVMFSGETDGKDLLVFRTGNGAGAAEGIGIGITDATGQLIIPNTAPARYAPIQEGETVLHYTARYRSTSRTVKAGNASAQVWFNLFY. 184
209 2.000e-45gi|652343951|ref|WP_026741142.1| type-1 fimbrial protein subunit A [Lonsdalea quercina]  clstr ali  26  1MRKTLLGALIGASILSAGYASA-ATTVAGGTVHFTGQIVNAACAVSSTSANQTVNLGQYRTANFTAVGAYSGKVPFTIKLEDCDPTVSTTAAVAFSGSADGNDNTVLSTSNSSGAAAGVGIEISDSKGTVLSPGAAFSSPQTLITGSNTLNFNARYKSTLATVTPGEADADATFTMQY. 182
210 2.000e-45gi|491172716|ref|WP_005031083.1| type-1 fimbrial protein subunit A [Acinetobacter bereziniae]  clstr ali  25  1MKK-----LGLLAAACVMSSASFAAPVNGGTVHFVGELVNAACAVSTDTADQTVDLGQHRTARLAVAGDKSGPVPFNIQLVDCDASVTNGVSFAFNGQTVSTNNKLLAVNGGGGAATNVGIEITDYASKILAVGSDFSTEKAIIDGTNTFPFTARYVATGAS-TPGKANADATFVVNY. 177
211 2.000e-45gi|694087291|ref|WP_032432059.1| hypothetical protein [Klebsiella pneumoniae]  clstr ali  25  1MKNMSLKVMSLAFIMTASSAAFADVNGGSGTIHFTGTVIDAPCSIAPESIEQTVELGSVALSSLKTAGSHSRPATGEIKLVDCTTTTYSKVGVTFSGTPDATVAALLANDS---SAQGVGVRLLDQDGKAIELGSETE--YPLGNG-ATIIYQAYVEANGNTVTAGDIRSDATFKLNY. 180
212 2.000e-45gi|653022525|ref|WP_027274423.1| fimbrial protein [Leminorella grimontii]  clstr ali  23  5.........VLLGIAIAAGSLCSAVQASDGTINFTGSITDKTCTIDSGSKSLNVPLGNVSKASLHGAGMKSSPTSFQIGLSGCP-ETAKAATVKFDGKATGSDQSLLALNGVDGVATGVGIEISDVNNNPIALYTASPEFT-LVQGANTLKFVARYVSTGPVVTTGPADGTSQFTIVY. 172
213 2.000e-45gi|503835211|ref|WP_014069205.1| adhesin [Enterobacter asburiae]  clstr ali  22  1...MRRLSKALLLVALVHANAHATTALGEINIELYGNIVDFTCVAEGSDSDKIVTLGTWPTKQLSTTGSRTQPVPFTLKLTGCPPGA---ASITFSGKEDGSDSGLLALNDSSQ-ASNVAVEIRDRDKTRLALQQASQTVAVDTQGNAELSFYANYIATADNPQPGRADADATFMINY. 171
214 2.000e-45gi|695774969|ref|WP_032697820.1| type-1 fimbrial protein subunit A [Raoultella planticola]  clstr ali  27  1MKLNITSLAGLFSVLTFGAAMNAFADVNGGTIHFKGEIVNAACAVNTNSFDQTVQLGQVRASLLNAKGAKSSPVGFDIELNECDTTVSKAASILFTGAAVSADKDVLALQGSAGSAKNVGIQITDGSGTPVMIGSAGSTAYQLTDGTNKIPFQAAYYATGQA-SAGVANADATFKVEY. 188
215 2.000e-45gi|655316106|ref|WP_028724550.1| fimbrial protein [Pantoea ananatis]  clstr ali  22  1MKKTLIAIAL-----MATSAISSSAFASDGAVNFTGTITDAACTIDTASQNQDVFLGNIARTAFSGAGSLAAAKKFTLVLTDCPDTVTG-ATVRFDGTQVSGDNSILALTAGDSTATGVGVQISDSQNKVVPLFEDSSVYPLVSTGPNNLDFSARYISVADDVTVGDANAVTQFTVVY. 172
216 3.000e-45gi|639142058|ref|WP_024485521.1| fimbria A protein [Serratia fonticola]  clstr ali  26  3MKKTLLAAVIALGSVSV----AQAGELGHGKVTFNGSIIDAPCSISAKSIDQTVELGQISNVALKDGGKT-EPHHFSIDLESCDLGTTNKVVITFSGAESTAQQGLLAI---SGTAKGASVAIAQGNGELIKLGTATKEQV-LQNGSNSLKFAAYVQGTAATITEGSFQASADFTLAY. 177
217 3.000e-45gi|723242879|gb|AIX75515.1| hypothetical protein PSNIH2_18325 [Pantoea sp. PSNIH2]  clstr ali  26  1MKTELRVMALILSCFASGAAISAGTNPGDGQINFTGNITDASCNVDTAKIDENVRLGTWASSYFTTVGTETQKQPFHISVKDCPDTVTK-VAVLFDGQAADANEELLAINNGPGTATGVAIQLYEDDKQQVKLGHVTNEHIKTHDKDTELTFYADYRSTSEDVTVGEANAVVNFSMVY. 187
218 3.000e-45gi|501408459|ref|WP_012440025.1| fimbria A protein [Erwinia tasmaniensis]  clstr ali  23  1MKLNKIMMVAAIAFGA--SSIAHAANQGQGVVKFEGSIIDAPCSINPDTVDQTVNLGQVSKIALKDGGQ-STPKEFQILLENCEIEEGKNVSLTFTG--VKAASGNLAIN---GEAKGASILLSDTSGKPIKLGTATAAH-KITEGKNILRFNAALQGDGKAVTPGNFTSVADFTMAY. 172
219 3.000e-45gi|500910545|ref|WP_012015814.1| fimbria A protein [Enterobacter sp. 638]  clstr ali  24  1MNFKKAALASVMGMLLV-AGAANAKDQGHGKVTFTGSIIDAPCSINPDSIDQTVSLGQVSNVALKAGAGTSVPRNFEIKLEGCDTTTLKSVKTTFTGAEGATDGSL----GITGTAKGASIILTNGDGVQIKMGEASAARQ-LQDGNNTLLFSAYLKGDGASATPGDFTAVADFTLAY. 176
220 4.000e-45gi|501081513|ref|WP_012132109.1| ferrous iron transporter B [Citrobacter koseri]  clstr ali  27  2MKKNMIAMALSAAAILSIS----HAIAYDGTVKFVGQVLDTACTVDIGANNMTVDMGSVYKTAFTNAGDEASTTKFTLRLINCPSSV-TSARVKFDGVNHSGNTDLLALSADPGSASGVAIRLMTADRAPLGLNQNGYSYSLLDMVDNQLDFYAAYVATSVPVVPGVVNAVANFTVNY. 176
221 4.000e-45gi|667778792|ref|WP_031397316.1| fimbrial protein [Burkholderia sp. MSh1]  clstr ali  32  23.............................GTITFQGEIVAGACGISADTLDQTVSLGQVPSNVFKKVGDRSQAQQFNIVLTDCDTSTQSNAYFTFTGASDSANPELFA---TTGSAANVGIRLQSSSNEYLKNGTEQSAPVVLSNGDNTVKFGAMYEATGASVTPGIANSVANFTVRY. 168
222 4.000e-45gi|695828281|ref|WP_032741810.1| ferrous iron transporter B [Klebsiella oxytoca]  clstr ali  28  4..KDNLKKKCLIAVSLAAAAFSASVLADDGRINFYGSITDSACTVVNNSNPLSVMMGNVSSSAFTGAGSTASPTKFNIALKDCPES-AKSATVKFDGTADSNVATLLALTQEAGVAKGVGIQLMDNKNVVVPLYTASSAY-PLQAGDNNLAFVARYYATANTVSAGFANATSSFTLNY. 178
223 4.000e-45gi|498114113|ref|WP_010428269.1| adhesin [Enterobacter mori]  clstr ali  20  8........IAAGVLMMLHAGAQAATALGEINIEMSGNIVDFTCVAEGNDSDKVVTLGTWPTKQLRTTGSRTQPMPFTLKLTGCPPGA---ASITFSGKADGSDSGLLALNDGS-TAGQVAVEIRDADKTRLDLQQASQPVTVDAEGNAVLSFYANYIATADNPQPGRADADATFMINY. 173
224 4.000e-45gi|514233093|ref|WP_016535742.1| putative PRS fimbrial major pilin protein [Cedecea davisae]  clstr ali  23  9.KMKKFIFTVAFGAMVCASAASAVGIGGSGKVNFSGSIVDAPCSMDPNTADQTVELGATSNLHLSN-GSSSTPKPFKILLEGCSGETLGSVTTTFKGLQADEDTTLLRLI---GSASGAAIAINDYKGRQIKMGEASPAY-NLATGNNELDFSANLKGFGKPVVPGEFTAIANFTLDY. 183
225 4.000e-45gi|639209232|ref|WP_024547425.1| MULTISPECIES: ferrous iron transporter B [Cronobacter]  clstr ali  26  1MKKNVFAVAFATVAVL----SASSVFAADGTVNFTGEIIDQACTVEIGTSNLTVDLGKVAKSSFAAVGDDASITKFSMKLKACPESI-TSAKVKFDGPNDATDSSLLALTSETGVAKGVAIALMTADKTDLGLNSVSDSYALKATEENTLDFYAAYRSTAATVVAGKANSTATFSINY. 175
226 4.000e-45gi|689261608|gb|AIR02540.1| hypothetical protein LG71_22765 [Pluralibacter gergoviae]  clstr ali  25  1..MKVSACAIAILSGVVFAGTAAAADEGHGIIHFKGAIIDAPCSINPDSEEQTVKLGAISSATLINSG-TSTPTSFSINLEKCALTTAKNVEITFTGIGTESNPDQLGI---SGSAKGATIALTDAAGTPIKLGTAYSAPA-LHDGSNQLRFAAYLQGDGSAVTPGDFTSIANFTLAY. 173
227 5.000e-45gi|501096817|ref|WP_012146849.1| fimbria A protein [Serratia proteamaculans]  clstr ali  24  1MKLNKIMMAAVVAFGMSSMA---HADEGHGKVNFAGSIVDAPCSISPETVDQTVNLGQVSNVALKDGGK-STPKNFQIDLENCTVATGKTVQVTFTGAKAQETNKNL--LAITGSASGAGIAMTDTSGALVELGKGGTAQM-LQNGNNTLQFAAYMQGLTAAVVPGDFTAVTDFTLTY. 178
228 5.000e-45gi|490362058|ref|WP_004241821.1| Fimbriae-like adhesin SfmA [Morganella morganii]  clstr ali  28  4.KQRLVMSVVALAVLSASQLSMAATTVTGGTVHFTGRIVNAACAVSADSTDQTVNMGQYRTAFFNAKGKKSGDVPFSIKLEDCDTSVSTKASVSFSGLSSADDPTALQTSNSAGAAKGVGIQIADHLGKVVKPGSVFSTAQNLVDGVNVLNFSANYISTQATVTPGGADADATFTMQY. 185
229 5.000e-45gi|502752342|ref|WP_012987326.1| fimbrial protein [Xenorhabdus bovienii]  clstr ali  24  1MKFKLI-----ISSLFVSSLFATTANATIGTVNFKGEITDKTCEIDAASANQTVNMGKVSVKEFSGENKVAAATKFSIKLTECPTEI-KNALVKFDGSSHESKGKLLALTTDSKNAKGVAIGIYDNSDNLVGLYKDSKSYA-IEKGAAELPFIAKYVATSDNVSAGSANAVARFTVVY. 172
230 5.000e-45gi|490382913|ref|WP_004262424.1| fimbrial protein [Providencia rettgeri]  clstr ali  26  1MKKIIATAIFAALCVG------QVANAKDGTVKFVGDIVTAPCEVAQNSWDQTVQMAQVKTATFADAGAKSADKKFQISLLTCDVTQFKNVSVSFAGQTNGDDATLLALDGGQGAAENVGIAIYDSKGKKLALGTATAD-TALQVGSNTLYFSAAYVSTKKDVKAGSANATADFNLTY. 171
231 5.000e-45T2D.3697791 [KEGG:K07348] minor fimbrial subunit;|[COG3539] P pilus assembly protein, pilin FimA  ali  23  2MKYNNI-----IFLGLCLGLTTYSALSADSVIKISGRVLDYGCTVSSDSLNFTVDLQKNSARQFPTTGSTSPAVPFQITLSECSKGTTG-VRVAFNGIEDAENNTLLKLDEGSNTASGLGIEILDANMRPVKLNDAGMQWIPLVEQNNILPYSARLKSTQKSVNPGLVRASATFTLE.. 175
232 5.000e-45gi|661297207|ref|WP_029990085.1| hypothetical protein [Tatumella ptyseos]  clstr ali  38  3...KIRLFFLLVVMGQAIASPPNNITLAGGLMRFQGEILSDTCIVDDGEQYLTVPMGQVSNNKFIHAGDDSDPVLFSLYFKHCSQSVKRNMNIVFRGVADQQNPDLLAIEQGNNVAHGIGIALFDEQGDLIPVNSGILSVRDINSGPLVLNLIAKYRSTSSDVTGGLANAQAWFSLTY. 177
233 6.000e-45gi|668702118|gb|KFB89773.1| fimbria A protein [Serratia grimesii]  clstr ali  30  1MQLNKIMLS-AILSLGAISVAHAAGDQGHGTVTFSGSIIDAPCSIALSDINQTVDLGQVSNVALANGGS-SKPASFEVKLEGCVLGTAKNVTTTFTGIEGAN-----GLLGMTGAAKGASIALTNGDGSPLKLNTPSKKQV-LQDGNNTMSFSAFLKGDGAAVVPGDFKSVVNFTLAY. 173
234 6.000e-45gi|496196481|ref|WP_008916318.1| fimbrial subunit [Providencia sneebia]  clstr ali  24  7.........IFSATLLMSMLFSSTAFAADSTITIKGNVKDNTCAVAPGSQSQVVDLLNNPVKQLYAVGEVTAVVPFQIDLTPCGESVI-AVKVGFVGIADVNNNALLALESGNSNASGVGIQILDGSRTPLELNANSSSWTPLVAGGNTLHFYARLMASKLPVVAGHVRATATFTLE.. 176
235 6.000e-45gi|495127477|ref|WP_007852288.1| PapA [Cronobacter sakazakii]  clstr ali  26  1MKFSKVSLAAA-MGLMLAAGMANAQDQGHGKVTFTGSIIDAPCSIHPDSIDQTVGMGQISNVALKANGNTGTSVPFEIKLENCDVSTLKTVKTTFTGAEGATDGSL----GITGTAKGASIILTNGDGQQLKLGEASAAHQ-LQEGNNTLLFSAYLQGDGATIVPGDFTAVADFTLAY. 176
236 6.000e-45gi|514235602|ref|WP_016538251.1| fimbrial protein [Cedecea davisae]  clstr ali  32  19..MIRKILLLVILAAANPAQAKRVVVINGGDVHMQGELVNGACAVAPESQEMTVQMGQYPSNAFKDVGSYAPPIPFTLRLTDCRPEVYDHVGIAFQGSTPAEDPQVLATSSVTGASSGIGLALFDQQQQLIIPNSEPATYLPITTQEMSVHFTARYRSVSKHMTPGNIRSDVWFTLVY. 198
237 6.000e-45gi|493362467|ref|WP_006318899.1| fimbrial protein [Serratia plymuthica]  clstr ali  24  1MKKNLLAVAVLTA-----SAFTASVFAADGTVNFKGSITDKSCTVDTASQNQDVILGAISKTAFATAGSSAGGKEFSLVLKDCPNTVTK-ATVRFDGTRVPGPVGLLALTDVADKANGVGVQLLDDSNNAINLGNDSREYALVSTGANTLKFFARYYAFG-TVSVGKADATTNFTIVY. 172
238 6.000e-45gi|496187225|ref|WP_008911732.1| minor F1C fimbrial subunit [Providencia burhodogranariea]  clstr ali  37  3.KLISLIVVLCSASFHVLAGDKHHVIIDGGMVHLRGGLVEAGCSVSTEDEQNIINMGKLRTNQFKGAGSYTEPVTFKIKLTDCSTAISEKVSISVFGSINDRDPQIFKLEQSDAAAKGVGIALFDTNGEIILPNMLPTKWISFHEGESILSFNARYRATDMQVIGGKANASLWFNLIY. 179
239 6.000e-45gi|545289339|ref|WP_021572264.1| type-1 fimbrial protein, C chain [Escherichia coli]  clstr ali  28  1MKLKFISMAVFSALTLGVATNASAVTVNGGTVHFKGEVVNAACAVNTNSFDQTVNLGQVRSERLKVDGAKSNPVGFTIELNDCDSQVSAGAGIVFSGPAVTGKTDVLALQSSAGSATNVGVQITDHTGKVVPLDGTASSTFTLTDGTNKIPFQAVYYATGQA-TAGIANADATFKVQY. 185
240 6.000e-45gi|695772777|ref|WP_032695642.1| type-1 fimbrial protein subunit A [Raoultella planticola]  clstr ali  23  1MKLNKFAVIFGAVMAMSAGMXXXXXXXXXXXXHFRGSLVDAACAVSADSADQTVTLGQYTLHHFKNVGDSSSAIPFKIKLEDCDTTIASTAAVAFSGQRDATQTNLLAIDSSTATASGVGIQILDEASQKVNPGSTFSTAHTLVDGENVLNFSAQYVSTVAAPTAGQANADAVFIMQY. 195
241 6.000e-45gi|500911849|ref|WP_012016396.1| adhesin [Enterobacter sp. 638]  clstr ali  23  1.MRKTMLIAVMTLLGAPMQGSLAATPLGEINIELYGNIIDFTCVAEGSDSNKSVTLGTWPTKQLSTTGSRTQAMPFTLKLTGCPPGA---ASITFTGKIDTHDPQLLALNDASQ-ASNVAIEIRDQDKMRLPLQQASQEVVVDVQGNAVLAFYANYIATANNPQPGRADADATFMINY. 173
242 7.000e-45JGI.Meta JGI_HUM.0745415 7045188284 C3789086__gene_314381 predicted fimbrial-like adhesin protein [Human Stool microbiome from visit number 1 of subject 158  ali  23  1MKYNNI-----IFLGLCLGLTTYSALSADSVIKISGRVLDYGCTVSSDSLNFTVDLQKNSARQFPTTGSTSPVVPFQITLSECSKGTTG-VRVAFNGIEDAENNTLLKLDEGSNTASGLGIEILDGNMRPVKLNDAGMQWIPLVEQNNILPYSARLKSTQKSVNPGLVSASATFTLE.. 174
243 7.000e-45gi|493874248|ref|WP_006820688.1| ferrous iron transporter B [Yokenella regensburgei]  clstr ali  27  1...MINKKMILVALATGAVLTAVNANAADGTVNFTGEIIDQACTVDIGSNNMTVDLGRVARTAFQNTGDESDSTKFTIKLINCPSTV-TSAQVKFDGANDSNNSDLLAITSGSAAAGGVAIKLMTADKSLLGLNQNSYSYPLVTTADNNLDFYAAYKSTAASVSAGTANAVANFTVNY. 176
244 7.000e-45gi|687256219|gb|KGD79384.1| hypothetical protein HA49_02015 [Tatumella morbirosei]  clstr ali  32  6..MWRIGLIILIFISQGAQADKNNAAAASGQMQFQGEVIADTCIIDDGNQYLTVDMGQASNSKFKQAGDDSDPVMFSLNFRHCSPNVSRNMVVAFRGVADKQNPDLLAIETGDNDARGIGIALFDDKGNLIPINTGKLVVKPKYAGPLTVNLTARYRSTTDNVSGGIANAQAWFLFTY. 181
245 7.000e-45gi|503995637|ref|WP_014229631.1| MULTISPECIES: fimbrial protein [Klebsiella]  clstr ali  26  5..........LIAVGLLAGVMSASAFADDGRIEFYGSITDSACTINHMTNPLTVMMGNVSSKAFNGAGSTASATKFIIELKDCPKS-AKSATVKFDGTADSSVGTILALTQQPGVAKGVGIQLMDNKNVVVPLYTASSAY-PLQPGGNSLAFVARYYATSNTVNAGFANSTSTFTLNY. 171
