current user: public




vfdb.0000004
Query: VFG1643 (gi:11322961) sfaD - SfaD protein [Escherichia coli 536], from VFDB

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# E-value Template Links and tools%idFirst MKISKMAVMLFLLPPAALAGNHWHVMLPGGNMRFQGKIIAEACSLALSDRQMTVDMGQLSSNRFHAAGEYGDPVGFDIHLQDCSTVVSQRVGISFYGVSDIHEPELLSVEEENDASDGIAIALFNESGELVKLNQPPENWVHLTRGDMKLHMQARYKATHYPVAGGKANGQVWFSLTYLLast
1 3.000e-63gi|485690730|ref|WP_001324733.1| fimbrial protein, partial [Escherichia coli]  clstr ali  55  53MKRKRLFLLASLLPMFALAGNKWNTTLPGGNMQFQGVIIAETCRIEAGDKQMTVNMGQISSNRFHAVGEDSAPVPFVIHLRECSTVVSERVGVAFHGVADGKNPDVLSVGEGPGIATNIGVALFDDEGNLVPINRPPANWKRLYSGSTSLHFIAKYRATGRRVTGGIANAQAWFSLTY. 230
2 6.000e-62gi|502671229|ref|WP_012907055.1| fimbrin fimI [Citrobacter rodentium]  clstr ali  57  1MQRMKACLLLLLSPACALAGNKWNVTLPGGNMRFQGVIIAESCRIEAGDRQMTVQMGQISSQRFHAPGEDASPVPFDIHLQECSTAVSQRVGIAFHGVADGKNPDVLSVGEGPGIATGVGIALFDKDGDLLPLNHPPVSWTRLYAGPTTLHFVAKYRATGHQVTGGLANAQAWFSLTY. 178
3 9.000e-61T2D.3937626 [KEGG:K07351] fimbrial protein;|[COG3539] P pilus assembly protein, pilin FimA  ali  57  1MQGVKTGLLMFLFPPLALAGNHWNVTVAGGNMRFQGVIIAESCRVEAGDQQMTVNMGQISSNRFHSAGEDANPVPFDIHLQDCSTAVSQHVGVSFRGVADGKNPDVLSVGEGPGIATGVGIALFDNEDQLIPLNSPPGAWRRLYTGPTTLHFVAKYRATGNQVTGGAANAQVWFSLTY. 178
4 1.000e-60gi|501411004|ref|WP_012442570.1| fimbrin fimI [Erwinia tasmaniensis]  clstr ali  51  1MLKIRLGLFLMLLAPLSMAGNKWNVTLPGGQMRFQGELIAEACTVDIGDRQLIVHMGQVSSNRFKAVGDDADPVPFTLHLQDCNTNVSERVGIVFHGVADGKNPDVLSVGEGEGTATGVGIALFDDTGKMIPVNSVPQAWKPLVNGARELQFVARYRATGHAVNGGKADAQAWFSLTY. 178
5 4.000e-60gi|491005570|ref|WP_004867290.1| fimbrin fimI [Klebsiella oxytoca]  clstr ali  57  4MQGMKSGLLFFLLSPLALAGNQWNVTLPGGNMRFQGVIIAESCRVEAGDQQLTVNMGQISSNRFHSPGEDTDPVPFDIHLQDCSTAVSQRVGVAFHGVADGKNPDVLSVGEGPGIATGIGVALFDKEDRLIPLNSPPGAWSRLYTGPTTLHFVAKYRATGHQVTGGAANAQAWFSLTY. 181
6 7.000e-60gi|490992227|ref|WP_004853960.1| MULTISPECIES: fimbrin fimI [Klebsiella]  clstr ali  55  1MHKMRSALFIFLLPTLALAGNRWNVTLPGGNMRFQGEIIAESCRVEAGDRQMVVTMGQIASNRFHATGEDAISVPFDIHLQECNTAVSQHVGVAFTGVADGKNPDVLSVGEGPGIATGIGIALFDKDNSLIPLNQPPRRWMQIYTGPTTLHFVAKYRATGKQVTGGVANAQASFSLTY. 178
