current user: public

anford Burnham Prebys Medical Discovery Institute

Query: VFG000865(gi:387604907) (aap/aspU) Dispersin [Dispersin (VF0215)] [Escherichia coli O44:H18 042], from VFDB

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
3 8.000e-39gi|477009075|gb|ENC94667.1| hypothetical protein ECP030230811_5241 [Escherichia coli P0302308.11]  clstr ali  25  1MKKLFFAF--PLVISSFSTFAGGGSEWQPTVSPGQCIEYTEIGETKWNDTDSCNEVVRRGYASGVMVSGKVFYDGAPSISYTGHVAPNKPYARQAPLYNDGKKKWGHGDSYTYWAR 117
9 3.000e-30gi|167744833|pdb|2JVU|A Chain A, Solution Structure Of Dispersin From Enteroaggregative Escherichia Coli  clstr ali model  100  1.....................GGSGWNADNVDPSQCIKQSGVQYTYNSGVSVCMQGLNEGKVRGVSVSGVFYYNDGTTSNFKGVVTPSTPVNTNQDINKTNKVGVQKYRALTEWV. 94
12 8.000e-29gi|739095862|ref|WP_036966678.1| hypothetical protein [Providencia alcalifaciens]  clstr ali  20  3....KYILGIILTMGSFSALAGGA--WQPSVGPGECISFGEIGGYKWVSSDGCNEVINRGHALGVGLERRVNYANGDYVSSAGVISPNRDYVIKGSTSSNGSPKVSTGGSSPYWYK 116
13 1.000e-27gi|331071104|gb|EGI42462.1| protein CexE (CfaD-dependent expression extracytoplasmicprotein) [Escherichia coli TA280]  clstr ali  25  1............MCASFSAVAGGGGSWQPSVTPGQCVLNVPAPGVKWNNTQACNEVISRGYAASVYVSGLFIYEGGQTRRYSGNVAPGHDHYFSEPKEIDGKKFSSLGQTNYQWV. 107
15 1.000e-25gi|282947570|emb|CBG87124.1| putative exported virulence protein [Citrobacter rodentium ICC168]  clstr ali  27  1MKLIGKFIGFAIMTISFYSFAGGGASWIPNVAPSACVNIDESRISFWNNNPECEKAISSGYASGVRIMGSASYPDTTIAQFNKVLKRNMSLTI....................... 96
16 3.000e-24gi|331071098|gb|EGI42456.1| conserved hypothetical protein [Escherichia coli TA280]  clstr ali  25  1...MKKFILLTALIISPFTYAGGT--SMPSVEPAMCIKKTYSWNTFWDGSDECNEVVDKGYAKGVHYSGVFVSSNEEEIPLDGYITPYQSY---EPSSIKGKELKTLITSKIQW.. 110
18 5.000e-18gi|486105340|emb|CCV37074.1| hypothetical exported protein [Yersinia enterocolitica (type O:9) str. YE56/03]  clstr ali  22  1MKLTGKFIGFVIMTIXXXXXXXXXXXWKPSVDPSACVNINETPSTWWNANPECEKAISSGYASGIRIMGTVSYPESTISQFNKVLKPNMSLTI....................... 105
19 4.000e-06gi|632181630|gb|KDA76153.1| hypothetical protein AC13_5603 [Escherichia coli 2-011-08_S3_C2]  clstr ali  46  1MKKTAFALG--LFDVSLNTFAGNNGWNADAVPPKQCIIVTGSGSVSVSGD.................................................................. 49

FFAS is supported by the NIH grant R01-GM087218-01
9 5 5 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Dunbrack RL Jr, Dunker K, Godzik A. Protein structure prediction in biology and medicine. Pac Symp Biocomput. 2000;(12):93-4.