246 7.000e-45gi|545170419|ref|WP_021524833.1| type-1 fimbrial protein, C chain [Escherichia coli]  clstr ali  25  1MKLKFIPMAVALTLGVATSASAAPATVNGGTVHFKGEVVNAACAVNANSFDQTVQLGQVRTEKLKADGDKSAAVGFNIELSDCDTKVSNGASILFSGTTVATKNNVLALQGSSGTATNVGVQVLDHTGSAVTFGNTPTASYTLSDGTNKIPFQALYIATGQS-TAGTANADATFKVQY. 181
247 7.000e-45gi|496187896|ref|WP_008912403.1| major mannose-resistant fimbrial protein [Providencia burhodogranariea]  clstr ali  26  1MNLNKIALVLGL-GLSITAGVANAADQGHGTVTFVGSIIDAPCSITPETSDQIVPMGQISTAELKDGG-RSNSRAFKIALENCTTETLKTVQTTFAGAASPITDGSLAIE---GKAQNAAIVITNAGGKQIKLGTPS-DAVTLRDGNNDLNFAAYMLGDTDAATPGEFKAIATFALNY. 173
248 7.000e-45gi|502860959|ref|WP_013095935.1| MULTISPECIES: adhesin [Enterobacter]  clstr ali  20  1..MGNWKWPFAALALTMCQANAWSATAGEINIQMYGNIVDFTCVAEGSDSDKTVTLGTWPTKQLSTTGSRTQPMPFTLKLTGCPP---GSASITFSGKTDGSDSGLLALNDAS-TANNVAVEIRDADKTRLALQQASQPVAVDAQGNAVLSFYANYIATADNPRPGRADADATFMINY. 173
249 7.000e-45gi|502386197|ref|WP_012776920.1| exotoxin [Photorhabdus asymbiotica]  clstr ali  21  1MKYFKLFVLRIGFMVIATTAYCNQAVQAADNMRFYGALVEEPCTIQPGDEDIKLDFGTIGEKYLYQHG-RTNSEPFQLRLSGCDISVGKSIKLTFSGIENTQLPGLLALGAGS-LASGVAIGMETAEGKRLPLNKEGDTY-PLKEGETLIELKAYVQAEPATIKRGTFHAVATFNLNY. 180
250 8.000e-45gi|559233616|ref|WP_023582659.1| fimbrial subunit [Proteus hauseri]  clstr ali  26  1MKKNLLAIFIASSSIFAV----NNVLAADGTIDFTGEIIDNACELASGSDALKVNLGKVSKTALPSTGSTAAATKFTIKLINCPTTVS-SAAVKFDAESYSGDDSVIALKKETGVASGVGIQITDDTNTVVPLFTASKIY-PLKTGANNLDFRARYIAKSDTVTAGPANGNATFTINY. 175
251 8.000e-45gi|490210901|ref|WP_004109300.1| hypothetical protein [Klebsiella oxytoca]  clstr ali  31  5..RKKLCLCVCLYILGTAVTFAENRTQYGGVVHLRGAVTDGTCAVSTESENKQVYMGQVQSSRFEELGAWADPVAFSLVLVDCTVASEKQVGIMFNGVSDGKDPLVFRAGEGANAAQGVGIGIFSASGELIIPNTRPQLLTSLNGETVTLPFTARYRATSRQVIAGDASSNVFFTLYY. 180
252 8.000e-45gi|491030221|ref|WP_004891908.1| fimbrial protein [Klebsiella pneumoniae]  clstr ali  28  1MKKSLILVALTATAALSTS----HAFAAAGTVNFVGNILDTACEVDVASQNQQVNLGNFYKSEFPNSGTKAAAKDFNIVLKNCPTTVTST-KVRFDGTPDLTNPNLLAIDTASSAASGVAINLMTADKVDLPLGENSYNYVLSSTQDNTLKFYAQYISTTAPVTPGTANSVANFSIVY. 175
253 9.000e-45gi|671541086|ref|WP_031524736.1| ferrous iron transporter B [Cronobacter sp. 1383]  clstr ali  26  1MKIHSIIAGLATSLTLA----ASSAWAADGTVNFTGEIIDEACVVDIGADNMTVDLGRVAKSSFKASGDEAPETKFSLKLKSCPETV-TTAKVKFDGANDATNSGLLALTQETGVAKGIGVTLRTADKAALGLDAVNDSYTLSSTEENSLDFYAAYRSTSDTVVAGKANAVATFTVDY. 175
254 9.000e-45gi|449467072|ref|XP_004151249.1| PREDICTED: type-1 fimbrial protein, A chain-like [Cucumis sativus]  clstr ali  26  1MKLSNIATVIATLALIAGAAHAAPVSVNGGTVHFKGELVNAACSVNTDSSEQTVNLGQYRTAKFTKVGDTTSNIPFTIELNDCDPAVAKTAAVAFTGQIDATDKTLLAVSSGDNSAKGVGIEILDSKSSTLTPGATFSAAQNLIEGTNTLNFTARY....................... 164
255 1.000e-44gi|490860172|ref|WP_004722214.1| hypothetical protein [Acinetobacter guillouiae]  clstr ali  29  5MKLALLSTALSALTLSVSAFAADPVTVNGGTVHFTGEIVNAACAVSTESSNQTVDLGQYRTARLAVAGDKTTPVPFQIKLVDCDPTVQATAAVAFYGQSVTSNANLLSVAAGSTAATNVGIEIADDTSKILGVGASFSTPKTLITGDNTLQFSARYVATGAS-TPGQANADATFVVKY. 186
256 1.000e-44gi|668993757|gb|KFD05465.1| type-1 fimbrial protein [Kluyvera ascorbata ATCC 33433]  clstr ali  30  1...............MFLLLACAGAQAHDGTVNVSGTIQDNTCIVAPSSQAQTVPLGDISAKQFATQGSGSQPVAFVIDLQKCGAAATG-VDFTFSGTADSDDKTLLAVDSGSDAAQGIGIELQNADHTRLPLNQASTRYALDPTTDNQFTFYARYIATANSVTSGTAKATATFTLT.. 162
257 1.000e-44gi|490220779|ref|WP_004119151.1| ferrous iron transporter B [Klebsiella oxytoca]  clstr ali  25  1MKKTIVIAMLAA----GSALSMTQAFAAAGVINFTGKILDKACDVDVASQNQTIDLGSYNKSEFPTSGTRTAAKEVKIVLKNCPDTV-NGAQVRFDGTPDLTNSSLLAIDSSTGAASGVAINLMTADKADLPLGSNSYNYPLSSTADNTLMFYAQYISTAANVVPGQANSVTNFSVIY. 175
258 1.000e-44gi|504470279|ref|WP_014657381.1| fimbrial protein FimF [Providencia stuartii]  clstr ali  22  4......KLKIFSATLLTSVMFSASAYAADSTITIKGNVKDNTCAVAPGSQNQVVDLLNNAVRQLYAIGEVTPLVPFQIELTPCGASVL-AVKVGFVGIADANNTSLLALEPGTSNASGAGIQILDGSRTPLVLNANSNAWTPLVAGSNTLQFYARLMASNLPIVAGHVRATATFTLE.. 176
259 1.000e-44gi|639137961|ref|WP_024483422.1| exotoxin [Serratia fonticola]  clstr ali  23  37..........................ADDNNVHLHGALVAEPCVIPPGDEEITLDFGTIIDKYLYLN-TRTLGQAFEIHLEECDLTLGKTVSVRFSGTESSALPGLLALDGSSG-ATGIAIGLETPSAQPLPLNQAS-DKLLLQAGSTNIALKAYVQGEPDAIERGPFSAVATFNLEY. 190
260 1.000e-44gi|635727443|gb|KDF09219.1| hypothetical protein AF41_02112 [Citrobacter sp. MGH 55]  clstr ali  27  7............LLGAIFSLVSASAFAADSTITISGYVRDNACAVAGESKDFTVDLLDNAAKQFSHIGATTPVVPFRIVLSPCGTSV-TAVKVGFIGIADNDNTRLLKLDSGTSAAAGMGIEILNGQQTTLPLNAGSAPWTTLTPGTNTLNFYARLMATQLPVTPGHVNATATFTLE.. 173
261 1.000e-44gi|15042714|gb|AAK82430.1|AF396083_9 MrfH [Photorhabdus luminescens]  clstr ali  24  1MNYFKLFVLRVGLMIVATAVYCNQVVQAADNMRFYGALVEEPCTIKPGDEDIRLDLGTIAEKYLYLHG-RTNSEPFQLRLSGCDMSVGKSIKLTFSGVENRQLPGLLALSAGSQ-ASGIAIGIETAEGKRLPLNKDGDAY-PLKKGENVIILKAYVQAEPTTIKRGAFHAIATFNLNY. 180
262 1.000e-44gi|701205012|gb|KGP44073.1| fimbrial protein [Morganella morganii]  clstr ali  22  1..MSMKKVVLALAVSSVMAMTAQAANQGGGKINFHGEVIDAACSIDANSLKQTVELGSVAKVQLAKGGK-STPVDFTIQLHNCDITSGKTATVSFNGIAGDSAKGLDKAFGVSGPASGMGVVITDAGGNVIAPGDTSNAFT-LNDGDNELNFKAYMQGDSNAVAPGAFTATADFVMAY. 178
263 1.000e-44gi|501074369|ref|WP_012125283.1| ferrous iron transporter B [Cronobacter sakazakii]  clstr ali  24  1.MMKKILLMTTMAALACSSSLTWAATTGEGQVNFTGEILDAACVVNSQSSPLAVDLGKISKTAFTGIGSTTNITSFVLQLKNCPETVTK-ASIKFGGTADTNNVDVLALTGGTGAASGVGIQLVDADGTPLNLYTASADYALTGTATNNLEFGARYIQTGATVTAGVANGSSTFTVTY. 178
264 1.000e-44gi|639216402|ref|WP_024554143.1| fimbrial protein [Cronobacter helveticus]  clstr ali  23  1MNKHVLAMVVALLAGGVMSAAQADVTVNGGTINFKGEVVNAACAVSADSVDQTVTLGQVRTVRLATAGSAANQKAFNIKLEDCDTTVATAAAVIFNGQEDANVAGTLANTAGAGAASHVALQLYGPDGNKLAIGDTSSK-VTLVDGSNVIPLSVDYIATDAAATPGNVAAVATFNMVY. 179
265 1.000e-44gi|653023063|ref|WP_027274958.1| hypothetical protein [Leminorella grimontii]  clstr ali  19  5.........LLISALCVGASLVSSAQAYDGQVNFKGTILDTACTVDINSKNLDVNLGRVAKTVFTSVGDVSTAMPFSLKLTGCPAAVTTGAKIRFEGTTVAGKTDVLDLASGS-VATGVGVQIKDNAGQKIVFGSDSSKY-PLSEGANSLDFTAYYISTNTAIVSGSANAVANFTVVY. 172
266 1.000e-44gi|493734811|ref|WP_006684031.1| ferrous iron transporter B [Citrobacter youngae]  clstr ali  25  1..MEKRILAVATAAVLFSALSCGIANAADGQIKFTGSLTADACKVDTTSADQTVSMGKVAISAFTDGGTKASPTKFSLKLTDCPDTVTSAV-VKFDGNADASNTDLLALDSDSDAA-GVGIEIADNTGAAIPIHQASTAY-PLAVGDNTLEFVARYVSDTATVTAGAANATSDFTINY. 174
267 2.000e-44gi|495778586|ref|WP_008503165.1| fimbrial protein BcfF [Enterobacter sp. SST3]  clstr ali  21  1...MKPFLRLFFFCIILMHLGSASTMAHDGTVYIVGTVKSKTCIISPDSENLIVRMSDVATGQFTNQKNNTPWEHFAINLENCGAGL-NNISTHFEGTPNQGNADLLSLTGGPGYASGVAIGIYNPDKTLIPLGDESQLFTLSNNQTATLDFYARYLADGCAVSPGTANAAATFILTY. 175
268 2.000e-44gi|501097333|ref|WP_012147351.1| MULTISPECIES: fimbrial protein [Serratia]  clstr ali  24  1MRLRALAMLSCTPFWFTTLPTLADTELVGSPLQFHGTVVSRPCNIEPQSADQVVEMDTVIVKTLYRYG-HSNPVPFNIKLTDCKTSVFKSVNVTFSGTEDSELPGKLAINNGTNGA---AIALFDSKGADIDLNQATSA-VALQDGANILNFTAYVQGHPKTITEGEFSSVANFVLAY. 178
269 2.000e-44gi|679617661|gb|KFX00497.1| fimbria A protein [Pectobacterium betavasculorum]  clstr ali  25  1...MKHISSAIGLVLALSSGVAFSADQGHGTVTFKGTIIDSPCSITPESTDQTVNMGQISNKALENGGKSTPRT-FYIKLENCDVTADKTVTTTFSGTASQAQPDNLTL---VGTAQGAAIALTNGDGTGIKLGSPSLP-SSVVNGNNTLTFAAFLQGNAASVVPGEFTSVANFTLAY. 174
270 2.000e-44gi|639192199|ref|WP_024531354.1| hypothetical protein [Serratia fonticola]  clstr ali  24  1MKRKLISSLIAASSMAFPMISSAATTVNGGTIKFTGEVVNAACAVDAGSSNMTVPLGQVRTAMLNQAGAKSGHQSFTIVLKDCDTTVSTKASVAFQGVASGSTGGVLGLSGGAGQATNVGIQLFDNDTTPLKVGTQFSTPKTLSDGENRLSFMAAYYATGVA-TAGSANAEANFKVQY. 188
271 2.000e-44gi|493867331|ref|WP_006813944.1| fimbrial protein [Providencia rustigianii]  clstr ali  24  1MKK----IILATLISGVMSSSALAVDAGSGTVTFSGSIIEAPCSIAPGEENQEVALGQVSNVTL-DNGSESSAQPFQIKLEGCNLKGDNQVAVTFKGTEAGTNTGYLQI---TGDATGAAVKIMNGSGAQIKVN--SSAKQNYVEGNNTLKFQASLIGLPLPVTPGQFQAVTNFTLAY. 176
272 2.000e-44gi|485712190|ref|WP_001344484.1| type-1 fimbrial protein, A chain [Escherichia coli]  clstr ali  29  54..................................KGEVVNAACAIDSESMNQTVELGQVRSSRLAKAGDLSSAVGFNIKLNDCDTNVSSNAAVAFLGTTVTSNDDTLALQSSAGSAQNVGIQILDRTGEVLILGATFSAKTDLIDGTNILPFQARYIALGQSV-AGTANADATFKVQYL 199
273 2.000e-44gi|490362059|ref|WP_004241822.1| Fimbrial protein [Morganella morganii]  clstr ali  32  3.KLISTVFLLCGISAGAYAGNKTHTIIDGGMVHLRGGLVEAGCTLSTNSENDVIDMGEFRTNQFKGTGSYSGNIPFKLVITNCSTAVSSKVGLSVFGYINEKDPQIIKLEDSDEAAKGVGIAILDSDGDIIIPDNIPSKWINFHEGENVLHFNARYRATDMQVTGGKANASVWFHLTY. 179
274 2.000e-44gi|493872428|ref|WP_006818899.1| fimbrial protein FimI [Yokenella regensburgei]  clstr ali  28  1..MIRKFCWIGVFCLVAIPASAHRVVVDGGSVHMRGQLVNGACAVSPESENMRIDMGQYRTNSFSGVGNFSTTVPFSIRLVDCHTDVSRLVGVAFQGLTPAEDPQVFVASTRVGGASGLGLGLFDQRQQLIEPNAPPLNYEPINSSEMTLHFSARYRVISLPLIPGNIHSDVWFTLVY. 180
275 2.000e-44gi|640473284|ref|WP_024913842.1| ferrous iron transporter B [Serratia fonticola]  clstr ali  24  1MKKNIIVVTLVAAAAMGSVS----TFAADGQINFTGEIIDAACEVVNNVNNLAVTLGRVAKTAFDGKGTTAAATGFTLQLKNCPATLTG-ATVKFDGTTVAGDNSVLALTQEAGVAQGVGIQLSDSSQDALPLNTASASYPLASTGTNNLDFVARYVATATTVTAGPANATASFTINY. 174
276 2.000e-44gi|578256325|gb|EUM16387.1| hypothetical protein L465_00200 [Enterobacter sp. BIDMC 29]  clstr ali  30  1..MMKYATQYVLLALGLIACTSGHALASDGQVTFMGQVVNAACTVNTDSQDLVVHMGQVRSSQFISTGDWAMPTPFQIKLEECDASVSQRAGVLFYGETALKDPQIFHXXXXXXXXXXXXXXXFDATGHLLIPGTTPLWKAPLQGGENVLRFIAKYRSTAPHVQAGNADAQIWFNVIY. 177
277 2.000e-44METAHIT unmapped GL0303630 unmapped_[Complete]_[mRNA]_locus=scaffold718072_1:446:958:-  ali  26  1MKKTMLSACFLLVAG--------NAVANDGTIHFTGSITDQTCTVDSGSQNMNVDLGKVAQTALNAAGMKASPTRFTLSLSDCPDTVTG-ANVKFDGTSDGVNQNLLALDSGTGIATGVGIEIADKNGAVIPLHTASMDY-PLAAGSNTLDFVARYVSTGTAVTTGTANGTSQFTINY. 169
278 2.000e-44gi|497339430|ref|WP_009653643.1| fimbrial protein BcfA [Klebsiella sp. OBRC7]  clstr ali  23  16MKKAFMVKSVVLAMVMAGGISSAMATVNGGTVEFKGSVVDAACAVTADTTNQVVNMGQVRLAAFTGKDSVANQTPFTIKLADCDTTIASQASVTFDGNAAAGEAGVLDNTSGAGNAAGVGIQIYDKDGSALDLGTASQA-VTLIDGDNTLNFSADYYQTADTATAGSVDTTATFNVTY. 200
279 2.000e-44gi|500229034|ref|WP_011899127.1| fimbrial protein [Aeromonas salmonicida]  clstr ali  20  1..MFRTFWIGLLLCPSLAVMAAPRAELLGNTLHLHGRIIDQPCLVSPESADQSVDMGVVDVRELYSAGAGAQ-VPFVIRLTNCKPGIFRMAKVTFSGSADQQMSGALAF--SAGSAKGAGIRLYDATQSPLDLGTPSRGYVLGNSTENELNFFARVEGHPDAIKPGDYTAVANFIVAY. 182
280 2.000e-44gi|668702124|gb|KFB89779.1| exotoxin [Serratia grimesii]  clstr ali  24  1MNQSVFYGRSALLMALGFLLAMPGAQAAD-NLRFHGALVAEPCVIPPGEEHITLDFGTVIDKFLYLNN-RTHGQGFTLHLTQCDLSLAKTVKVTFSGIENTALPGLLALSAGSQ-ASGIAIGMESPGGKRLPMNKPWGQQG-LVSGDNVLRLQAYVQAEPEAIQRGPFSAVATFNLEY. 179
281 2.000e-44gi|639141502|ref|WP_024484989.1| ferrous iron transporter B [Serratia fonticola]  clstr ali  27  1MKKNLIAVAVLATSVFGVASSMAAV----GQVNFTGEIIETPCVVNTPANPLEVKLGTVSKTEFTGAGSTAAATKFTLQLKDCPATVS-SATIKFDGTSVAGDNSVLALTQVSGVATGVGIQLSDDSNTVLPLYTASKAYPLLVGVVNDLDFVARYIATAATVTAGPANSMASFSVVY. 176
282 2.000e-44gi|493713493|ref|WP_006663080.1| fimbrial subunit [Providencia alcalifaciens]  clstr ali  24  1MKKHVIASLIATSTLLISA----NGFAKDGDINFTGEIIDNACQLATGSDAIQVNLGKVSKTALPSTGSTAAGTKFTIQLEKCPAAV-TSATVKFDGVAYDGNNNVLQVTNTSGVATGVGIQIQDVKGVTVPLYSISNPYTLQETVVNNLDFTARYIAMSDTVTAGQANSTATFTINY. 175
283 3.000e-44gi|493362764|ref|WP_006319196.1| exotoxin [Serratia plymuthica]  clstr ali  22  1MKMKKTRGVVTCFSMGFFVNAAQAASPPQVSVLYSGNLVAEPCTLLPENENVIVDFGSVVDKYLYLN-HRTHGVPFQLNLTDCDLGLGKTLKVTFNGPESTALPGLLALSAESQ-ASGIAIGMETEQGQPLPLNAASGKY-PLQDGNTVIRLQAYVQGEPAAITRGPFNAIATFNLEY. 181