7 9.000e-60gi|495729743|ref|WP_008454322.1| fimbrin fimI [Enterobacter sp. Ag1]  clstr ali  53  1MRGIKLILLSVLLPSLALAGNRTHVMLPGGNMRFQGTIVAESCRVEAGDRQMTVEMGRISSNRFHAPGEDSDPVPFALHLQDCNTNVSRHVGVAFMGVADGKNPAVLSVGEGPGIAEGVGVALFDAEERQIPLNAPAKAWTRIYAGPNTLHFIAKYRATGHQVTGGLANAQAWFSLTYL 179
8 3.000e-59gi|499797417|ref|WP_011478151.1| fimbrin fimI [Escherichia coli]  clstr ali  98  4MKISKMAVMLFLLSPAALAGNHWHVMLPGGNMRFQGKIIAEACSLALSDRQMTVDMGQLSSNRFHAAGEYGDPVGFDIHLQDCSTVVSQRVGISFYGVSDIHEPELLSVEEENDASDGIAIALFNESGELVKLNQPPENWVHLTRGDMKLHMQARYKATHYPVTGGKANGQVWFSLTYL 182
9 3.000e-59CGD_mc16a.204387 FOM5TJD02R7WBU|FOM5TJD02R7WBU|metagene|gene_2  ali  95  1.........................................................................VGFDIHLQDCSTVVSQRVGISFYGVSDIHEPELLSVDEENDASDGIAIALFNESGELVKLNQPPENWVHLTRGDMKLHMQARYKATHYPVDRGKG........... 95
10 5.000e-59gi|562747209|ref|WP_023654324.1| Fimbrin-like protein fimI [Erwinia piriflorinigrans]  clstr ali  50  1MLKIRLGLFLMALAPLSIAGNKWNSTLPGGQMRFQGELIAEACTVEAGDRQLTVYMGQVSSNRFSAAGDLADPVPFVLHLQDCNPNVSERVGIEFHGVADGKNPDVLSVGEGEGIATGVGIALFDDNGQIIPINSVPQAWRPLIHGSRVLQFVAKYRATGNLVTGGAANAQAWFSLTY. 178
11 9.000e-59gi|550552343|ref|WP_022631439.1| fimbrin fimI [Klebsiella pneumoniae]  clstr ali  56  1MQGMKTGFLMFLLPPLALAGDHWNVMVAGGSLQFHGVIIAESCRVEVGDQQMTVNMGQVSSNRFHSTGEDASPVPFDIHLQDCSTKVSQQVGVSFRGVADGKNPDVLSVGEGPGIATGIGIAFFNKEDQLIPLNGPPSLWQRLYTGPTTLHFVAKYRATGKQVTGGMANAQVWFSLTY. 178
12 1.000e-58T2D.2691342 [KEGG:K07351] fimbrial protein;|[COG3539] P pilus assembly protein, pilin FimA  ali  96  1MKISKMAIMLFLLSPAALAGNHWHVMLPGGNMRFQGKIIAEACSLALSDRQMTVDMGQLSSNRFHAAGEYGDSVGFDIHLQGCSTVVSQRVGISFYGVSDIHEPELLSVDEENDASDGIAIALFNESGELVKLNQPPENWVHLTRGDMKLHMQARYKATHYPVTGGKANGQVWFSLTYL 179
13 7.000e-58gi|639192200|ref|WP_024531355.1| fimbrial protein [Serratia fonticola]  clstr ali  51  1MLKMQSAFFLMLLPPVVFAGNQWNVTVAGGNMRFQGEIIAEACRVEAGSHNMTVIMGQVSSNRFHAVGEDAGPTPFEINLLDCSTAVSQRVSVAFHGIADGKNPELLSVGEGNGVASGVGVAIFDEKNQLIPVNGPVRSWTTLNDGPLSVHFVAKYRATGHTVTGGAANAEAWFSLTY. 179
14 2.000e-56METAHIT MH0079 GL0050813 [Lack 5`-end] locus=C2072638_1:1:522:+  ali  56  1......FLLASLLPMFALAGNKWNTTLPGGNMQFQGVIIAETCRIEAGDKQMTVNMGQISSNRFHAAGEDSAPVPFVIHLRECSTVVSERVGVAFHGVADGKNPDVLSVGEGPGIATNIGVALFDDEGNLVPINRPPANWKRLYSGSTSLHFIAKYRATGRRVTGGIANAQAWFSLTY. 172