284 3.000e-44gi|640699517|ref|WP_025123495.1| MULTISPECIES: hypothetical protein [Serratia]  clstr ali  29  1MKKT-----LMTLALVASGFVASSVYAADGTIEFSGEITDSACIVDSASQNLQVPLGKIASNSFSGQGSYSAATNFTLKLKSCPLATS-TVTVKFDGASVPGDNSVLAL--ALGGATGVGIELSDANQKVVKLFTNSTPYTLNTGADTDLNFTARYKALSSTVTPGAANASVQFSIIY. 172
285 3.000e-44gi|675321499|gb|AIL61828.1| P pilus assembly protein, pilin MrfA [Pseudomonas alkylphenolia]  clstr ali  25  1MKLSTLAGAIMAVSLAATSAVSVAKDQGHGVITFKGAIIDAPCSIAQESQYQTVDMDQIANVALKNGGK-SNPTPFKIELRGCELGALKAATATFSGSPSS-NPDLLALK---GTAQGASLAIADHTGALIKLGTASPAQT-LSNGDTYLQFNAYLQSTAAEIVPGDFETFANFTLAY. 183
286 3.000e-44gi|544768073|ref|WP_021193390.1| hypothetical protein [Ralstonia sp. AU12-08]  clstr ali  27  24.............................GTITFNGEIVAGACGISPDTLDQTVPLGQVPAHVFAKLGDRSQAVPFNVQLTDCDTTTAKNAFFTFTGTADTVTPGLFA---TTGSAGHVGVRLQTAAGEYLNNGTEQKAPVVLSNGNNTIQFAAMYEATAATVTPGLANSVANFTVRY. 169
287 3.000e-44gi|674725439|gb|KFK95429.1| hypothetical protein JV45_08710 [Serratia sp. Ag2]  clstr ali  27  1MKKNIVNAALFSLIV-----ATPAVFAADGTINFVGEVTDVACTVDTNSQNLTVTLGKVASSAFSGIGSKAAPTQFQLVLKDCPAAATSAV-VKFDGTSVTGDNSVLALTPAVDAAQGVAIELSDASQQVVRLFENSQPYTLETGSVNNLNFVARYKAISNTITAGIANASAQFTIVY. 174
288 3.000e-44gi|722067847|gb|KHA57340.1| hypothetical protein NM74_06885 [Aeromonas hydrophila]  clstr ali  28  1MKLRNIILATSVVLGGANSVYAATV-VEGGTVRFNGNVVATPCAVSSESVDQVVYIGQVTTSQFTAAGQKANNQPFSIKLVNCSAAVSGTASVAFNGLQDLDNPTLLRVGQGADAAVGIGLGIYEANGTQLHIGSQSRPVTLL-PGQVQFEFMADYVSTKASVTAGDASGVATFSITY. 177
289 3.000e-44gi|449328150|gb|AGE94451.1| fimbrial protein [Citrobacter amalonaticus Y19]  clstr ali  20  1MKLMTFSFLLLTGAVL-----SNGVQAVDNNVHFSGALVAEPCRIPDGDSNIKLSFGSVIVKGLYQY-QRTKSQPFIIYLENCDPALMKTVSVTFEGTPDDELTTMLALEPSS-VAKGVAVGLELVDGTPLAINKAS-PYQPLSQGNNALTFNAYVQGKPSAITPGDFNAIATFVLVY. 175
290 4.000e-44gi|500023779|ref|WP_011704497.1| fimbrial protein [Aeromonas hydrophila]  clstr ali  20  1....MLRTLLISLMLSPLIAVAAIPRAGDGKLNLHGRIIDQPCVVAPESLEQEVEMGVVDVKQLYANGA-GEQVPFSIRLTNCKPGIFRMAKVTFTGSKDAQLSGGLAFT--AGIAKGAGIRLYDVTQTPLDLGTPSRGYLLGGSADNELQFFARVEGHPDAIQPGDYSAVANFIVAY. 182
291 4.000e-44gi|446872228|ref|WP_000949484.1| type-1 fimbrial protein subunit A [Escherichia coli]  clstr ali  28  4..KQHVTKSILGLALLSAVPVASAAVVTGGTVHFTGQIVNAACAVSAESVDQIVKMGQFRTANFTSVGMRSHAVPFTIKLEDCDTNISTTAAVSFYGNLDANDPTVLAVSNXXXXXXXVGIEISDYTGKLVKPGSVFSTAQNLVDGANVLSFTARYKSTLASVTPGQADADALFKMQY. 184
292 4.000e-44gi|668963982|gb|KFC81418.1| fimbrial subunit [Buttiauxella agrestis ATCC 33320]  clstr ali  24  1MKIKHPPLKELSAALFLLVAPYAAADAY--NLQITGTILSRTCDVSS-SQSQTVNIGQFSVSHFAAAGDTTTAKRFTIDLVNCGSAATGT-KLTFSGTNDSDNPALLALSDTGSTATGVGIEILDGNQQPLAINTLSSTVYELSPGSNSLPFYLRYKATQNVVTAGNASSVMYFDLQY. 177
293 4.000e-44gi|556425945|ref|WP_023310872.1| major type 1 subunit fimbrin (pilin) [Enterobacter cloacae]  clstr ali  26  1..MKKVILGLFIAAALGCSASSFAASTGEGQINFTGEIIDSACQVVNGSSPLNVALGKVSKTTFTGAGSTSTLTKFDIQLKDCPETV-TSAAINFGGTPDADNNTTLALTPGATTATGVAIQLVDSSEQPVSLYTPSKQYPLTPGTTVTLEFGARYIQTQAAITAGQANSASTFTVIY. 177
294 4.000e-44T2D.3436823 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  24  1MNKKLMMAMLAAGSVLTM----TNAFAAAGTVNFNGNILDSACDVDVASQNQVVVLGDYYKTEFPTAGARTAATQFNIILKNCPVTV-TNAKVRFDGTPDLTNASLLAIDTSAGAATGVAINLMTADKADLPLGSNSYTYALSSTADNTLNFYAQYISTAASVTAGPANSVANFSVVY. 175
295 4.000e-44gi|475955345|gb|EMU21868.1| fimbrial protein (pilin), partial [Acinetobacter baumannii ABNIH17]  clstr ali  19  40MKK-------FIFIAASSLFNIAAAQAADGTITINGLVTDNTCTIDTGDKNLTVNLPTVSSQSLKNAGDVAGRTPFQINLTNC-ASVGKVATYFEPGATVDFNTGRLLNQATSGAAANVNIQLLGSNNAVIPVQDNSQWVNVSAGGNADLNYYAEYYATGAS-TAGTVTSQVKYTIIY. 216
296 4.000e-44gi|493867559|ref|WP_006814164.1| fimbrial protein [Providencia rustigianii]  clstr ali  23  1MKFNKTIMAIAATSLISFSAFSAPVNHGNGKVTFTGSIISAPCSIDPASLDQTVDLGQIADVVLKNGETQSSPVMFDIKLIDCTVETGDTVNVTFSGAAAENNGNPL--LAITGTAGGAGIQIVDSNNAPIVLNEKTKSTHKLQGVTNTLQFAAYIKGLGTEIIPGEFQAVTDFILTY. 187
297 5.000e-44gi|514966368|ref|WP_016654670.1| hypothetical protein [Acinetobacter rudis]  clstr ali  25  1MNIIKLLIVGCVLCAPVL----HADPLVKINLRFKAMIVDRTCTVSPESQNINVALGTWGTKNMVNVGDQTRPIPFSIRLTDCS---AKNVSLSFKGPQDTTNPQFLALSDDS-TATNVAIQILDKDRQLLPIETFTKPVAVDTNKNLQLNFFANYFATRKNVTAGTANSTANFVLNY. 170
298 5.000e-44gi|661297210|ref|WP_029990088.1| type-1 fimbrial protein subunit A [Tatumella ptyseos]  clstr ali  25  4..KSLVVGVLSALSLTVSMAHAATTTVNGGTVHFEGEVVDAACAVDAGSVNQTVQLGQVKASTLAAAGDTSSAVGFNIQLDDCDVSTATKASIAFTGVQAXXXPAVLALQSSSGSAANVGIQILDSTGTALPLGGTFSATKTLVSGTNSLPFQARYYALGEA-TAGTANADATFQVQY. 189
299 5.000e-44gi|502862497|ref|WP_013097473.1| ferrous iron transporter B [Enterobacter cloacae]  clstr ali  22  1..MKKKMIIAGIAAGMACASVSVFASSGEGQINFTGEIIDSACTVVNGSNPLNVSLGKVSKSAFTGSGSTTSTTRFSIQLKDCPETV-TSASVTFGGTPDSNNKDILAVTSGTGSASGVGVQLLDKTENPLSLYTASAAYTLTGTTTNDLQFGARYIQTGGTVSAGLANAASTFTIVY. 177
300 5.000e-44gi|727189625|ref|WP_033651427.1| fimbria A protein [Serratia marcescens]  clstr ali  22  1..MNLNKTMMAAVLAFGTISGAQAADQGHGKVTFTGSIIDAPCSIDPKSIDQTVDLGSVSNVSLLNGGN-SDPKPFEIHLEKCSLDTAKTVTTTFDGAA-----GKNGLLGMTGDAKGASIAITDGSNNVIELGKPTAGQLISAGATATLAFSAYLKGDGASIVPGKFQSVANFILNY. 174
301 6.000e-44gi|238719961|gb|EEQ11767.1| P pilus assembly protein, pilin FimA [Yersinia mollaretii ATCC 43969]  clstr ali  35  10.....VFVVLSLPGAFASGHNNTVVTLPGGELNFIGDVIDAACLVDIDSRKQEIRLDQVNNAQFTASGSSVSAAPFSIQLNNCSVTTSQSVGISFIGVADERDPTILATITERNMANGVGIALFDADNNLLPINAPPKDFSLLSRGTNTLHFFAKYRSTLPVVTSGSSNAAANFMVTY. 182
302 6.000e-44gi|494955140|ref|WP_007681168.1| Type-1 fimbrial protein, A chain precursor [Cronobacter condimenti]  clstr ali  26  1..MKNVLLSTLLTGMACCAGSAFAASTGEGQINFTGEILDSACVVNSAASPLSVTLGKVSKSSFSTVGATSAPTTFDIELKNCPESITST-SITFGGTADANNNDVLALKAETGAATGIGVQLLDASSQPLSLYTASADYTLSSGATNKLTFGARYIATAPTVTAGLANAISTFTVVY. 177
303 6.000e-44gi|493178092|ref|WP_006177567.1| fimbrial protein [Enterobacter cancerogenus]  clstr ali  27  26........................AFASNGIVHFTGEIIESTCEVSTGTKDQTVDLGKVNKSTFTDVGSTASVQAFQIDLVNCPQT-YKKANARFDGTEDGD--GYLKLNN--GGAAGVAIAIYNADNSLLKLYNQSKTADISAEGSASLPFMARYIATSSTVTAGLANADSEFTISY. 175
304 6.000e-44gi|501082903|ref|WP_012133450.1| adhesin [Citrobacter koseri]  clstr ali  20  1.....MRLLLAIFCSVLLSPLCRADTAGEINIELRGNVVDFTCTAVTGDSNKTVELGTWPTKQLKTSGDTTQPVPFSIKLEGCPPGA---ASMTFSGTPAAG-TSLLALDDAV-MAQKVAIEIRDSDRSRLPLEQASQSVSVDENGNATLTFYANYIALADGVQPGVAKADATFMINY. 169
305 6.000e-44gi|488394024|ref|WP_002463409.1| fimbrial protein [Escherichia hermannii]  clstr ali  27  1.....MTSKLTLAVVLAAMSMSASVLAADGTVNFTGTITDKACTVDTGSKNQTVDMGTVATTAFGAKGDTAAAKSFTIKLTTCPTDVTTNAAVRFDGMAKDGDPSVLALDAAS-VATDVGIQIKDNANKVVKLFENSSVYT-LVQGDNNLNFTARYISTADTVGAGTANSSAQFTIIY. 172
306 7.000e-44gi|491497229|ref|WP_005354939.1| fimbrial protein [Aeromonas veronii]  clstr ali  20  14...........LLGVTAAPRASNDLELLGNTVHLHGRIIDQPCVVSPESLDQEVEMGVVDVKELYANG-VAELVPFSIRLTNCKPGIFRMAKVTFTGSQDTELSGGLAFT--AGIAKGAGIRLYDVAQSPLNLGSASRGYLLGGAADNELQFFARVEGTAKNIQPGDYSAVANFIVAY. 182
307 7.000e-44CGD_mhc6a.1027207 GBUI7QQ02IGD9I|GBUI7QQ02IGD9I|metagene|gene_1  ali  25  2.....................SAFAAGNPGTITFNGEIVAGACGISPDTLDQTVPLGQVPAHVFAKLGDRSQAVPFNVQLTDCDTTTAKNAFFTFTGTADTVTPGLFA---TTGSAGHVGVRLQTAAGEYLNNGTEQKAPVVLSNGNNTIQFAAMYEATAATVTPGLANSVANFTVRY. 155
308 7.000e-44gi|493444735|ref|WP_006400116.1| fimbrial protein [Burkholderia multivorans]  clstr ali  26  1..MKKTLLTAAALAVLSTSAFAAGANSGTGTINFTGEIVAGACGIDSGSDNQTVNLGKVPTNVFKQAGDKSTATNFDIKLTDCDTSVAQNAFFTFTGTSSAGQPKLFA---TIGSAQNVGIRLQSASGEYLDNGVEQKAPTVLQNGTNIARFAAMYEAVAADVKPGTADGVANFTVRY. 173
309 7.000e-44gi|573502616|gb|ETT03006.1| fimbrial protein [Providencia alcalifaciens PAL-3]  clstr ali  24  1MKKQIIASLIATGTLLISA----NSFAKDGDINFTGEIIDNACQLASGSDAIQVNLGKVSKTSLASTGSTAAATKFSIQLENCPAAV-TTATVKFDGVSYEGDSSVLQLTGASGIAKDVGIQIQDAKGVTVPLYTESNEYTLKETVVNNLDFTARYIAMSDAVSAGLANSTATFTINY. 175
310 7.000e-44gi|447004780|ref|WP_001082036.1| fimbrial protein BcfE [Salmonella enterica]  clstr ali  23  1..MNRSHCALFAMGLILCPQINASADDLAYNLEFTGTIVAQTCDIDISSLSQSIDLGQFAVGDFPSTGTTTKFKPFNINLKNCSRGIAG-AKIWFTGEPDPDNPALLAITDTGMGASGVGVEILNDDQDTISINNADSVVYPLKAGRNTLSFYIRYKSTRPTVTSGNATAVMYFDMQY. 180
311 7.000e-44gi|504695745|ref|WP_014882847.1| adhesin [Enterobacter cloacae]  clstr ali  20  1..MRNGIRFITVALFALCTQAQAETALGEINIQLYGNIVDFTCVAEGNDSDKTVTLGTWPTKQLSTTGSRTQPMPFTLKLTGCPPGA---ASITFSGKADGSNNGLLALNDAS-TASRVAVEIRDADKSRLDLQQASQPVTVDAQGNATLSFYANYIATADNPQPGKADADATFMINY. 172
312 7.000e-44gi|446750559|ref|WP_000827815.1| fimbrial protein [Shigella flexneri]  clstr ali  25  1MKRNIIGGAFTLASLML----AGHALAEDGVVNFVGEIVDTTCEVTSDTADQIVPLGKVSKNAFSGVGSLASPQKFSIKLENCPAT-YTQAAVRFDGT------------GQAIAATGVGIRIFNSDNSQVKLYNDSDYTAIDAEGKAEMKFIARYVATNATVTAGTANADSQFTVEY. 162
313 8.000e-44gi|497856674|ref|WP_010170830.1| type-1 fimbrial protein, FimA [Pseudomonas sp. PAMC 25886]  clstr ali  27  3.KINLINSVIAASLLSVGVAHADITTVNGGTIHFQGEVVNAACAVDTGSTDQTVQLGQVRTAALSAAGQTSTAVGFNIQLNDCDTSVSSQASVAFTGVTDPTNTEALALSSAAGAATNVGVQVLDRVGTPLTFGATFSNPLTLNDGTNTLPFQARYIATG................... 163
314 8.000e-44gi|159794884|pdb|2JMR|A Chain A, Nmr Structure Of The E. Coli Type 1 Pilus Subunit Fimf  clstr ali model  33  2...........................ADSTITIRGYVRDNGCSVAAESTNFTVDLMENAAKQFNNIGATTPVVPFRILLSPCGNAVS-AVKVGFTGVADSHNANLLALENTVSAASGLGIQLLNEQQNQIPLNAPSSAWTTLTPGKNTLNFYARLMATQVPVTAGHINATATFTLEY. 154
315 8.000e-44gi|491095558|ref|WP_004957162.1| exotoxin [Serratia odorifera]  clstr ali  24  12.KQTSRRGSALLGVGIVLAGLMTQPAAADENMRFHGTLVAEPCVILPGEERIQLDFGTIVDKYLYLN-TRTHSQIFTLHLAECDLSLGNTVSVTFSGSENANLPGLLALDGGS-SASGIAIGLENRDGTALPLNSASDKY-RLAAGSNQIALQAYVQGEPKTIGRGEFSATATFSLEY. 190
316 8.000e-44gi|639188612|ref|WP_024527848.1| fimbria A protein [Serratia fonticola]  clstr ali  22  1MKLNILALVVAA--GFMSNAFAVATEAGKGQIKFTGSIIEAPCSITPGTSNQNIELGQISSTALQDGGK-STPVTFQIDLEKCDTTSLPGVTATFTGPASANNTDLLGI---TGSAKGASIVLTDGAGTPIKFGTPTAKQ-LIMDGSNTLVFSAYLQGDGVSIIPGEFTSIANYALAY. 174
317 9.000e-44gi|497856679|ref|WP_010170835.1| fimbrial protein FimF [Pseudomonas sp. PAMC 25886]  clstr ali  23  1MKK-------YLCVLGLMPCFASHSYAADTSISITGYLKDNTCSVSVDSKGFTVDLMSNAAKQLNRVGATTVPVPFKIVFDKCGSSTTG-VRIIYGGTSDEDNNTLLKIGAGTNAASGLGIQILDSDKQPIPLNAASLSWSPLIAGSNTLNFYACLMATRSPVTAGVVNATADFTLE.. 172
318 9.000e-44gi|490366551|ref|WP_004246215.1| fimbrial protein FimF [Proteus mirabilis]  clstr ali  22  1.MTNNIKGILTTLWLFFLSLSPNVAYSADSIIQITGYMRDNTCAVAPESQYQTIDLLNNEVKRLYKVGETTPFIPFHIILEPCGESVI-AVKFYFNGISDRNNPSLLALDPIATSASGVGIQILDSERSPIPINPSSDQWIPLVAGSNTVFFYSRLMASDMPVLAGKIKASATFTLEY. 179
319 9.000e-44gi|490858713|ref|WP_004720755.1| fimbria A protein [Yersinia ruckeri]  clstr ali  24  1MKLNKIVLGITLVFGIAAFSQAATADLGHGTVTFTGSIIDAPCSIDSGTIDQTVDLGPVSKVALDNKG-TSTPKDFKIKLEKCNIGDGKSVTAKFTGAE-GNTTGLLGI---TGTAAGASVVMKDGKGELIELGK-SSDAQKLQNGNNTLLFSAYLQGNGASVVPGDFSSVANFTLDY. 178
320 9.000e-44gi|300527009|gb|EFK48078.1| type-1 fimbrial protein, A chain [Escherichia coli MS 119-7]  clstr ali  25  12..MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNTDSADQVVTLGQYRIDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNLLAISTNTTTATGVGIEILDNTSAILKPGNSFSTNQNLIPGTNVLHFSARYKGTGTSASAGQANADATFIMRY. 190
321 1.000e-43gi|659667768|emb|CDG48815.1| Fimbrial domain-containing protein [Serratia symbiotica SCt-VLC]  clstr ali  26  1MRLHTLAILGCALWWFATLSATADTELYGAQLQFHGTVVSRPCHIEPQSADQLVDMGTAIVTTLYRYGHTA-PVPFTIKLMDCKNTVFKSVNIIFSGIEDPELPGKLAINNGV---QGAAIALFDHQGTGIDHNQASST-VRLQEGHNVLNFAAYVQGQPNTITEGEFNSVANFVLAY. 178
322 1.000e-43gi|646213297|gb|KDP99523.1| fimbrial protein [Cronobacter sakazakii]  clstr ali  26  6...........LLFCVALALTSAGVQADDDNVHFSGALVSEPCNLPDADKDIHLDFGTIVEKYLYQH-ERTKSQPFSIHLEECDPSVLSTVSVTFQGTADTVLNNLLALDASS-TAKGVAIGLELADGTPLPVNKPS-PFTQLNSGNTTLVFNAFVQAAGKNLTPGDFTAISTFLLNY. 174
323 1.000e-43gi|504709980|ref|WP_014897082.1| fimbrial protein [Burkholderia cepacia]  clstr ali  28  15....................STSAFAAGTGTINFQGEIVAGACGIDSGSVNQTVQLGKVPTHTFTKAGDKSTPVKFNIVLTDCDTKVAKNAYFTFTGTSNSAQPKLLA---TIGSASNVGVRVQSASGEDIDNGVEQAAATQLQNGNNVVTFGARYEATAADVTPGTADAVANFTVRY. 169
324 1.000e-43gi|490203123|ref|WP_004101580.1| ferrous iron transporter B [Klebsiella oxytoca]  clstr ali  28  5........IIMATFAISXXXXXXXXXXXDGTINFTGEILDQACTVDIGSNNMTVDLGRVARTSFQSTGDESDATKFTIKLINCPASV-NSAKVKFDGANDLNNSDLLAITQGPAAASGVAIKLMTADKSLQGLNQNSYSYPLVTTADNNLDFYASYQATQAVVTAGPANAVANFTVNY. 175
325 1.000e-43gi|446746124|ref|WP_000823380.1| fimbrial protein [Salmonella enterica]  clstr ali  24  1...MKRKITAAIAVFFTTISIASSVFAHDGTVNFTGKIIEAGCKIDGSTTDKDVELGEISRTAFTTSGDTAATTPFSLVLTECPASLGKSVNVKYEGTPDNINNDYLQLTGDSGVAKGVAIELLNADLSSLPLGTESNAVTEDAPAETNLNFFARYVSTEASVTAGTANATVNFTLTY. 183
326 1.000e-43gi|505806585|ref|WP_015704344.1| fimbrial protein BcfA [Enterobacter aerogenes]  clstr ali  23  1MKKHLLVMVAMTAGGMSCAANADTATVSGGTVNFTGQVVNAACSVSADSIDQTVTLSQVRTSKLTAAGMVANQKDFSIKLEDCDTTVSQNAAVIFNGQQDSSLAGSLANTAGAGSATNVALQLYGPDGQVLNIGDTSGT-ITLIDGENTVPLSVDYVATGAA-TAGNVAATATFSMVY. 179
327 1.000e-43gi|727186896|ref|WP_033648745.1| exotoxin [Serratia marcescens]  clstr ali  23  1MNKVILTLLVGLGAGGVLNM-AQAATTPEVSVLYRGSLVAEPCTLLPEDENILLDFGTVIDKYLYLNG-RTNSKPFQLHLIDCDTSLGKMVKMTFSGTESLPLPGLLALDAGS-EAKGIAIGLETQDGQALPLNQQSRGQ-EITNGNNVITLKAYVKGEPDAITRGIFTAVATFALEY. 179
328 1.000e-43gi|505739116|ref|WP_015700780.1| fimbrial protein [Pantoea ananatis]  clstr ali  24  1MKLNKLASVLALGLSMAAISNVYAANQGQGKITFTGSIIDAACSISPETSDQEVSLGQIAASQLADNG-TSKPVNFEIDLQHCTTTTAPSVKVTFGGSPAEGDNTWFGI---TGTASGAGVVITDASSNKIPVGGTTEMARELIEGDNTLGFSAYLQGLGDKVTTGEFSSIADFTLAY. 194
329 1.000e-43gi|498976561|ref|XP_004528351.1| PREDICTED: protein FimF-like [Ceratitis capitata]  clstr ali  23  1..MIMIARAVPLITATLLALCAGARADGGSTIEISGYVRDNACEVAGDSKDFEVDLLKNSVRQLRTVGAATPQVLFRIFLSRCGGS-ATAVRVGYSGPADDENSALLRLDPGGSAASGAGIQILDHQQVPLPINAPPASWITLHPGSNTLNFYARLMATRVPVTAGQVRATATFTVE.. 177
330 1.000e-43gi|493177042|ref|WP_006176992.1| adhesin [Enterobacter cancerogenus]  clstr ali  21  1.MRSVTRYAAAAALLMFHASAGANTALGEINIQLYGNIVDFTCVAEGSDSDKTVPLGTWPTKQLRTTGSRTQPMPFTLKLTGCPPGA---ASITFSGKADGSDNSLLGLNEASD-ATHVAVEIRDRDKTRLALEQASQPVTVDALGNAELAFYANYIATADNPQPGRADADATFMINY. 173
331 1.000e-43gi|516505537|ref|WP_017893975.1| hypothetical protein [Serratia sp. S4]  clstr ali  23  14..........LGIAGVMLAGAIGQPAAAEENMRFHGTLVAEPCVIPPGEEEIQLDFGTIVDKYLYLN-TRTHSQPFALHLAECDLSLGNTVSITFSGTENTKLPGLLALDGGS-SASGVGIGLETQEGKALPLNSASEKF-RLSAGSNMINLQAYVKGEPEAIQRGTFSAVTTFTLEY. 183
332 1.000e-43gi|505488987|ref|WP_015673633.1| P pilus assembly protein, pilin FimA [Serratia marcescens]  clstr ali  25  1MKKNLLAVAV-----XXXXXXXXXXXXXDGQVNFTGSITDVACEIDANSKNQTVNMGKIATTAFVGAGSTAGDRRFSLILKNCPASV-TAAAVRFGGKMVPGADGVLALTDATDMAEGVGIQITDEHNNVINLGLDSAVFPLVSTADNKLNFMASYYALANKVTPGSANAVAQFTIVY. 176
333 1.000e-43gi|692181925|ref|WP_032098450.1| type-1 fimbrial protein subunit A [Morganella morganii]  clstr ali  26  1MKLNIIASVVXXXXXXXXXXXXDPVIVNGGTVHFTGELVNAACAVSTESSNQTVELGQYRTAKLAASGDMSTPVPFKIKLVDCDPAVATTAAVAFSGQSMTGDATLLAVNSGTNAAQNVGIQISDTASKVLSPGADFSATKTLIQGTNVLDFTARYVAKGAT-TPGQANADATFVVKY. 181
334 1.000e-43gi|544913467|ref|WP_021323234.1| f15 p-fimbriae major subunit precursor [Photorhabdus temperata]  clstr ali  24  28MKLNKLVMALGLMALVASSVNAANPSQGHGTVTFTGSIIDAPCSITPETVDQVVPLGSISNVSLKNGG-RSSSKSFKISLENCTTETINTVTTTFIGAKSSI-TGGEGLLGIEGSAKGAGIAITDGGGNKIKLGTPSPA-IALHDGSNDLNFAAYLQGDPDAVVPGDFTGIANFQLTY. 205
335 2.000e-43gi|668712362|gb|KFB98085.1| fimbriae-like periplasmic protein [Trabulsiella guamensis ATCC 49490]  clstr ali  22  1.............MLACSLTVQAQSPLGEINIELRGNVVAFTCIAEAGDSNKTVQLGRWPTKQLSLAGNTTQEVPFTLKLTGCPPGA---ASITFSGIPDTQDNSLLGLNGGSQ-ASNVAVEIRDKDRTRLPLEQASQEVVVDALGNATLQFYANYIATANDPQPGIADADATFMINY. 161
336 2.000e-43gi|573011231|dbj|BAO34583.1| fimbrial protein [Serratia marcescens SM39]  clstr ali  21  1MKMTPRRRWATAGLLLFSLGASGMVRAAD-NLYMHGALVAEPCVIQPGDEDIQLDFGTVVDKYLYLN-QRTLSQPFELRLSECDLSLGKTVSITFKGEENPQLPGLLAL-AASSEASGIAIGMETAQGRPLPLNSAGGKY-PLQNGSTVIAVQAYVRGEPKTIGRGAFNAIATFNLDY. 179
337 2.000e-43gi|493867167|ref|WP_006813786.1| ferrous iron transporter B [Providencia rustigianii]  clstr ali  22  1MKKYTFTVLIAGITFL----PNSLTFAADGTIEFIGDIIDQACEIKTESKNIQVQLGRIPKANLPNVGSKSIPVKFTITLVNCPVSI-NSATVSFDATSFPGDNSVIALKAIPNAASGVGVQLTDNKSAVITLLTPSNEYPILPTVENSLDFTANYIAKAIPVVAGSANASATFLISY. 173
338 2.000e-43gi|505736968|ref|WP_015698640.1| P pilus assembly protein, pilin FimA [Rahnella aquatilis]  clstr ali  25  1...MNKRNSFILLLGTMLCFSHSVAHAADGTINFTGQIVATTCDVNGGTTDINVDLGTVAATSFTAAGATSSPTAFTISLTNCPTT-FTAAAVKFDGTADAVDNQLLEV---TGGATGVGIEIADNQGTPIPLYTASRFYPIDATAEVDMNFIARYKSTAATVGEGAANATSQFTINY. 173
339 2.000e-43gi|674723089|gb|KFK93154.1| ferrous iron transporter B [Serratia sp. Ag2]  clstr ali  21  1MKKNLLAIAVLAS----SSVFSLHAAATDGDVKFTGEITDVTCKVDTGSAPLAVTLGKVAKTSFPDAGARASATKFTLQLSACPDTI-TSAKVKFDGTAIPGTNGLLALTDEAGVATGIGIELSDDSNSVLPLFTASKAYTLQKDVVNNLDFVASYISTSKTITTGPANATASFTINY. 174
340 2.000e-43T2D.2976128 [KEGG:K07355] fimbrial-like protein;|[COG3539] P pilus assembly protein, pilin FimA  ali  22  28....MRRVLFSCFCGLLWSSSGWAVDLGTININLHGNVVDFSCTVNTADKDKTVDLGRWPTTQLLSAGDTTALVPFSLRLEGCPP---GSVAILFTGTP-ASDANLLALDDPA-MAQTVAIELRNSDRSRLALGEASSTEEVDANGNVTLNFFANYRALASGVQPGVAKADAIFMINY. 197
341 2.000e-43gi|503131484|ref|WP_013366145.1| ferrous iron transporter B [Enterobacter lignolyticus]  clstr ali  27  1MINNNMITATIVASAVLCL---TTANAADGTINFTGEIIDQACAVDIGSNNMSVDMGRIARTSFQSAGDESDSTKFTIKLINCPATV-TSAKVKFDGANDQNNSDLLAITQGASSADGVAIKLMTADKTLLGLNQNSYSYPLVSAADNNLDFYAAYKSTQTAVTAGLANSVASFTVNY. 176
342 2.000e-43gi|505190175|ref|WP_015377277.1| fimbrial protein MrfG [Serratia marcescens]  clstr ali  24  7...NRRRSALLGAGMVMAAGIMAQSAAAAENMRFHGTLVAEPCVIQPGDEDIQLDFGTIVDKYLYLN-TRSHSQTFALHLTECDLSLGNTVAITFTGTENAKLPGLLALDAGS-LASGIGIGLEDSSGKALPLNRASDKF-RLSAGNTTLTLQAYVQGEPEAIQTGTFSAVATFTLEY. 183
343 2.000e-43gi|562747212|ref|WP_023654327.1| Protein fimF [Erwinia piriflorinigrans]  clstr ali  25  5...........LSILYLLSFLAWDTHAADSTITITGYLKDGGCSVAVDSQDFTVDLMSNAARQLYRPGAVTPAVPFNIVLDACGESVTGL-RVGYTGTSDSDNTALLKLDAGDNAASGMGIQILDKDRGAIPLNAAQEAWITLTPGSNTLIFHARLMATRTPVTAGLVNATANFTLE.. 172
344 2.000e-43gi|497270634|ref|WP_009584851.1| putative type-1 fimbrial protein, A chain [Acinetobacter sp. WC-743]  clstr ali  27  1MKKISL-----IAFALVASSTSFAATVPGGEIHFTGDLVNAACAVSAGSDGQTVPLGQHRVASFKKAGDTTSPVPFKIELVDCEAAVTKGVSIAFKGPTVATNPKLLSVGAGTSAAKGVGIQIADSSSTPLALGTGFTKETLINDGTNTFQFTARYVSTVDALTAGKANADATFIVNY. 181
345 2.000e-43gi|640731873|ref|WP_025154719.1| ferrous iron transporter B [Morganella morganii]  clstr ali  25  1MKKT-----LLASLLTSVTFICSYANAADGQIKFSGSVIDNACDVTNNLANLNVNMGKISKSVFNNAGVTASSSTFSLVLKNCPNTVSG-AQIKFDGTSASGDNNVLSLTQETGVAKGIGIQLTDDTNTVIPLYSASKNYELKPNKENELNFIARYISISDDVEPGAANAVANFTINY. 174
346 2.000e-43gi|619738425|gb|AHY13664.1| ferrous iron transporter B [Citrobacter freundii CFNIH1]  clstr ali  26  1MKKNVIAKTLSAAAILM----ASNAMAYDGTVIFNGEILDSACTVDGGSNTLMVDLGRVAKTAFVSTGDEASTTKFTLRLKDCPASVA-AAKVKFDGAHDGNDSSLLAITQGSGSASGVAIRLKTADSVNLGLNQDNGTYMLSSTADNNLDFYAAYVATAVPVLPGAANAVANFTVNY. 175
347 2.000e-43gi|639210832|ref|WP_024548956.1| MULTISPECIES: ferrous iron transporter B [Cronobacter]  clstr ali  24  1MKKQFIFAAIAMTAAGG-----EYTHAADGTVNFTGSIVDQACVVDIGTNDMTVDLGNVAKSSFTASGDESPETKFTLTLKSCPETI-TSARVKFDGLNDATNSSLLALTPEQGVAKGIAITLRTADKAGLGLNAVSDSYPLVSTGENTLDFYSAYRSTSDTVVAGKANAVATFTMDY. 174
348 2.000e-43gi|490366554|ref|WP_004246218.1| fimbrial subunit [Proteus mirabilis]  clstr ali  23  1MKLNYLKLFVISALSVGSVFAVSAVTVNGGEIFFKGELVNAACAVDSSSDGQIVKLGQVRTAKLAKAGDFSENTNFTIQLNDCDSKVASTAKVAFTGVSAAGQDDVLAVSSSSGGAKNVGIQILDSKSAPMSFGAGFGNATKLHDGKNIIPFQARYYALGAT-EPGIANANATFAVQY. 187
349 2.000e-43gi|671539757|ref|WP_031523446.1| ferrous iron transporter B [Cronobacter sp. 1383]  clstr ali  29  1MKKNVIAVAFATLA----AMSASSVFAAEGTVNFTGEIIDEACTVDIGSSDLSVSLGKVAKSSFSATGDDASTTKFTMTLKDCPAAV-TAAQVKFDGTHDATDSSLLALTDETGVATGVAIALMTADKADLGLNAVNDSYTLAADTENKLDFYAAYRSTSDTVVAGKANAVATFSINY. 175
350 2.000e-43gi|515614476|ref|WP_017047076.1| hypothetical protein [Vibrio ordalii]  clstr ali  26  1MKKTIIASAMMMLSASVFAAAAE--DTGHGVVNFTGAIIDAPCSIAPESMDQTINMGLISNDLLEKQGET-PVRPFSIHLESCSTETAKAATVTFSGRSDSVEKKNLAI---SGAGKGAAIALVNQDDSVIELGTKTKA-ISIVEGDNVLQFGAKLVSEGDKATPGEFKATTNFIISY. 175
351 3.000e-43gi|668996222|gb|KFD07846.1| type 1 fimbrae adaptor subunit [Kluyvera ascorbata ATCC 33433]  clstr ali  26  7............VFSVCFALTATCALAADSTITITGNVRDNGCAVAGESKDFTVDLMNNAAKQFNAVGATTPAVPFRIVLSPCGGAVS-AVKVGFIGVADNGNTSLLKLDNGASAAAGMGIQILDGQQTMLPLNATSSAWTTLTPGTNTLNFYARLMATQVPVTPGHVNATATFTLE.. 173
352 3.000e-43gi|571190651|emb|CDL37878.1| FIG00510038: hypothetical protein [Escherichia coli ISC11]  clstr ali  27  1MWQMIGKGVALAGMLCVLPVFAHTVILESGRLHLRGQLVNGACTVATDSQNLRVQMGQYRTNAFSGTGSASTSVPFSLRLTSCSSDVYDHVGIAFAGVTPAEDPQVFLASGDASAASGIGLALFDQRQRQIIPNALPLHYAPIITQEMTFHFTARYRAVSENITPGTLRSDVWFTLVY. 179
353 3.000e-43gi|491073671|ref|WP_004935293.1| MULTISPECIES: hypothetical protein [Serratia]  clstr ali  25  6........VIMLAFVAAACSSALPALAADGQVNFTGNIVDAACKVTNDSNPLNVVLGDVARTAFAGGGSTSSATKFTLEVTDCPDTV-KSATVKFDGAADNGDSNVLQLTQETDVATGVGIQLSDISNSVLPLYTASTAY-PLASGSNNLDFTARYISTQADVTAGKANSVATFTLNY. 178
354 3.000e-43gi|639141580|ref|WP_024485066.1| ferrous iron transporter B [Serratia fonticola]  clstr ali  24  1MKKNIIAATLAAVALTSVS-----AFAADGQVKFTGEITDAACKVANTASPLDVQLGKVAKSSFTQAGDKSAATKFTLQLSDCPDTVS-TATVKFDGTSVNGDNSILALTQGAGVATGVGIQLSDDSNTVLPLFTESKSYSLQAGSTNNLDFVARYISTAAAVTPGPANATANFSINY. 174
355 3.000e-43gi|493867336|ref|WP_006813948.1| fimbrial protein FimF [Providencia rustigianii]  clstr ali  24  1..............MLTFMLLCQNAFAADSTINIKGNIKDNTCAVAPGSQNQVVDLLINAVKQLHSNGEVTPLVPFSIDLTPCGTAV-TAVKVGFVGIADGNNKSLLALEAGSANASGVGIQILDGARTPLVLNADSNSWTPLMAGSNTLHFNARLMASKTPVVAGHIRATATFTLE.. 165
356 3.000e-43gi|619734431|gb|AHY09671.1| fimbrial protein [Serratia plymuthica]  clstr ali  23  1MKK----LIILTTLCGTGYLFPAIATAADKEIDFFGTVVNRPCNIEPQSADQVVEMDTVIVKTLYRYG-HSNPVPFNIKLTDCKTAVFKSVNVTFSGTEDSELPGKLAINNGTNGA---AIALFDSKGTDIALNQATSA-VALQDGATVLNFTAYVQGHPKTITEGEFSSVANFVLAY. 174
357 3.000e-43gi|496195577|ref|WP_008915414.1| fimbrial major pilin protein [Providencia sneebia]  clstr ali  26  1MKK----IILATLISGAMSASALAVDAGQGTVTFEGSIIEAACGIAPESTDQTVNLGQVASAQLAGGGM-SRPVNFTIELVDCDTSISDTXEVTFTGGINPNLADSLAIQ---GTASGAGVVITGLDAVPVKLGSXSAGXIALQDGDNSLLFSAYLKGDSTTIVPGFFTALTNFTMQY. 171
358 3.000e-43gi|535640953|gb|EQX77286.1| hypothetical protein G936_01539 [Escherichia coli UMEA 3193-1]  clstr ali  26  1MKLKHVGMIVVSVLAMSSAAVSVTTTVNGGVIHFKGEVVNAACAIDSESMNQTVELGQVRSSRLAKAGDLSSAVGFNIKLNDCDTNVSSNAAVAFLGTTVTSNDDTLALQSSAGSAQNVGIQILDRTGEVLVLGATFSAKTDLIDGTNILPFQARYIA..................... 167