15 2.000e-56T2D.1363741 [KEGG:K07351] fimbrial protein;|[COG3539] P pilus assembly protein, pilin FimA  ali  56  1......FLLASLLPMFALAGNKWNTTLPGGNMQFQGVIIAETCRIEAGDKQMTVNMGQISSNRFHAAGEDSAPVPFVIHLRECSTVVSERVGVAFHGVADGKNPDVLSVGEGPGIATNIGVALFDDEGNLVPINRPPANWKRLYSGSTSLHFIAKYRATGRRVTGGIANAQAWFSLTY. 172
16 4.000e-56gi|490990598|ref|WP_004852331.1| fimbrin fimI [Klebsiella oxytoca]  clstr ali  56  1MQRMKSGXXXXXXXXXXXXGNQWDTMLPGGNMRFQGIVIAESCRVEVGDRQMTVKMGQISSNRFHSAGEDTNPVPFDIHLQECSTAVSQRVGVAFHGVADGKNPDVLSVGEGPGIATGIGVALFDNTGSQIPLNAPPGAWTQLHTGPTTLHFVAKYRSTGNQVTGGAANAQAWFSLTY. 178
17 9.000e-56gi|506355425|ref|WP_015875144.1| fimbrin fimI [Klebsiella pneumoniae]  clstr ali  55  52...................GNHWNVTLPGGSMRFQGLIMASSCRVEAGDRQMTVNLGQISSNRFHAVGEDSNPIPFAIHLQDCSTAVSQHVGVTFHGVADGKNPDVLSVGEGPGIASGIGIALFDSQGQQLPLNRPADRWISLYRGPTTLNFVAKYRATGRQVTGGAANAQAWFSLTY. 210
18 4.000e-55gi|515951823|ref|WP_017382406.1| ferrous iron transporter B [Enterobacter cloacae]  clstr ali  37  8.........ALLIAGTALFAVLPAAAKDDGSVTFQGQVVNAACSVSMDSQDQIVHMGQVRNSQFIAAGDWAKPVPFFITLEACDTSVSQRAGVLFSGESDGNDPQVFRAGYGPGAATGIGIGLFDAMGNLVKPDTAPPWYRPLQDGENRLSYIARYRATEDSVNAGTANAQVWFIVFY. 176
19 4.000e-55METAHIT V1 GL0046307 [Complete] locus=scaffold70519_2:4058:4591:+  ali  37  8.........ALLIAGTALFAVLPAAAKDDGSVTFQGQVVNAACSVSMDSQDQIVHMGQVRNSQFIAAGDWAKPVPFFITLEACDTSVSQRAGVLFSGESDGNDPQVFRAGYGPGAATGIGIGLFDAMGNLVKPDTAPPWYRPLQDGENRLSYIARYRATEDSVNAGTANAQVWFIVFY. 176
20 4.000e-55T2D.2154520 [KEGG:K07351] fimbrial protein;|[COG3539] P pilus assembly protein, pilin FimA  ali  37  8.........ALLIAGTALFAVLPAAAKDDGSVTFQGQVVNAACSVSMDSQDQIVHMGQVRNSQFIAAGDWAKPVPFFITLEACDTSVSQRAGVLFSGESDGNDPQVFRAGYGPGAATGIGIGLFDAMGNLVKPDTAPPWYRPLQDGENRLSYIARYRATEDSVNAGTANAQVWFIVFY. 176
21 4.000e-55JGI.Meta JGI_HUM.0743787 7045184430 C3784907__gene_310527 fimbrin-like protein fimI [Human Stool microbiome from visit number 1 of subject 158337416]  ali  56  1..............MFALAGNKWNTTLPGGNMQFQGVIIAETCRIEAGDKQMTVNMGQISSNRFHAVGEDSAPVPFVIHLRECSTVVSERVGVAFHGVADGKNPDVLSVGEGPGIATNIGVALFDDEGNLVPINRPPANWKRLYSGSTSLHFIAKYRATGRRVTGGIANAQAWFSLTY. 164