359 4.000e-43gi|490379781|ref|WP_004259301.1| fimbria A protein [Providencia rettgeri]  clstr ali  21  5.KMKLNKLALVLGLGLAVVAGSASANQGGGQVTFKGSIIDAPCSIPPGSQAFEVQMGAIATSALNGGGK-SIARDFNIQLEQCDITTLKTVQTTFTGIPSTSVTDGLAI---AGTAKNAGIVITDYNGTKIALGAKSPSQTLLT-GANTLRFQAYLQGDDDAAVPGEFDAIATFALSY. 180
360 4.000e-43gi|493707675|ref|WP_006657352.1| hypothetical protein [Providencia alcalifaciens]  clstr ali  27  6MKLKLIAIALPISLALSHTAFATPVTVGGGIVNFAGAIVNTPCVIDNDDASQTVNLGQYRQDAFTGKSSVSSPVGFDIKLTGCATETFKNASLTFAGITVPDEEKILAPVASQGTATGVGIQILQNSKLVNVDGLKATDVVKLNEGDSTLRFQAQYIALADEVTAGSANASADFTITY. 197
361 4.000e-43gi|495105320|ref|WP_007830143.1| fimbrial protein [Variovorax sp. CF313]  clstr ali  28  1...MPKTIFVKLATLAVAGMLSQGAFAADGTVNFTGEIVDAPCSISPNSQNMTVPLGKVSRTVFATIGKKSTPAHFTIDLLGCGAT-AKGATVTFSGTADLDDASYLRVANGVGAASGVAIELGDSAGTKIALGSPSGEYV-LGLGDNSLKFQAAYVATRTAVTVGPANSVAQFTVAY. 188
362 4.000e-43gi|323188515|gb|EFZ73800.1| hypothetical protein ECRN5871_2934 [Escherichia coli RN587/1]  clstr ali  24  28.KKTLLSMATALLSGVAFNALADDPNQGSGKITFKGEVIDAPCSIAPGDEDQTINLGEVADTVLKS-GQKSLPVDVTIHLQDCGTNTVDKVKITFSSASDATDSNLLKNTGNIGGATDVGVRLVKSDNTNVTLGTPITINFPTTNSYQELNFKARMESLGRTATPGNVQAQANYVLDY. 211
363 4.000e-43gi|495778592|ref|WP_008503171.1| MULTISPECIES: fimbrial protein BcfA [Enterobacter]  clstr ali  25  1MKKHVLAMVIATAMVSGVAMNAQAVTVSGGTVNFVGQVVNAACSVAADSVDQTVTLSQVRTVKLTTKGMQANQKDFKIVLEDCDTTVSQNAAVIFNGQQDAALAGSLANTAGAGSATNVALQLFGPDGNVLNIGDTSSN-VKLINGENTIPLSVDYIATGAA-TPGNVSSTATFQMVY. 179
364 4.000e-43gi|505192241|ref|WP_015379343.1| fimbrial protein [Serratia marcescens]  clstr ali  23  1..MTIRLCGLLLIALSVGSAAAAAKNQGHGKVSLGGTIVETPCGIASDSLDQTVDFGLISMTDASQDGQSGSRRHFTIKLVNCELAIYRAANVTFDGTADSGDPSLLGVY---GEAQGVAIELLNDAGTPIPLGSTTADYQ-IVAGDNTLRFGAQLRLHPDKARAGGFSSLAKFTLSYL 183
365 4.000e-43gi|639223550|ref|WP_024560785.1| fimbrial protein [Cronobacter pulveris]  clstr ali  25  1MNKFNLACLVLLFTGL------PAANAAD-NLKFTGTIVGSSCDIDTSSTNQDVTIGQFSPADFPSVGTTTAAVKFNIKLKDCSGSITGS-KILFSGTSDNSDTSLLALSDTGKGATGIGVQILDANQSPISINNTDSDVYPLIGGDNTLVFYLRYKSTKADVTAGDATAVMYFDMNY. 175
366 4.000e-43gi|446526065|ref|WP_000603411.1| adhesin [Salmonella enterica]  clstr ali  21  1..MILRRVFITIGCVLLSPLSQANSSLGEVNIELRGNVVDFTCAVVAGDSNKSVNLGTWPTKQLHAAGDATQPVAFSLKLEGCPP---GSASITFSGTPAPG-TALLAL-ADTEMAQKLAIEIRDGDQRRLPLEQASKAVDIDNNGNATLKFYANYIALADGVQPGLANADATFLINY. 171
367 4.000e-43gi|503309261|ref|WP_013543922.1| fimbrial protein [Variovorax paradoxus]  clstr ali  26  1...MQKSVLVKFASLAVAGVLSQGAFAADGTINFTGEIVDAPCSISPNSQNMTVPLGKVSRTAFDGVGKKATPAKFKIDLLGCGAT-AKGATVTFSGTADLDDATNLRLANGVGAASGVAIELGDSAATKIPLGSPSGVYT-LGLGDNSLNFQAAYVATKTAVTVGPANSVAQFTVAY. 184
368 4.000e-43gi|675523480|gb|KFN18164.1| fimbrial protein [Aeromonas salmonicida]  clstr ali  26  1MNANKILVAMGVGSILLCGSAVAAGNTGSGQVTFNGEIINAPCSVAPESVDQVVEMGQISTKELVNGGE-SNSKPFSIKLLNCEISEKDAVKVTFSGIKDTVDDSLLVIGGGNGTAAGAGIKMTAPGGAPIVLGTPTAAFA-LTNGDNELPFSAVLKGTANPLQAGAFTAVTNFTLSY. 183
369 5.000e-43T2D.3940879 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  24  1MKKHLLAMVAMAAGGMTCAANADTSTVSGGTVNFTGQVVNAACSVSADSIDQTVTLSQVRTSKLTAAGMVANQKDFSIKLEDCDTTVSQNAAVIFNGQQDSSLAGSLANTAGAGSATNVALQLYGPDGQVLNIGDTSGA-ITLINGENTVPLSVDYVATGAA-TAGNVAATATFSMVY. 179
370 5.000e-43gi|489310334|ref|WP_003217751.1| fimbrial protein FimF [Pseudomonas fluorescens]  clstr ali  25  1MKKYLCILCL-------MPCLANQSYAADTSISITGYLKDNSCSVSVDSKDFTVDLMSNASKQLNHVGTTTVPVPFTIVFDKCGGSTTG-VRVGYSGTSDNDNIALLKIDEGVNAASGMGIQILNSDKQAIPLNTTSLRWTHLIAGSNTLNFYACLMATHSPVTAGVVNATANFTLE.. 172
371 5.000e-43gi|490380045|ref|WP_004259565.1| putative minor fimbrial subunit PmfF [Providencia rettgeri]  clstr ali  23  12.KRTKYLLSIGLYLLVSGPMSASVIPTNMGSYSFRGMVIATPCQIAPGSEKVPVDFQQISVKDLYKEGK-SKPLNFSIHLTNCNTTIFKSVTVTFNGIENKNLPDHLAISDQS-EASGIGIGLLNLNETPIELNTPSLAQ-NLATNNTEIQFKAYVEAEPQTITYGNFYSTAYYTLNY. 190
372 5.000e-43gi|495729741|ref|WP_008454320.1| type-1 fimbrial protein subunit A [Enterobacter sp. Ag1]  clstr ali  28  1MKIKNLAL-VALSALSLSSGAAYAVTVNGGTVHFKGEIVNAACAVDAGSVDQTVQLGQVRSARLAAAGSTSSAVGFNIQLNDCDTTVSTKASVAFSGVAVTGKTDTLAIQGAAGSATNVGIQILDNTSTPLALGATFSAKTTLNDGTNIIPLQARYI...................... 158
373 6.000e-43gi|490366218|ref|WP_004245882.1| fimbrial protein [Proteus mirabilis]  clstr ali  25  1..MHKLMLIVALSLLFTTKGS-----AYDTLVHINARVTGNTCTVETNSKRITVKLGQIATKDFISTTQRTPVIPFSIKLVDCQPEAS-AVKVSFNGRADPIDNALLAIDAT--GAKGVAISIMDNSGASIDINDKSQSYTLLPNQDNTLQFYARYVATQLPVQAGSANATATFLLEY. 171
374 6.000e-43gi|491305269|ref|WP_005163272.1| fimbria A protein [Yersinia enterocolitica]  clstr ali  26  1MKLNKTILAAGLVLG--FASMANAADQGQGTVTFNGSIIDAPCSIAAGSDAQTVEMGQISNVALQNGGK-SSAHDFKIKLENCDTTTLKTVTTTFGGAESAAVPGLLGI---TGVAEGAGIAIVDGTGSVITLGTATEQQT-LVTGNNTLAFSAYLQGSSDAIKPGSFSSVADFTLAY. 173
375 6.000e-43gi|41464|emb|CAA29154.1| unnamed protein product [Escherichia coli]  clstr ali  30  1MRNKPFYLLCAFLWLAV-----SHALAADSTITIRGYVRDNGCSVAAESTNFTVDLMENAAKQFNNIGATTPVVSFRILLLPCGNVVSRRKGWVYW-RADSHNANLLALENTASAASGLGIQLLNEQQNQIPLNAPSSAWTTLTPGKNTLNFYARLMATQVPVTAGHINATATFTLEY. 175
376 6.000e-43gi|556463226|ref|WP_023315071.1| MULTISPECIES: hypothetical protein [Enterobacter cloacae complex]  clstr ali  24  1MKLNAIASAIILSSSIL----SGAALASDGTVHFRGEIIDSACEITTVTKEQNVDLGKVSKTAFNGVGSTSAPTQFTISLEKCPPT-YTKASVRFDGTEATGTPGDFTGTGDAVTATGVAIRIYNADNSQVELYKDSAT-TDIVDTKADLKFIARYIATSTTVTPGTANADSQFTVEY. 185
377 6.000e-43gi|490386518|ref|WP_004266015.1| fimbrial protein domain-containing protein [Providencia rettgeri]  clstr ali  22  1MKLKSITTSIFITLGLVS--FANAADQGHGKVTFKGSIIEAPCSISPDSIDQTVELGQISNMALVSGGK-STPRSFDIALENCDVTATKGVQLTFTGAAASFDATS-KTLGIVGTGAGAGIQITNGGGNIVTLGTAT-PFQNIQSGDNTLRFSAYLKGNGTTITAGDFSSVADFTLSY. 177
378 7.000e-43gi|554923964|ref|WP_023196213.1| fimbrial protein BcfA, partial [Salmonella enterica]  clstr ali  25  27................................KFVGQVVDAACSVSADSVDQTVTLGQVRASKLTEAGMVANQKDFTIKLEDCDTQTSQNAAVIFNGQQDANQPGSLANTAGAGSATNVALQLYGPDGQALNIG-ESSSTVTLNDGENVIPLSVDYIATG-TATAGNVTATATFSMVY. 171
379 7.000e-43gi|447098930|ref|WP_001176186.1| hypothetical protein [Escherichia albertii]  clstr ali  21  1...MQLKKVLGFVSGIILSSCSWAADLGTINIELHGNIIDFSCTVNTADIDKTVELGRWPTKQLLSAGDTTALIPFSLRLEGCPP---GSASVTFAGTPATDNS-LLALDDAV-MAQNVAIELHNSDRGRLPLGESSQTVAVDANGNVTLNFFANYIALASGVQAGAAKADATFMINY. 171
380 7.000e-43gi|723243318|gb|AIX75954.1| hypothetical protein PSNIH2_15615 [Pantoea sp. PSNIH2]  clstr ali  23  1...............MALLFSSAAAMAFDGTVNFNGEIIDNTCTVANGSNSLVVPMGSVNKSSFTGRGSIASTTQFVLTMTECP---SVNARVKFDGQAYDGDDTVLQLMGGPGVATGVGIQLYDQNMEVLPLFTPSSVYALQEGEPNDLKFYASYIAMSNSVTAGAANSVANFTVTY. 162
381 7.000e-43gi|654058455|ref|WP_027705119.1| hypothetical protein [Zymobacter palmae]  clstr ali  24  1MKRIAWLGAVALAGVLAADTPAASQTAPGGKIHFVGTAVNAACAVDANSVNQEVQLGQVRTAKLTKNALSSSRIPFKIMLGDCDTSTYKSAAVSFTGTAATGYTNVLQAGEGSSAATGVGIQIFDSTGTAVTLGTPSSTF-SLNNGSNELDFNASFYGTSDAATAGDASATANFNITY. 182
382 7.000e-43JGI.Meta JGI_HUM.1463549 7053944145 SRS017521_Baylor_scaffold_54224__gene_115395 sfm fimbrial protein, A chain [Human Stool microbiome from visit number 1 o  ali  24  1..MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNTDSADQVVTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNLLAIVSSTNTATGVGIEILDNTSAILKPGNSFSTNQNLIPGTNVLHFSASYKGTGTSASAGQANADATFIMRY. 179
383 8.000e-43gi|658469311|ref|WP_029685140.1| hypothetical protein [Tatumella saanichensis]  clstr ali  35  3...KKGALLFLLLINYSYAQLAFPVILPGGLTKFRGQVVAGTCTIDSGDRFLTVDMGRISSNRLLQVGEYADPIPFTLHFRNCNSETGHHLSLVFRGVADDQDKDLLAITQELNSARGVGIALFDSQGSIIPLN---SVFIPISDGTSVLKLIAKYRATSENISGGKVDAQAWFLITY. 181
384 8.000e-43gi|692294857|ref|WP_032115873.1| hypothetical protein [Arsenophonus endosymbiont of Nilaparvata lugens]  clstr ali  27  1.....MRKLLMTSFLSIFYLTQFTAHASDGNIKFTGEIIQSSCTFKALTKDQTVSLGTVATNSFKKVHDTASPTVFNIEINNCPNN-SQEVFVIFDGVKDEINNELLAIKEGDGYAAGVAIGIYNNNSERIPLNHKTGVY-PITDKTAILKFIAKYVATENIVLPGKVEANANFTLVY. 172
385 8.000e-43gi|515944367|ref|WP_017374950.1| hypothetical protein [Enterobacteriaceae bacterium LSJC7]  clstr ali  23  1MKFNLIASALFMSLGLAT-MTVNAAEQGSGTITFSGAVIDAPCSVNPDASEQDVYLGQVALHQLSDGGS-SKPRDFKINLENCAALVAPSVKVKFEGVPADGDDDT--AFATRGDASGIGVVITDKSGKPIKVGGESDARELL-AGNNALGFSAYVLGMGKDVSVGEFESIVDFSLSY. 185
386 8.000e-43gi|674725222|gb|KFK95216.1| ferrous iron transporter B [Serratia sp. Ag2]  clstr ali  25  1MKKNIIVXXXXXXXXXXXXXXXXV----DGQINFTGEIIDSACEVVNNSAPLNVELGKVAKTAFSGAGDTASATKFTLQLKNCPVSVTG-AAVKFEGAAAAGDNSVLALTQGAGVATGVGIQLSDASATALQLNTASATYPLVSTGVNNLDFVARYIATETEVGVGQANAVASFTINY. 174
387 8.000e-43METAHIT V1 GL0046306 [Complete] locus=scaffold70519_2:3444:3986:+  ali  24  1MKKQVIAMAVAGALAGGMAINAQAVTVSGGTVNFVGQVVNAACSVAADSVDQTVTLSQVRTVKLTTVGMQANQKDFKIVLEDCDATVSQNAAVIFNGQQDPAVEGSLANTAGAGSAKNVALQLFGPDGQALNIGDTSSN-VKLINGENIIPLSVDYVATGAA-EPGNVSSVATFQMVY. 179
388 8.000e-43gi|505189112|ref|WP_015376214.1| fimbrial protein MrfG [Serratia marcescens]  clstr ali  23  20.........ALLLVPMLMAAPLSALAAGDNNLYLHGALVAEPCVIPPGDEEITLDFGTIIDKYLYLN-TRTLGQAFEIHLEECDLTLGKTVSVTFTGTENQALPGLLAIDGGS-AATGIAIGFETPSAQPLPLNTQSGK-SLLQDGGNTIALRAYVQGEPQTIGRGAFSAVATFNLEY. 190
389 8.000e-43gi|503993406|ref|WP_014227400.1| fimbrial protein [Klebsiella oxytoca]  clstr ali  26  1MKPATLFFPLLMTFAGVHSASADDIDSGQVELDMTGTIVAESCDIDTASQNQTIHIGDFSAGIFQSVGDTSEWKQFDIKLNNCTSAISQS-TVAFSGTSDGSDPSLLALSDTSGGASGVAIELLDSSMNTIAINSTDNGY-PITQGNNDLTFRLRYKATAVPVTPGNASSVLYFDVSY. 179
390 8.000e-43gi|514233362|ref|WP_016536011.1| putative PRS fimbrial major pilin protein [Cedecea davisae]  clstr ali  22  1MNMKKI--VLAMAMSSAMIAGANAADQGHGKITFEGTVIEAACSINPDSLDQTVSLGSIARHQLLSGGK-STPRDFSIKLEDCDAKIGSNAEVTFNGPAGDQGEGLDKTFATTGVAAGVGVVITQAGGVIVEPNKP-ATAIALNDGENELAFQAYAQGGTTTVATGAFSATANFVMNY. 175
391 8.000e-43gi|573498909|gb|ETS99428.1| putative type-1 fimbrial protein, A chain [Providencia alcalifaciens PAL-3]  clstr ali  26  1MKFKLIAIALPISLALSANVFAAPVTVSGGVVNFAGTIVNTPCVIDNDDASQTVNLGQYRQDGFDGKDSVSSPVGFDIKLTGCATETFKNASLTFDGNTILDEEKILASQSGQTIATGVGIQILQNNKLVTVNGSKATDAIKLNEGDSTLRFQAQYIALANEVTAGSANASANFTITY. 191
392 9.000e-43gi|506490737|ref|WP_015966115.1| P pilus assembly protein, pilin FimA [Enterobacteriaceae bacterium strain FGI 57]  clstr ali  24  1MMRKLIVSALALLAISPSFSVLAMGELIGGDLSFKGVVVAYPCSIAPESERVPVDFGEISTKSLYATGK-STPVPFSIKLQNCNPGVFNAVTVTFSGTENSNMTDRLAIKAVTGNAGGIGIGLLESDQTPIKLDVPTNA-TAITDTALQLNFLAFVEGEGGTLTTGPFTATANYTLNY. 182
393 9.000e-43gi|639218475|ref|WP_024555978.1| ferrous iron transporter B [Cronobacter pulveris]  clstr ali  22  1..MKNIVLSTVIAGIASCSVSAFAVSTGEGQVNFTGEILDSACVVNTLSSPLQVNLGKISKTVFTGVGSAATPTSFALQLKNCPAT-ATAASITFGGTANSDNDKVLALTSGTGVASGVGIQLLDSSGSPLDLYTASADYTLKSGSTNDLAFGARYIQTAASVTAGKADSTSTFTVTY. 177
394 9.000e-43gi|515919109|ref|WP_017349692.1| hypothetical protein [Pantoea sp. A4]  clstr ali  23  1..MNLNAKMMALLVAMGISGAVNAANTGSGTVTFTGAIIDAPCSINPNSVDQTVNLGQISNAELATNTGTSTPQPFYIKLENCTTATLKSVQSTFTGPKSLWDADSLGIN---GSAEGASIILKDGSGAKIKLGEKTTAQA-LQDGNNTLSYSAYLQGGGAVIKPGNFQTVSNFTLSY. 176
395 9.000e-43gi|727186263|ref|WP_033648118.1| hypothetical protein [Serratia marcescens]  clstr ali  23  1MNKYMLNSLLLVGVPLAMTTITKAA-AADGTINFTGNVTDQTCTVVAGSANQTIPMGNISAKAFKSAGDTALPTKFSIALTSCPETVTK-ASVKFDGTYAQGNSTLLSLNSESGVATGLGVALYEADGTQIPMASFSNAQSVQKDINNVFTYVAKYMATSDKVTVGPANATTQFSISY. 177
396 9.000e-43gi|490209957|ref|WP_004108360.1| fimbrial protein BcfE [Klebsiella oxytoca]  clstr ali  28  7...........LFLALLCGSPFCQAGDTGNNLEFTGTIVAQTCDVEISSVSQSIDLGQFSVEDFPATGTTTKFKPFNINLKNCSRGITGT-KIWFTGTADSDDPSLLALTDTGMGASGIGVELLDEDQDDVSMNNSESVVYPLKAGRNTLSFYIRYKSTRPVVTSGNATAVMYFDLQY. 177
397 1.000e-42gi|660567640|gb|AID87560.1| hypothetical protein KONIH1_00275 [Klebsiella oxytoca KONIH1]  clstr ali  25  1MKMYWLCLPFFLLSGVSLA----DTQIGTWNMTINGTVLPSSCDIDSSSQTQSINLGTFSANTFSSTGDVSPDVPLDIKLTGCGDSIVG-ATLTFSGHADSGNSNLLALSDTTGTASGVGVEIKDSDGTTIPLNTASKQY-PLSAGDNTLNFLLHYKATTIPVTAGYATAVMYFDVDY. 175
398 1.000e-42gi|501411148|ref|WP_012442714.1| minor fimbrial subunit PmfF [Erwinia tasmaniensis]  clstr ali  24  1..MNSIIIAAALLFAVLSSAPAMAAVLIGGDLRFEGEVVAYPCSVAPESERVPVNFGEISTKSLYINGK-SIPVPFSIRLQDCNPGLLNTVSVTFSGDENPNLANHLAIKATAGGASGVGIGLLEADNTPVSLGVPTTP-VTIGDSVMQLDLQAFVEAEPDTLTAGPFSATAYYLLNY. 181
399 1.000e-42gi|573499908|gb|ETT00390.1| type-1 fimbrial protein, A chain [Providencia alcalifaciens PAL-3]  clstr ali  26  1MKVKSLALVISALSLGSVAAMAATTTVNGGQVHFKGELVNAACAVDAGSVEQTVRLGQVRTAKLAKLGDTSGSVGFNIQLNDCDTTVATSAKVAFTGAADATNPTVLVASSASGAATNVGIQILDGKSAPLGLGATFSNPITLNDGANVLPFQARYFALGAT-TAGVANADATFAVQY. 181
400 1.000e-42gi|496195664|ref|WP_008915501.1| frimbrial protein [Providencia sneebia]  clstr ali  25  1..MRTLKKSLIAVEVVLVLTTAPAAFA-SGTIKFTGEITDVACTVDSKSKNLNVELGKVSSKSLAAKGEVAGLKDFTIKLIDCPAT--SKVTVRFGGTRDLIDRDILAINQGTSAATNVGIALFEKDTTPIKLYEDTKE-VEFKGATVDLDYVARYKATG-TATAGPANSSAVYSIQY. 172
401 1.000e-42gi|668975021|gb|KFC89914.1| type 1 fimbriae major subunit [Hafnia alvei ATCC 13337]  clstr ali  25  5..FKLSALFAASFIILSGSAMAATTSVTGGTVHFKGTVIDAACAVDDNSIEQTVTMGQVRTARFGTAGSVTQKVPFSISLKDCDSTVASNASLTFNGTASADYPSALENAGGPGSASGVGIQIYDAEGAALGLGTASAT-VALINGENTLSFTADYISTKTTVTSGDVEATATFNVTY. 185
402 1.000e-42gi|496187226|ref|WP_008911733.1| fimbrial subunit [Providencia burhodogranariea]  clstr ali  28  4.KQRLIKSVIGLTVLSASGLGVAATTVTGGTVHFTGTIVNAACAVSANSTNQTVNMGQYRSAFFDAVGKKSGNVPFSIKLEDCDTTVSKKVSVSFSGLTTADNVTALSTSNXXXXXXXXXIQIADHLGQVLKPGSVFSTAQNLVDGANVLNFSANYISTKAVVTPGAADADATFTMQY. 185
403 1.000e-42gi|703134196|ref|WP_033356145.1| hypothetical protein [Burkholderia ubonensis]  clstr ali  29  1............MAALVAAFGSTSALAADGTVNFHGKIVATTCKVNN--ANIQVPLGAIGVEQLAEAGRESRRVPFQIELNECNDQLSG-VRAQFEGVSHNDDPTLLAIGSGKDDAKGVGIQLMDEGGAQIGINSETDTFQ-LTPGSNVLSFNANYVSTSNDVEAGAANGTASFTLNY. 162
404 1.000e-42gi|505805644|ref|WP_015703409.1| fimbrial protein [Enterobacter aerogenes]  clstr ali  23  1MKKLIISALVAASFAAVSTPTFAGATVNGGTIHFEASVVNAACAVDANSINQTVQLGQFKLSDFSKKGDETSRIPFSIKLNSCDPAVASTAAITFVGTPSESEQDVFALQ-GAGAAKNIALKLVDSQNKQIAPGQVSTG-VKLIDGSNELNYSASLISTSDEVSAGNANAVTNFMVTY. 192
405 1.000e-42gi|496187889|ref|WP_008912396.1| fimbrial subunit [Providencia burhodogranariea]  clstr ali  22  1MMNRQFKKLIFILLL----PYAGTVFAIPDNLHFHGILVEEPCTIKPGDESVRLDFGNVPDKNLYAYG-RTVSEAFTINLSECDTSIGKSVNVTFFGTSNLVLPGYLALQNNS-SATGFAIGIEDIDGTFLPVNTQSNK-LSLQNGTTALKFKAYLKGEPDAIKRGPFNAIATFKLDY. 176
406 1.000e-42gi|500023022|ref|WP_011703740.1| type-1 fimbrial protein subunit A [Escherichia coli]  clstr ali  25  20MKIKTLAIVVLSALSLSSTAATTPTTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTATLKQAGATSSAVGFNIQLNDCDTTVATKAAVAFLGTADSTHPKVLALQSSAGSATNVGVQILDRTGNELTLGATFSAETTLNNGTNTIPFQARYFATGAATPG-AANADATFKVQY. 202
407 1.000e-42gi|693043818|ref|WP_032214680.1| hypothetical protein [Escherichia coli]  clstr ali  26  1MKTKLIALSVLCAAMVPAFASAATVTTPGGEVHFVGEVVNGTCAVDADSVNQTVQMGQVRANTLAKQGDVGQNVGFNIVLKDCDNTLPATAAIIFSGVTNTTNAKVLALQSSAGGATNVGIQVLDRSGQPVAFGSTASASIKLNEGTNTIPFQARYMATGQA-TAGTANADATFTVQY. 188
408 1.000e-42gi|504696417|ref|WP_014883519.1| ferrous iron transporter B [Enterobacter cloacae]  clstr ali  25  4MKKNIILAMIATGSALMM----GNAFAAAGTVNFNGNILDSACDVAVASQNQVVVLGDYYKTEFPTTGSRTAATKFNIILKNCPVTV-TSAKVRFDGTPDMTNTDLLAIDTSAGAATGVAINLMTADKADLPLXXXXXXXXXXXXADNTLDFYAQYISTAAAVTSGPANSVANFSVVY. 178
409 1.000e-42gi|701202659|gb|KGP41800.1| fimbrial protein [Morganella morganii]  clstr ali  28  6..........IIIAGTCLCLTVFQASSANSTIKISGRVLGFGCAISSESAEFTVDLLKYSSKQFPVIGSTSGVVPFRILLEDCSEGT-TAVKVSFSGIHDNSNNALLKLDGGINAADGLGIEILNADKVPVPINAPSLNWIKLVEGVVTLPFYARLMATQSPVHPGFVNASATFTLEY. 175
410 2.000e-42gi|491049047|ref|WP_004910698.1| frimbrial protein [Providencia rettgeri]  clstr ali  25  1...MSILKKSLAVIGVALAVTSAPTVFASGTINFTGEITDIACTVDSNSKNLNVDLGKVSAKSLASQGEVAGLKDFTIKLVDCPAN--SKVTVRFGGTRDTADRDILAINQGAGVANNVGIALFEKDTTQIKLFDDSK-QIEFDGATVDLDYVARYKATGVA-TAGPANSSAVYSIQY. 172
411 2.000e-42gi|516457055|ref|WP_017845895.1| hypothetical protein [Pseudomonas veronii]  clstr ali  24  1MNKKLI-----VCTLLACSAFSALSHAADGTINFTGTITDAACTVTPGTANQTVTMGTVSSTALANVGDTAAPTRFDIVLTNCPATATSAV-VKFDGPTDGNNSSLIALTSGAGTAEGVAIGVYEGDATLIPVGSPSVSKPLSPVADTTFNFFAKYVAT-APVVAGSGNAVSDFTVIY. 172
412 2.000e-42gi|490379879|ref|WP_004259399.1| fimbrial protein [Providencia rettgeri]  clstr ali  24  1MKIKSIAMATLLVLGGASA--ANAADQGHGKVTFKGAIIEAPCSIAPESIDQTIELGQISNMALADGGK-SSPKTFDIALQNCNVSLTKGVQLTFTGASASFDEDS-KTLGIVGTGSGAGVQITSGNGEIVTINTAT-PFQQIQDGSNTLQFSAYLKGNGSTITAGEFSSVADFTLSY. 177
413 2.000e-42gi|559224991|ref|WP_023581058.1| fimbrial protein [Proteus hauseri]  clstr ali  26  1MKLNKLGLVLGLGLTVA-AGSAFAADQGHGTVEFWGSIIDAPCSIDPNSGDQRVPLGQVSANALKDGG-RSVSNTFKIKLLQCSTETYKTVQTTFTGAEAAALPGSLGIE---GLAKNAAVVITDAGGTQIKLGEPTKAQT-IRDGSNDLNFAAYLQGSSDAAVPGDFTAIATFALTY. 174
414 2.000e-42gi|696655251|ref|WP_033137344.1| fimbrial protein [Aeromonas sp. 4287D]  clstr ali  26  1MNMNKIVTALGFSAIMVCGSVMAAGNMGGGKVTFIGEIINAPCSVAPESVDQIVQLGQVSTKELVIGGE-SDAQPFTISLRNCEIDEGDSLKVTFSGVADPLQAGLLIL--SSGEAKGAGIAMTAPGGSKVELGKPTAAF-KLTNGNNDLIFNAALKGDAQPLVAGAFTAVTNFVLAY. 179
415 2.000e-42gi|573011653|dbj|BAO35005.1| putative fimbrial protein [Serratia marcescens SM39]  clstr ali  24  1MKLRTQRTMLLAGAYLVISSTSYAA---DGTINFTGTVTDQTCTVEAGSANQTIPMGNVSAKAFRSVGDTALPTKFNIALVSCPDTV-KKASIKFDGIYADGNTTLLSLNKETNAATGIGVALYEADGTQIPVASFSNAQSVQKDIRNVFTYVAKYMSTSGTVTVGPANATTQFSISY. 175
416 2.000e-42gi|506320732|ref|WP_015840507.1| type-1 fimbrial protein subunit A [Pectobacterium carotovorum]  clstr ali  25  1.MHKSLLNTLIGASLLSSSVTVFAATVAGGTVHFKGEIVNAACAVSTNTADQIVNLGQYRTARFTGVGTYSGKVPFTINLEDCDSTVSTTAAVAFTGTADSNDNTVLAVSNXXXXXXXXXIEISDRTGAVLTPNGAVSAPQTLNDGSNVLAFNARYKATQATTTPGAADADATFTIDY. 182
417 2.000e-42gi|586611462|gb|AHJ74908.1| fimbrial protein FimI [Kosakonia sacchari SP1]  clstr ali  24  1...MMRTGLTQAFMLCMMPLLAKAAVVDGGRVHLRGSLVNGACAVAPDSEDLHVQMGQHRTDAFSGIGSFSPSTGFALRLTACDADVSRYVGVVFSGQTPPEDPQVFVAHSTGGGAEGIGLALFDQQQRQIIPNSMPHAYSPLVADEITLHFSARYRAITERITPGHLRSDVWFTLVY. 177
418 2.000e-42gi|655306939|ref|WP_028715591.1| fimbria A protein [Pantoea ananatis]  clstr ali  22  1...MKVKATAIIIGASLVASTAYAAKQGEGKITFTGSIIDAPCTISQDSIDQTVNLGQVSNVALSGGGK-STPKHFSIDLKGCSPAAKNKVAVTFTGAESSAVKGLLGI---TGSAQGAGVALTKGDGQMVKLGEPTTAQT-MQNGNNTLDFAAYLQGATAAIVPGDFTSVANFTLAY. 175
419 2.000e-42gi|696395709|ref|WP_032968427.1| fimbrial protein [Cronobacter malonaticus]  clstr ali  24  1MKRNH-----FLLGILFFITVSTNIFAAEDNIHFSGALVAEPCKLPDADTDIHLDFGTVIEKYLYQY-QRTKSQPFSIHLNDCDPSLMNSVSVMFQGTADTELTQMLALD-TSSTAKGVAIGLELKDGTPLAVNK-SSPFTELTQGNNTLDFNAYVQAQPTTIVAGDFTAISTFILAY. 175
420 2.000e-42gi|490214757|ref|WP_004113140.1| hypothetical protein [Klebsiella oxytoca]  clstr ali  25  1MKISKIASAVVL--TMGVASFAAQADQGSGKVTFWGSIIDAPCSIKNGYGDQRIELGQISNTHLDNGG-ISTPRPFDIELENCGDPMYNTVTVTFNGGNVPNDMTMLAI---TGQAAGAGVRIQDYSGTMVTLDKPTAGRI-LGIGDNTLSFSAYLIASVTNVTPGDFEAVTNFTLAY. 180
421 2.000e-42gi|666379528|gb|KEY49292.1| hypothetical protein DQ02_08250 [Citrobacter amalonaticus]  clstr ali  22  3.KKSILHTLIASSALTFAITTAYALPVTGGTINFTGKVVDASCTVSAGSSTQTITMEPVSTTRLKVVGDTANPTDVPIVLEECNTNTSNTVQVLFSGNSVSGDSTVLSLTDNGNSAKQVGIKLYDSENNEIKLDEMTSPF-SLTTGETTLNFTAKYYALGQA-EAGDVNATATFTMIY. 177
422 2.000e-42gi|490967769|ref|WP_004829570.1| hypothetical protein [Acinetobacter bereziniae]  clstr ali  22  1MKLSLLSIAALSVLSGSAFAVEPPVTIEGGKVQFTGDLVNAACAVTTGSQNKPVVLGQYRTASLAEDGDSTSPVPFELNLTDCDPTVQATASVAFQGTPATTGSTLLQVNGDGNTAKNVGIQITDHTAKALGIGTVFSTPQTLIKGNNTLKFNAFYKATGES-TPGQANATATFFVKY. 180
423 2.000e-42gi|639188537|ref|WP_024527774.1| fimbria A protein [Serratia fonticola]  clstr ali  22  1MKLNKIMMVAVVALGMSSVAHAAVKDQGHGKITFNGSIIDAPCSITQKSAEQTIELGQISKVALKDGGK-SSSHDFTIDLENCEIGTGNKVSVSFNGNVGSVKNRL-------GTGRGASIVIEDVNG-PIELTKATALQ-ELQNGDNTLNFSAYLQGDGAAVTEGKFETVANFTLAY. 174
424 2.000e-42gi|495736313|ref|WP_008460892.1| adhesin [Enterobacter sp. Ag1]  clstr ali  23  1.MNKFILSALALVPILCVPSVKAASPLGEINVELHGTIVDYTCVVETGGDNKTVKLGSWPTKQLRTAGSTTQAMPFNLKLTGCPPS--GTASITFNGK--STGTGLLALNAAS-TAKNVAIELLNEDKSRLLLNDASKTMPVDANGDVTLKFWANYIATADNADAGLANADATFLINY. 172
425 2.000e-42gi|691658158|gb|KGF84353.1| fimbrial protein [Salmonella enterica subsp. enterica serovar Weltevreden]  clstr ali  23  1MKLNLIASALVLSSTMLV----GNAMASDGTVHFLGEVVDSTCQVTPQTADQNVNLGKVNKTAFAGVGSTAAPTEFHIDLTGCPAT-YTKAAVRFDGTEASNSDGDLAIDGAAITASGVAIRIYNADNSQVKLYNDSASTIDTTAGTASMEFIARYIATDATVTAGTANADSQFTVEY. 189
426 2.000e-42gi|503132592|ref|WP_013367253.1| adhesin [Enterobacter lignolyticus]  clstr ali  22  6.........IALLMGIAIALPALATPLGQVNIELTGNVVDFTCVAEGSDSDKSVSLGRWPAKQLRQAGSTTTAVPFTLRLTGCPPGA---ASITFAGKADGADPSLLALNASS-SASRVAVEIRDNDRRRLPLQQASRDVAVDAQGNVMLQFYANYIATADDPQAGSADADATFMINY. 171
427 2.000e-42gi|511289029|ref|WP_016349296.1| type I pilus assembly protein FimF [Aeromonas hydrophila]  clstr ali  20  1...MLRTLWIGLALCPLLAVTAAPRAGDDNTVHLHGRIIDQPCVIAPESLDQAVDMGVVDVRELYANG-TGAQVPFVIRLTNCKPGIFRMAKVTFTGSQDAQLSGGLAF--SAGSAKGAGIRLYDVTQSPLTLGTPSRGYLLGGTTENELQFSARVEGHPDAIQPGDYTAVANFIVAY. 182
428 3.000e-42gi|445934348|ref|WP_000012203.1| fimbrial protein ydeS [Escherichia coli]  clstr ali  23  10...........IFLGLCLGLTTYSALSADSVIKISGRVLDYGCTASSDSLNFTVDLQKNSARQFPTTGSTSPAVPFQITLSECSKGTTG-VRVAFNGIEDAENNTLLKLDEGSNTASGLGIEILDANMRPVKLNDAGMQWIPLVEQNNILPYSARLKSTQKSVNPGLVRASATFTLE.. 177
429 3.000e-42gi|661565058|emb|CDG21419.1| putative Fimbrial protein precursor [Xenorhabdus poinarii G6]  clstr ali  26  1.....MKTTLLISSLFVSSVFMSAAHAIDGQIKFTGKITDSACKVDPSSANQTVNMGTIAANSFDGPSSTSSPSRFSIKLSECPKS-NKSVQVKFDGQTDASR-KYLALEGG-NAAKGVAIALYDDNNTPIPMFKSSRSQDLSDSKTQELHFIAKYIATSSPVTPGLGDAVTNFTITY. 171
430 3.000e-42gi|499457686|ref|WP_011145150.1| exotoxin [Photorhabdus luminescens]  clstr ali  23  1MKYLKLFVLRVGFMVIAATVYGHQGVQAADNMRFHGALVKEPCTIKPGDEDIQLDFATISEKYLYLHG-RTHSEPFLLRLSGCDMSVGKSFKLTFSGIENTQLPGLLALSAGSQAA-GIAIGIETAEGRRLPLNKEGDAY-PLKEGENLIALQAYVQAEPQTITRGAFHAIATFNLNY. 180
431 3.000e-42gi|695724959|ref|WP_032651563.1| ferrous iron transporter B [Enterobacter cloacae]  clstr ali  30  1MKKXXXXXXXXXXXXLTMS----NAFASAGTVNFTGEIIDAACTVDAGSVNQTVDLGRYSKSEFTAAGDKTAATKFSIVLTNCPATVTG-ATIKFDGSADPANSNLLAV---TGGATGVAINLMTADSQDLPLGVNSHVYSLAETVPNTLDFFAQYEATSATVGVGPANGVANFSVSY. 171
432 3.000e-42gi|666618395|emb|CDG86667.1| putative fimbrial-like adhesin protein [Xenorhabdus bovienii str. feltiae France]  clstr ali  22  8.KMKLLKLFIAAVISGSMAAS---AFAADGTINFNGRITKATCTVDASTAD-PVNLPEVGATALAGKGKTGGDTLFSINLKDCGIGGSANVQVKFGGVKDRIDGNLLKINSESGGATGVGIGIYEKNGSTLINMGELSKSTPVTKDVTKLEFKAKYVATGETVTPGTVKASTDFTLDY. 181
433 3.000e-42gi|575851964|emb|CDL85891.1| Major MR/P fimbria protein [Xenorhabdus cabanillasii JM26]  clstr ali  26  1MKMNKLAMILG-FSVALTTGAANAANQGNGTVTFTGSIIDAPCSIKN--TNVEVDMGAVSSHILKKQG-RSESKFFKIELENCTTQTLKGVETTFTGSIASGESGYLGIE---GTAKGAAIAITDAGNNRLPLGTASKLF-SLHEGNNDLQFAAYLQGTSLSVVPGNFTAIANFTLNY. 177
434 3.000e-42gi|446898133|ref|WP_000975389.1| fimbrial protein [Salmonella enterica]  clstr ali  27  1MMKGKFAVVAFAALLGVSSTAMADNKDGDGKIEFFGNIIDAGCQIDTGASNLSVKLGDVAKTTFTAAGDTAATTKFVLTLKDCPDTLNSKVTIKYSGTPDTTDNDYLQLTQETGVAKGVAIQLLNSDASPLPLGSASTQTVTVASNKAELDFFARYIATAAAIEAGKANGSVNFTMTY. 181
435 3.000e-42gi|569548332|gb|AHE49953.1| fimbrial subunit type 1 [Aeromonas hydrophila 4AK4]  clstr ali  23  1MKKSLLAMAVVLSSGMSLNAFAPPTTVTGGTVYFNGEVVNAACAVSSDSLDQTVYLDQVRTAAFNGAADAPANQPFEIKLVDCDTTVQTTAAVSFTGTTVAGKTSVLANSAGSGAAQGVGLVLMGPDSAVLEINTVPSSKVTIVDGTTVIPLSVDYISTSTVVTPGPVSSVANFNVHY. 183
436 3.000e-42gi|503771486|ref|WP_014005562.1| fimbrial protein [Collimonas fungivorans]  clstr ali  27  1MKQMTIAKLVAVAAAGLLS---QAAFADGGTVNFNGNIVDSPCTVDPSSQNITVPLGDVSRTVFGAAGKKSTPSKFTILLTDCGPT-AKGATVTFTGTTDAIVKDDLAIANGVTAATGVAIELGDSAGTKIPVGSASGTYV-LGLGNNPLKFQAAYISTSTAVTVGPANSTAQFVVAYL 179
437 3.000e-42gi|515203645|ref|WP_016809922.1| fimbrial protein [Klebsiella oxytoca]  clstr ali  25  4...........LLIVTLIAGFSTGVFADDGKINFEGEVTDQACTVVNDLANLKVTLGTVSKASLDGKGKTAAATTFNIKLDNCPATV-NSASVKFDGQSANNDNTALKLTQETDVAKGVGIQLSDHTNAVVPLYTESAAY-SLTTGSNSIPFVARYIALQDTVDAGHANSTANFTVVY. 170
438 3.000e-42gi|501097328|ref|WP_012147346.1| MULTISPECIES: fimbrial protein [Serratia]  clstr ali  22  1..MTKRIWGVVLIALSVCSAEATAKNQGHGTLNLGGEIVETPCGIASESLDQTVDFGLISMTDAALDTQIGSRRNFEIKLVNCELAIYRAATVTFDGTADSRDPELLAVY---GEAQGVAIELLTAAGIPIPLGSTTADYQ-IVAGDNTLRFSAQLRIHPDRARAGGFSSLAKFTLSYL 183
439 3.000e-42gi|578247222|gb|EUM07320.1| hypothetical protein L465_04517 [Enterobacter sp. BIDMC 29]  clstr ali  29  1MNKSVITMGFLLAAIASPSSHAAPGKGA-GTIEFTGMITASTCDVDINGQNPTIDMGTISSSAFKEKGDVAGIHRIQIELSNCDTAVLKSAGARFGGAYDANDNNLLALKTDGDAATGLGIEFLNEDGTSLKLGDNPNKFVPITTGAATLLYSARYKASLDAVTAGKADAVADYTIIY. 183
440 3.000e-42gi|578248844|gb|EUM08935.1| hypothetical protein L465_03027 [Enterobacter sp. BIDMC 29]  clstr ali  23  1MKRKRKKVAGLLLTQALITFAVPPVTAAD-NVHLYGALVAEPCVIPPGDEEIQLDFGTIVDKYLYQN-TRTLGQPFEIRLAECDISLGKTVRVTITGMENTALPGLLAIDAGSG-AKGIAIGLETLEGKPLPFNKSSDDYV-LQAGNNMIALKAYVQGEPQAIANGPFNAVATFSLEY. 189
441 4.000e-42gi|696226449|ref|WP_032806821.1| fimbrial protein [Cronobacter turicensis]  clstr ali  20  1MKRKILMLYAVLGLVLLNC-----AHAAEDNVHFSGALVSQPCTIPDADTDIKLDFGSVIKKSLYKY-TRTTGKSFTIHLEDCNIELMKTVSVTFEGIADNELTTMLALDAVS-TAKGVAIGIETVDGVSMPVNK-MGPYSQLVSGSNTLTFNAYVQAAPSSITEGDFSSTANFVLNY. 175
442 4.000e-42gi|502671738|ref|WP_012907556.1| minor fimbrial subunit PmfF [Citrobacter rodentium]  clstr ali  24  1..MHRIMIFLASLLTPLCTAPAWAGQLIGGDLSFKGVVVAYPCSIAPDSERIPVDFGKISTKSLSINGKTT-PVPFTIKLQDCNPSVFHSVTVTFSGTENPNLADRLAISATAGNAGGVGVGLLEADDTPVRLNVPTTP-TTVSDTVLRLNFQAFVEAEPDTLTTGPFTATANYTLNY. 181
443 4.000e-42gi|493180209|ref|WP_006178641.1| fimbrial protein BcfA [Enterobacter cancerogenus]  clstr ali  25  1MKKHILALVTAAALTGGICANAQAVTVSGGSVDFVGQVVNAACSVAADSVDQTVILSQVRTVKLTQAGMMANQKDFQIKLEDCDTSVSQNAAVIFNAQQDEAQPGTLANTAGAGSAQNVALQLFGPDGKALHLGTSSST-VKLINGENIIPLSVDYIATGAA-TPGNVAATATFQMVY. 179
444 4.000e-42gi|689258572|gb|AIQ99503.1| hypothetical protein LG71_06100 [Pluralibacter gergoviae]  clstr ali  27  1MKKKII-----AAALXXXXXXXXXXXXXDGTVTFNGSITDETCEVTSDSKALTVDMGVAGSNSFSGKGSTSLAKPFVIELTNCPTATPKDVRVNFDGDIDNGDSSILKLDSASD-AKNVGIQIRDASNNVVNMQEDSSTYTVTGGPTNKLRFTARYIATAASVGAGTANAVTQFSINY. 176
445 4.000e-42gi|327412748|emb|CAX67751.1| fimbria A protein [Yersinia enterocolitica]  clstr ali  25  1MKFNKIMLSAILVFGASSMAQANPVMGATGKVTFSGKIVDAPCSIAPESVDQTVKMGSIANGALKAGGK-STPQPFMLKLTDCDVATKKSVVTTFTGGASESKDGHLGVI---GSAKGISVGIGDTAGNLIVLGKPVPS--ELIVGSNELNFTTFVKGDAAAITPGDFQAVAGFTLAY. 178
446 4.000e-42gi|490839100|ref|WP_004701175.1| fimbria A protein [Yersinia aldovae]  clstr ali  25  1MKLNKTILAAGLVLG--FASVAHAADQGHGTVTFTGSIIDAPCSITPDTVDQTVNLGQISNVALTNGGK-STPRNFLIKLENCDVTTLDTVTTTFSGSESTAVAGLLGI---TGVAEGAGIAITDGSGSVVTLGQPTAGQTLVGP-NNTLTFSAYLQGSTAAVKPGNFYSVADFTLAY. 173
447 5.000e-42gi|333391206|gb|EGK62326.1| fimbrial protein internal segment [Enterobacter hormaechei ATCC 49162]  clstr ali  29  17.RRMTRTGILLCALAIAPAVNAHTVVIDGGKVHLRGELVNGGCAVAPDSQNMRVDMGQYRTNAFSGVGSFSTNVPFTVRLLDCSVDVSRTVGIQFQGVTPAEDPQVFLATSRPGVSSGVGLALFDEQQRQIIPNATAVSWLPINTRELAFHFSARYRAISEHLVPGTIQSNVWFTLIY. 197
448 5.000e-42gi|446726729|ref|WP_000804042.1| fimbrial protein [Escherichia coli]  clstr ali  25  1MKPNMIVGALAFTSVFM----AGHLQAADGTVHFRGEIIDSTCEVTPETKDQVVDLGKVNRTAFSGVDDVAAPTAFSIDLTQCP-ETFKSAAIRFDGNEDAHGNGNLAIGGAVSAAKGVAIRLYNADNTQVKLYENSAS-TPISNGNASMKFMARYIATETTIDPGTANADSQFTVEYI 199
449 5.000e-42gi|496189127|ref|WP_008913634.1| fimbrial protein [Providencia burhodogranariea]  clstr ali  25  1MKK-----VFLAALISAAIASPALADQGHGKVTFKGEIIDAPCSISSDSIDQTVWLGQIANSVLANGG-TSTAKQFNIELEDCDKVYNDKVSITFSGSSAGFNPKLLGVTGLDATAGNVGIQLTDTNGKALDMGVATSQEHQLQAGDNTLRYSAYVQGASVDVDKGKFEGVTNFTLAY. 186
450 5.000e-42METAHIT O2 GL0056557 [Complete] locus=scaffold67262_7:2006:2569:-  ali  24  1MLKKTLLSMFATALLSGVAFNALADDQGSGKITFKGEVIDAPCSIAPGDEDQTINLGEVADTVLKS-GQKSLPVDVTIHLQDCGTNTVDKVKITFSSASDATDSNLLKNTGNIGGATDVGVRLVKSDNTNVTLGTPITINFPTTNSYQELNFKARMESLGRTATPGNVQAQANYVLDY. 186
451 5.000e-42gi|505805619|ref|WP_015703384.1| fimbrial protein [Enterobacter aerogenes]  clstr ali  26  1MPGWRILLLFIFISPAWVSADTFRLVSTPGKMRMRGNIIEAACYVDPRDRSLLVEFDDLSARDISGKPEKVSAHNFSIHLLGCPGNVFQRANITFSGAPDRDNPDYLSVQSET---ENLAIEIYDSKGQQIHLGEPSPDYV-LNPGKNTLKFTAYLISRDGRMTSGEFTAVTHFVVNYL 182
452 6.000e-42gi|661561524|emb|CDG17805.1| putative fimbrial-like adhesin protein [Xenorhabdus doucetiae]  clstr ali  26  1MKTKLIISSLFISSVLM-----STAHAADGQVKFTGKITATACKVDSNSANQTVNMGTISSSSFNGANSTSAATRFSINLTDCPTE-YNQAQVKFDGQTDKTNSRFLALTNSKGAAQGVALALYDDSSTAINIAENSQSQKLVAGQKNTLDFIAKYIATSNKVVPGSGDAVANFTITY. 175
453 6.000e-42T2D.3330176 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  23  1MNILQKFILLMFRSLFMMVISYNALANDTVVVTFTGQLLAKTCDITTGSKDQPVNMGTYDVNDFLNVGDVSGSHTFTINLEGCPTTTSTSANVQFTGDADAINTTLLRLTSSADSATGVGIEILDSNDKIIAINSESKELILNNNGDASLTFKLRYKSTQQNVHAGQANALLYFDIDY. 186
454 6.000e-42gi|635162078|dbj|GAJ66138.1| fimbrial protein [Edwardsiella piscicida]  clstr ali  22  18..MKSIVLIVLLSIGQVVWAT------GDNNLNFDGILVTEPCTLDPDTTDITLDFGTVVDKYLYTNMRTASKV-FNIRLLDCDVTLGQSVRVTFGGMPNKELPTLLAL--SSGPASGIAIGMEKSDGSALPLNKSTPSYT-LMSGDNILTFKGYVQGEPTAIILGNFTAVATFTLEYL 189
455 6.000e-42gi|446843231|ref|WP_000920487.1| F7-2 fimbrial protein [Escherichia coli]  clstr ali  19  1....MLKSTLGIAIAFSLCAVAHAANQGQGVVNFKGTVIDAPCGIDPDSADQTIDFGQISKSHLNSNG-ISVKKDLNIKLVNCDLSAKKTVQVTFNGATVNGHKDELGTAGDTGTA----VVISGQDGKLISFGTPGTAQ-NLKDGENTLHYSSWVKASDGTVKEGAFTAVADFNLSY. 172
456 6.000e-42gi|570288620|gb|AHE70805.1| ferrous iron transporter B [Enterobacter cloacae P101]  clstr ali  24  2MKKTLLLATIAAGSVLTMA----NAFAAAGTVNFNGNILDSACDVDVASLNQVVVLGDYYKTEFTATGARTAATKFDIILKNCPVSV-TNAKVRFDGTPDASNSNLLAIDTSAGAATGVAINLMTADKADLPLGSNGYTYMLSSSADNTLNFYAQYISTTASVTAGPANSVANFSVVY. 176
457 6.000e-42gi|503130003|ref|WP_013364664.1| fimbrial protein BcfF [Enterobacter lignolyticus]  clstr ali  30  4..........FALAACVSLAMMAQPQAHQGTVYVTGTITDNTCAVSPDSKNLTVPMGDVSSKQFSRAGDGSRYEPFVINLEKCGGAASG-VTVHFAGTSDSRNPALLALTXXXXXXXXXXXXIYNPDKSLIPLGAESGN-TPISPNQATLHFYARYIADGDSVAAGTANASATFVLTY. 171
458 6.000e-42gi|674723959|gb|KFK93991.1| hypothetical protein JV45_13965 [Serratia sp. Ag2]  clstr ali  24  1MNKN-----LVAVAMLAASAFTANVFAADGKINFTGSIIPNPCTVTGGTADQTVNLGTIGVTAFPVAGALAGAQSFTLKLTNCPDTI-TSARVSFDGTSASNDNSVLALTPAADAATGVGVQITDKTGAVVKLFDRSSEYALASTAVNNLDFVARYISTSANVTSGSANAVTNFTIVY. 173
459 7.000e-42gi|727239262|ref|WP_033699813.1| hypothetical protein [Pseudomonas sp. WCS358]  clstr ali  26  1MKVSSLAGAIMAVALASTSAVTFAQDQGHGRITFRGAIIEAPCSIAQESAYQTVEMDQVSNVSLKDGGK-STPKTFKIELRGCELGALKSATATFTGSP-ASNPDLLAIR---GTAQGASLAIADHTGELIKLGDASPAQT-LSNGDTYLEFKAYLQGDXXXIKPGDFETFANFTLAY. 183
460 7.000e-42gi|695644514|ref|WP_032617161.1| ferrous iron transporter B [Leclercia adecarboxylata]  clstr ali  27  1..MNKVALSLFIAAMAGCAASAFAATNGEGQINFSGEIIDSACQVTNGSNPLDVQLGKVSKTLFTGTGSTSTATKFDIQLTNCPETV-TSAAVNFGGTPDADNNSTLALTRDADAATGVAIQLLDTAGQPVSLYTPSRQYPLTAGSTNDLEFGARYIQTQAAVTAGPANSVSTFTIIY. 177
461 7.000e-42gi|505189260|ref|WP_015376362.1| fimbrial protein MrfG [Serratia marcescens]  clstr ali  23  1MKKTALAMALLCMSHTGWGAPPTVA------VNYRGELVAEPCVIPPGEENIELDFGTVIDKYLYLN-QRTAGKAFSLQLTECDLSLGETVSVSFSGTESAALPGLLAI--SSGGASGIAIGLENVSGELLPLNQPSGK-LRLQEGSNRITLKAYVRGEPEAIKRGEFVSTATFLLDY. 173
462 7.000e-42gi|555087242|gb|ESM30402.1| hypothetical protein L402_03898 [Enterobacter cloacae BWH 31]  clstr ali  29  15MKAKKIALAIAMIAGAMIA-NANAKDQGHGTVTFTGSIIDAPCSITPDSADQTVDLGQISNLALEDGG-TSIPQAFAIKLQQCDXXXXXXXXXXFSGTASAANPDLLGIQ---GTAKGASVAITTDTGTPIKLGQASPAQALL-NGDNDLTFAAFLKGDGASAT............... 172
463 8.000e-42gi|676310966|gb|AIM23422.1| fimbrial protein domain-containing protein [Serratia sp. SCBI]  clstr ali  21  1MKKNLLAVAVLTA-----SAFTTSVFAADGALNITGTITDQSCTVDPDSQNKQVALGKIAKDAFPNAGATAGAKAFNLILKNCPDTVTG-ATVRFDGTQVQGQSGLLKLTGTPGVAGGIGVQLLDDGSNVLNIGNDSRVYALAENKDNVLGFVARYFAY-DTVSVGSANATANFTIVY. 173
464 8.000e-42gi|490366214|ref|WP_004245878.1| fimbrial protein [Proteus mirabilis]  clstr ali  24  1MKKLLLSAIITSAMAIIATPAPTEVTVNGGTINFEGSVVNAACGVDSSSSNQTVRLGQFRVAEFTKKGDETGRIPFSIKLNNCDITVSSLAAITFNGTASDGDATAFALQ-GSGAATNVALKITDSSSKNVVPGQPSSTQ-KLIEGENQLNYNASLISTDDTVKAGSANVTTNFMVTY. 185
465 8.000e-42gi|493543121|ref|WP_006496982.1| fimbrial protein [Burkholderia cenocepacia]  clstr ali  23  1.MKNLKRSAIPFLLVAAGVAFSSAAHASDGTINFNGKVIASTCSVEGGS-DLTVPLPPVSTTALAEVGSVAARSAFSLALKGCTTGDDNPVKVFENGTNVDRSSGRLTIDAGDKAAEGVQINVLDDQQKLVPIGAQTPASTQLSDGTAKLDYFAEYYASGA-VKAGDVNSRVEYSLIY. 182
466 8.000e-42gi|658501182|ref|WP_029697843.1| fimbrial protein [Cronobacter pulveris]  clstr ali  23  1..MNKILLAALALV------FSAGASAAEDNVHFSGALVSEPCTLPDADTDIRLDFGSVIEKYLYQY-QRTKPQPFSIHLQECDPSIMSTVSVTFQGTVDTELTELLAPDAAS-TAKGVAIGLELTDGTPLAINKAS-PYTQLSSGNNTLTFNAYVQAANKTLAAGDFTATANFVLAY. 172
467 8.000e-42gi|491328914|ref|WP_005186875.1| fimbrial protein [Yersinia intermedia]  clstr ali  28  1MSNFKKSAFIIALASSAFISQAFAADEGNGRIHFTGTVINAPCSIAPNSTDISVDLGQVANKVLETGNKYSQNVQYSIDLQDCDLTAMSKVSVTFGGVSDATSPALLAN---TGSAGGAGIRLIDTNGALLKVGDTGAD-VNLVTGPNQIVFAARVEATGAPVTTGTIVSQATYALNY. 184
468 8.000e-42gi|583251626|ref|WP_024157766.1| long polar fimbrial protein LpfA [Salmonella enterica]  clstr ali  28  1MKK----VVFALSALAVVSTSAFAAESGDGTIKFTGEIVDAPCVVSTDSQNQEVVLGQVKKNIFKAIGDKSSSKPFQIKLEDCDITSNTKVNVSFNG---------------------VGIGIYDNANKLVEMNT-GKSTTTLAAGQTVLYYTANYVATKDTVTTGYGNAEVDFNLSY. 152
469 9.000e-42gi|674724062|gb|KFK94090.1| ferrous iron transporter B [Serratia sp. Ag2]  clstr ali  28  1MKKNII----VATLVAAAAMTTASTFAADGQVNFSGSVIDASCNVNATSGSLNVVLGQVSKSAFTAAGTKAAPTKFTLQVSNCPDSVS-SVGVKFDGTTVAGDNSVLALTQGTGVATGVGIQLSDASQNVLPLNTASINY-PLTAGAANLDFVARYISTAATVTAGPANAIANFSIIY. 173
470 9.000e-42gi|525768400|ref|WP_020825903.1| hypothetical protein [Serratia liquefaciens]  clstr ali  23  1MKLNKIMLAAVMAMG-VSSFAANAVDAGHGKVTFKGSIIDAPCSIDPDSIDQTVQLGQISNVALKDGGS-SSPKNFEIRLENCTLSTAKTVTTTFTGA--KGVNGL----GITGTAKGASIVITDGKGAAIELGKATDAQG-IQDGKNTLSFSAYLKGDGKTVVPGDFTGIADFTLAYL 177
471 1.000e-41gi|668975027|gb|KFC89920.1| type-1 fimbrial protein [Hafnia alvei ATCC 13337]  clstr ali  26  1MKSNTGVFHYGLLTLMMASGTCLASDDGKGTINIMGDIHNNTCVVDT--TELNVDMGNVATKQFYQTGNVPRPVLFNIALKDCGPDVSG-VAVKFTGESAAANSPLLKLDASAGAATGVGISLMDKNKTQIAINDSSKIYPLTASQTARLDFYAQYSAYTLPITAGPASASVIFTMTY. 176
472 1.000e-41gi|491329003|ref|WP_005186964.1| fimbrial subunit type 1 [Yersinia intermedia]  clstr ali  27  1MKSKLIALSIMIVSGSTLSV----ANAADGTINFTGNIIDPACTVNPASASQTIALGTVSSNALATSGATAAPTAFSIALTDC--AVAGNVSVKFDGTHNTSNPDLLAITSGAGVATNVGIALYEQDGTQIPLNTASAAKPIVGTGTATLNYIAKYMATGQS-TAGIADGVTQFSVIY. 175
473 1.000e-41gi|648450746|ref|WP_026142497.1| fimbrial protein [Serratia sp. S4]  clstr ali  28  1MKKS----LLVLMMTGSVMAGANMAHAADGTVKFTGNIIADACTVDTASKDQTVVLGDVSTKAFAAAGDKASPTKFKIRLTTCPTSL-TSVTVKFDGVSDSANTNLLKLDS-AQTATAVGIEIADNNGVPIPLHTASPTYPIAADHTADLTFVGRYXXXXXXXXXXXXNGTSQFTINY. 172
474 1.000e-41gi|575544076|gb|ETX44495.1| hypothetical protein P805_01832 [Serratia marcescens BIDMC 44]  clstr ali  20  28...............VATPLSAMAAGENENNVHLYGALVAEPCVVPPGDEEIHLDFGTIIDKYLYLN-TRTLGQQFEIRLAECDLTLGNTVKVTFMGTENRALPGLLAID-GSSEATGIAVGLETTEAQPLPINKESGEYV-LQEGSNNIVLKAYVQGESKAIEAGPFNAVATFNLEY. 192
475 1.000e-41gi|489927786|ref|WP_003831118.1| adhesin [Citrobacter freundii]  clstr ali  22  11......ALLVMLPILIFSSLCHAASSLGEINIELRGNVVDFTCAVIASDSNKSVELGTWPTKQLQTSGDTTQPVAFTLKLEGCPP---GSASITFSGTPAPG-TTLLALDDAV-MAQKVAIELHDSDRTRLPLEQASQTVGIDENGNATLTFFANYIALADGVQPGLARADATFMINY. 177
476 1.000e-41gi|666605657|emb|CDH26929.1| putative fimbrial-like adhesin protein [Xenorhabdus bovienii str. Jollieti]  clstr ali  20  8.KMKLLKLFIAAVISGSM---AAPAFAADGTINFNGRITKATCTVSALTDN-SVNLPEVGATALAGKGTTGGETLFRIGLENCGIGGSANVQVKFGGVKDSIDGNLLRINSESGGAKGVGIGIYEKDGTPINMGALSKGIPVVSPAT-TLEFKAKYVATEATVTPGTVKASTDFTLDY. 181
477 1.000e-41gi|559235503|ref|WP_023583053.1| fimbrial subunit [Proteus hauseri]  clstr ali  26  20..........................AYDTLVQIHARVTGNTCTVETNSENITVKLGDIATKDFTSTAQRTPIIPFSIKLVDCQPEAS-AVKVSFNGAGDLSDNTLLAINN--NGAKGVAISIMDKSGISIPINDKSQSYPLLPNQDNTLQFYARYVATQVPVSAGQANATTTFLLEY. 171
478 1.000e-41gi|493711471|ref|WP_006661102.1| hypothetical protein [Providencia alcalifaciens]  clstr ali  23  23.........VFFSSILTSLLLCTSAFAADSTIIIKGNVKDNTCAVAPGSQNQVVDLLLNAVKQLHSVGEVTPTVPFRIELTPCGSAV-TAVKVGFVGIADLNNKSLLAIEPGSSNATGAGIQILDSAKNPLVLNADSNNWTPLVAGANTLNFNARLMASKLPVTAGHIRATATFTLE.. 192
479 1.000e-41gi|491065587|ref|WP_004927218.1| fimbrial protein [Providencia stuartii]  clstr ali  25  1MKK----IILATLISGAMSASAFAVDAGKGTVTFTGSIIEAPCSIAPGDESQTIDLGQVSNVTLQKGGM-SAAQPFEIHLEGCTLNANNMVEVKFEGTEWVNNGSNTGLIQITGDASGAGIVLMNKSGAKININD-STVERAYTSGNNILSFQAALQGMSATVVPGSFQAVTNFTLAY. 185
480 1.000e-41gi|497321245|ref|WP_009635458.1| type-1 fimbrial protein subunit A [Serratia sp. M24T3]  clstr ali  25  1MKYKTIALSVVASLSLVAXXXXXXXXXXXXXXHFTGQFVNAACAVSTDTADQTINLGQYRTASITAAGQTTTNIPFNIKLVNCDTTVATAASIAFTGTPDEDNSTLFAVNAGSTAASGVGIQLLDSASNDLPPGTTYSVAKTLTDGDNTIPFTARYKSTAATVTAGQADADATFVIQY. 188
481 1.000e-41gi|503130079|ref|WP_013364740.1| fimbrial protein [Enterobacter lignolyticus]  clstr ali  24  3.NKTLLAAVTATLMVGASFNASADDNQGSGKITFTGEVISAPCSIAPGDEDQTIKLGEVADTVLNTAGQYSLPVPVTIHLQDCGTNTIDKVKVTFTSPGDATDPNLMKNTGNVGGASGVGVRLLDAGSNKVTLGTPVTVAFTTTNAYQELNFQARMESLTNNATPGNLKAQANYVLDY. 186
482 1.000e-41gi|640699627|ref|WP_025123593.1| MULTISPECIES: ferrous iron transporter B [Serratia]  clstr ali  25  1MKKNLIAVAVL-----XXXXXXXXXXXXDGQVNFTGEIIDSACVVNTPSNPLNVVLGKVAKTAFTGTGSTAAATKFTLQLTNCPATV-NTASVKFDGTSVNGDTTLLALTQESGVATGVGIQLADASNTVLPLYAASMAYPLVSTATNNLDFVARYIATAATVTAGPANSMASFTVNY. 174
483 1.000e-41gi|491484498|ref|WP_005342239.1| hypothetical protein [Aeromonas veronii]  clstr ali  28  1MKKAIVASVLLAVFSGASSATPAATDQGHGVIKFIGAIVDAPCSIAPESVDQTINMGQISNSVLEHQGE-GPLRPFDIHLEGCSLDTAKTAAITFNGIPDDTEKKHLAIN---GFAKGAAIAISQLDGSEVVLGTPTKAAT-LVEGDNHLKFGAKLVSDGGKAIPGEFSATTDFIMTY. 183
484 1.000e-41gi|502671232|ref|WP_012907058.1| fimbrial protein FimF [Citrobacter rodentium]  clstr ali  26  16.....................AADAFAADSTITISGYVRDNACAVAGESKDFSVDLLNNAAKQFSTVGATSPTVPFRIVLSPCGSAV-TAVKVSFVGTADNDNSHLLKLDGGALAASGMGVQILNDRQTALPLNAAASPWTTLTPGKNTLNFYARLMATRVPVTPGHVNATATFTLE.. 173
485 1.000e-41gi|501411001|ref|WP_012442567.1| fimbrial protein FimF [Erwinia tasmaniensis]  clstr ali  25  5...........VSILCLLSVFAGNTHAADSTITITGYLKDNACSVAVDSQNFTVDLMSNAGRQLYRPGAVTPAVPFTIVFDKCGSS-ATAVRVGYTGISDGDNATLLKLDAVSNAASGMGIQILDKDKDPVSLNSATLNWTTLTAGANTLGFYARLMATRSPVTAGIVNATANFTLE.. 172
486 1.000e-41gi|506434072|ref|WP_015953789.1| fimbrial minor structural subunit [Escherichia fergusonii]  clstr ali  23  4MNILQKFILLIFTSLSMMVISCDALANDTVVVTFTGQLLAKTCDITAGSKDQPVNMGTYDANDFLNVGDVSDSHTFTINLEGCPTTTSTSANVQFTGDADAINTTLLRLTSSADSATGVGIEILDSNDKIIAINSESKELILNNNGDASLTFKLRYKSTQQNVHAGQANALLYFDIDY. 189
487 2.000e-41gi|503130002|ref|WP_013364663.1| fimbrial protein BcfE [Enterobacter lignolyticus]  clstr ali  25  5..........VLSGLWLCGAFAAHADDGSYNLKLTGTIVAETCNVDASSETQTVRLGQFSTADFPTVGSTSRSAPLPITLTGCTQNITGG-QVWFTGTADSDDPSLLALSDTAQMATGVAVQILDGSQSPVSINNTHSAVYPLHAGDNVLTFNLRYMSTKSQVTAGNATAVMYFDLQY. 176
488 2.000e-41gi|431042959|gb|ELD53444.1| fimbrial-like adhesin protein [Escherichia coli KTE224]  clstr ali  24  85......................HGAGQSSRTWEISGRVLDYGCTVSSDSLNFTVDLQKNSARQFPTTGSTSPVVPFQITLSECSKGTTG-VRVAFNGIEDAENNTLLKLDEGSNTASGLGIEILDGNMRPVKLNDAGMQWIPLVEQNNILPYSARLKSTQKSVNPGLVSASATFTLE.. 241
489 2.000e-41gi|639138676|ref|WP_024484129.1| exotoxin [Serratia fonticola]  clstr ali  24  1MRQILRSLCATVALLALSQGVQAA------KMRLHGTLVAEPCIIPPGEETIQLDFGTVIDKHLYHN-QRTSSREFKLHLSNCDQTLGKSVQVTFTGVENPALPGLLALDASSQ-ASGIGIGVETENGNSVPLNQLGTHRYPLATGDNYLRMMAYVQGEPDAITRGPFSASMTFALTY. 175
490 2.000e-41gi|546165539|ref|WP_021807390.1| type 1 fimbriae major subunit FimA [Serratia fonticola]  clstr ali  27  1MKINKLAIALSILALNSTSVLAAEAGANGGKVYFKGEVINAACAVDAGSIDQTVQLGQVRSAKLAKAGDTSPAVGFNIQLNDCDTAVSTKASIAFSGTADSTNTTVLATQSTSGGAKNIGVQILDKTGSPLVLGSTFSTAMALNDGSTAVPLQARFYATGAA-TAGTVSADASFKVQY. 186
491 2.000e-41gi|639222885|ref|WP_024560226.1| hypothetical protein [Cronobacter pulveris]  clstr ali  27  1MKK----ISIVSLALLAFMANSAVCNASDGKITFTGKVIAEGCDVDTADQNKSVALGTVAATQFAAAGDKSPLIPFTLKLSECPEAVTK-VAIRFDGTPNSTNAKLLALDA-DQTATGLGIEISDDAGTAIDLATNSKTYTVDT--TAELKFGARYVSTG-TVGAGTANGTSQFTVIY. 169
492 2.000e-41gi|506490297|ref|WP_015965675.1| P pilus assembly protein, pilin FimA [Enterobacteriaceae bacterium strain FGI 57]  clstr ali  23  1MNKKLLPIAALII-----SASAMNAYAVNGKVNFTGEIIESTCTVTSGDQNKDVFIGKYPTSAFATKGDVTASKAFTINLEKCEAGDY---SLRFDGPSVAGNPNLLSVDQ----AGGVGIEILTNDEKVIPINQASSPWVNVATGTATFNLKARYKSFLDKVTAGSANASATFTIEY. 174
493 2.000e-41gi|488365312|ref|WP_002434697.1| fimbrial protein [Escherichia hermannii]  clstr ali  23  4.........VVALFISLTSLFIMPCFASDGVINFSGKITDQSCEIDTQASTLNVNLGSYSISQFGSVGVTSLPIPFTIKLKNCPNTEEIRFNVALSGVSEPTNPDYLKIND--GGAQGVAIVIKDKDGAVVPINKTSPTVYDIPDVEMELKFTAYYISTSSLVKPGDANSTTDITLVY. 172
494 2.000e-41gi|30524677|emb|CAC85333.1| PixA protein [Escherichia coli]  clstr ali  21  1....MLKSTLGIAIAFSLCAVAHAANQGQGVVNFKGTVIDAPCGIDPDSADQTIDFGQISKSHLDADG-ISVKKDLNIKLVNCEPN--KSVKVTFSGATIASAANELGTVGDTGTA----VVISGQDGKLVSFGTEGSAQ-SLQEGENTLHYSSWVKATGGTVKEGDFTAVANFNLSY. 167
495 2.000e-41gi|668960376|gb|KFC77924.1| fimbrial protein [Ewingella americana ATCC 33852]  clstr ali  28  6.KKALIVALSAVISASAFAAAPTGADQGSGRIHFTGTVINAPCSIAAGDEDINVNMGQVANKVLESGNKYSQNVNYTIHLQDCDLTAQTKVAVSFAGTPDSSLSELLAN---TGSAKGAAIRLIDSNGDLLKVGDTSKD-INLVTGNNELVFAARVEANNQPVSTGTIVSQATYALNY. 192
496 2.000e-41gi|666375283|gb|KEY45236.1| hypothetical protein DQ02_22265 [Citrobacter amalonaticus]  clstr ali  27  1..MSNKFFAVAVMSMSVVMGMSTAQANNDGTVNFTGEIIGTACTVDIGANNMNVDLGKVSKTVFTGTGTYASATEFDLKVKDCPATGINGITVKFDGTAYAGDNSVLALTEEDGVATGIAIELLDKSKKAVPLFTDSDSYA-LEAGKTTMPMYARYKQVAAAVTAGPANSSVQFTLNY. 178
497 2.000e-41gi|666375305|gb|KEY45258.1| fimbrial protein [Citrobacter amalonaticus]  clstr ali  24  1..MHRITMVFAGLLTALAPAPVWAGELLGGDLSFTGVVMAYPCSIAPDSERVPVDFGKVSTKSLYINGKT-VPVPFTIKLEDCTPSVFDSVTVTFSGTANGNLADRLAISATSGNAGGVGIGLLEEDDTPVRLNVATRPAA-ISDTTLRLNFQAFVEAEPDTLTTGPFTATANYTLNY. 181
498 2.000e-41gi|639216724|ref|WP_024554437.1| ferrous iron transporter B [Cronobacter helveticus]  clstr ali  26  1MKK----IVIXXXXXXXXXXXXXXXXXHDGTVKFTGEILDQACTVNIGTDNLTVDLGKVAKTAFTGVGTEASTTKFTIKLKDCPAS-ATSAKVKFDGANDPSDSSLLALDNVTDVAKGVAIKLMTADKAALGLNENSYSYALSSTVENNLDFYAAYRSTAATVEAGKANAVANFTVNY. 175
499 2.000e-41gi|693043814|ref|WP_032214676.1| hypothetical protein [Escherichia coli]  clstr ali  24  1...MKFTPQIILASALCFTPLSVLADGEQTTITINGYIVDNTCVVSEESLKIPVDLQTNNAKDFFRVGTTGPAQPFSIILAPCGQQVGD-VKVQFSGVADDTNTDLLKINSGNGTASGVGIELLDNQQQQIALNSSSLTAVSLVPGTNTLTYYARLMSTHYPVGAGAVSATATFTLEY. 177
500 2.000e-41gi|490386717|ref|WP_004266214.1| exported pilin protein [Providencia rettgeri]  clstr ali  25  37.............................GEIKIRGQLVAEACTVRPGDENIIVDFGTIVNKYLY-INQKTPLENFNIHLDDCDNSIFRTVTVKFTGSENTHLPGLLALDSGS-MASGIGIEILEFSGKKIPINSTTPAY-NLENGTNILSFNANVQGEPDAIKNGHFTATAIFSLIY. 187
501 2.000e-41gi|695707974|ref|WP_032642235.1| hypothetical protein [Enterobacter cloacae]  clstr ali  26  1MKPIIFWIVATVYTGFAFCL---PVQAHDGTVYINGKINQRTCTVATDSQALLVKMGNVQRNQFTQVGDSSYYESFTINLENCQGS-KQNMSISFEGAPDKSNPSLLALTPDAASATGIGIGIYNQDKTLIPMGKPSSTLTPAQASDTAFIFFARYVSTVTDVTTGTANASTTFIVNY. 175
502 3.000e-41gi|668993756|gb|KFD05464.1| fimbrial subunit [Kluyvera ascorbata ATCC 33433]  clstr ali  23  6............LCLFLMSTLSLAAMAHDGTVNITGSIYASSCDVDSNSQTKNIRIGDFAANSFSSVGDVQGNALLSITLNNCTAEIAGGA-ITFSGDADTDNTTLLALSDTSGGASGVGVEVLDKDGGQIPLNSQSKPFA-LSEGDNTLTFYLRYMATKIPVTAGNASSVMYFDLSY. 172
503 3.000e-41gi|493713911|ref|WP_006663493.1| fimbrial protein BcfA [Providencia alcalifaciens]  clstr ali  24  1MNINKKIAMLSVVISSIICSAAFAENVNGGNITFNGEVTSGPCAVSSADTDKIVTLDTVKSTVFTAADQLAASKPFNINLLECDTDVRKSVQVTFNGQTVEGKPGLLANTAGVGSAKNVALQLFNPDGSALDIGALSSKVNL--AETTTIPLSVDYKSTAAAVTAGKVQSVANFTLTY. 184
504 3.000e-41gi|491063641|ref|WP_004925273.1| fimbrial protein [Providencia stuartii]  clstr ali  25  1MKK----IILATLISGAMSASALAGDAGSGTVTFNGSIIEAPCSIAPGNENQTVELGQVSNVTLAAGGE-SSAQPFSIKLEGCNLENNNQVTVIFSGAAVDGEAANTGLLQISGDAAGAAVKIMNSSNTQIKINDNDGYTRNYVQGNNELKFQAALKGLGATVVPGNFSAVTNFTLAY. 177
505 3.000e-41gi|518240380|ref|WP_019410588.1| hypothetical protein [Pseudomonas psychrophila]  clstr ali  23  4.KLKTRANRPILLALMLMPFMMSKQVQAADNLNFIGNLVAVPCTLRPGDDAVTLDMSEISTHYLYAN-SRTIGKQFNIHLEGCDTSIADSVTTTFSGTPSPALPGLLALD-GSSVAEGIALGIETSANLPLPLNTPSEAHT-LIDGNNIIAFKAYVRGEPQAIVAGVFTAVSTFKLDY. 182
506 3.000e-41gi|491425810|ref|WP_005283605.1| type-1 fimbrial protein subunit [Edwardsiella tarda]  clstr ali  22  1..MKKILLPVMALSASVMSG---QVSAANGTVNFTGEIINSTCQVSGDSKNIDVYLGKYPTSAFKAIGDKSASKAFQINLEQCEPGTY---TVRFDGNTVAGHPDLLAVDGSTAAAQGLGIEITDINGKHFAINKATPTVKVVGDKKAVFNLQARYRSYADTVTAGLANATSPFTIEY. 176
507 3.000e-41gi|559224960|ref|WP_023581052.1| fimbrial subunit [Proteus hauseri]  clstr ali  23  1MKLKTLPLPVICGLTLLIGIFS-AANAAPNNMRLYGTLVDEPCVIKPGDETISLEFGNVPDKTFYIGAGRTNSQNFQIHLSECDLSINKRVRVTFSGTENQAGQGFLALSTGSQ-AEGIAIGLENSDGSPLRINQETSN-IALNSGDSILRFRAFIQAEPNAIKRGRFSAIATFHLNY. 182
508 3.000e-41gi|503577744|ref|WP_013811820.1| MULTISPECIES: type-1 fimbrial protein subunit A [Serratia]  clstr ali  26  1MNFKLIPLALISALTLGAAMNASAATVNGGTVHFKGDVVNAACAVNTNSFDQTVHLGQVRTAKLAKDGDKSTPVGFNIELNDCDTTVSSTASILFDGVSVSGKPTVLALQSSAGSATNVGVQILDSTGTPVMVGSAASTAYTLSDGTNKIPFQAAYY...................... 160
509 3.000e-41gi|669019632|emb|CDS57103.1| Fimbria A protein [Serratia symbiotica]  clstr ali  25  1MKLNNRSAAVVLGFVLXXXXXXXXXXQGQGTVTFKGSVIDSPCSITSETANQTVDMGQISNSALKKAG