22 5.000e-55METAHIT MH0008 GL0036334 [Complete] locus=scaffold13109_10:18492:19028:+  ali  55  19...................GNHWNVTLPGGSMRFQGLIMASSCRVEAGDRQMTVNLGQISSNRFHAVGEDSNPIPFAIHLQDCSTAVSQHVGVTFHGVADGKNPDVLSVGEGPGIASGIGIALFDSQGQQLPLNRPADRWISLYRGPTTLNFVAKYRATGRQVTGGAANAQAWFSLTY. 177
23 5.000e-55T2D.2752616 [KEGG:K07351] fimbrial protein;|[COG3539] P pilus assembly protein, pilin FimA  ali  55  19...................GNHWNVTLPGGSMRFQGLIMASSCRVEAGDRQMTVNLGQISSNRFHAVGEDSNPIPFAIHLQDCSTAVSQHVGVTFHGVADGKNPDVLSVGEGPGIASGIGIALFDSQGQQLPLNRPADRWISLYRGPTTLNFVAKYRATGRQVTGGAANAQAWFSLTY. 177
24 8.000e-55gi|485714537|ref|WP_001346660.1| type-1 fimbrial protein subunit [Escherichia coli]  clstr ali  31  1MEFFMKKVIFALSALALTSGSVFAADSGDGTVKFTGEIVDAACVLSVDSQNQEVVLGQVQKSVFAAVGDKSPSKPFEIKLEDCDITTLKKAKVSFSGVGDTDKPELISVSTEAGAAKGVGIGIYDNSNTLVAMNS-GESSTDLKKGQTVLYFTANYVSTLAAVTTGYGNAQVDFNLSY. 177
25 1.000e-54METAHIT O2 GL0034456 [Complete] locus=scaffold11862_2:3688:4203:-  ali  97  1........MLFLLSPAALAGNHWHVMLPGGNMRFQGKIIAEACSLALSDRQMTVDMGQLSSNRFHAAGEYGDSVGFDIHLQGCSTVVSQRVGISFYGVSDIHEPELLSVDEENDASDGIAIALFNESGELVKLNQPPENWVHLTRGDMKLHMQARYKATHYPVTGGKANGQVWFSLTYL 171
26 2.000e-54gi|491095550|ref|WP_004957154.1| fimbria A protein [Serratia odorifera]  clstr ali  25  35MKLNKVMMAAVIAFGATSFAHAAVKDQGHGKVNFIGSIIDAPCSIAPESIDQTVDLGQVSNVALKDGG-TSNPRPFDIKLEQCDTTTLKSVSVTFTGTESTGNKDLLAI---AGTAKGAGIAIS-YDGKPITLGDATPSQNLNNN-NNTLHFAAYLQGEGAAVVPGDFTAVADFTLAY. 208
27 6.000e-54T2D.3697449 [KEGG:K07351] fimbrial protein;|[COG3539] P pilus assembly protein, pilin FimA  ali  31  1MEFFMKKVVFALTALALTSGSAFAAESGDGTVKFTGEIVDSPCVLSVDSQNQEVVLGQVQKSVFAAVGDKSPAKPFEIKLEDCDTTTMKKANVSFTGVGDADKSDLISVSTEAGAAKGVGIGIYDNSNTLVALNG-GKASVDLKTGQTVLYFTANYVSTLATVTTGYGNAQVDFNLSY. 177
28 4.000e-53gi|544752535|ref|WP_021179445.1| type 1 fimbriae protein FimI [Serratia fonticola]  clstr ali  47  30............................GGLMRFQGEVIAETCSVEAGDRNLTVSMGNITTDRFRMPGDEADPVPFDLHLQNCTSTVSRNVGVMFHGMADSNNPQVLSVGDGPGVASGVAVALFDDRGRFIPLNTAPRYWVPLQEGPVILHFVAKYRATGQPVNNGLANAQAWFALTY. 179
29 4.000e-53gi|546165487|ref|WP_021807339.1| type 1 fimbriae protein FimI [Serratia fonticola]  clstr ali  44  3.KKQLCAGIVLLLMASALAGDRHHVVIDGGITHFRGSLTAEACTVATDSQNQTVDMGQLRSNQFSGVGSLTSPVGFSIRLTECSTAVSDQVGVTFFGVTDGKDPLVLKAGEGVNAATGVGLALFDEQGQIIAPNTQPRVWSRLHEGDNSLRFHARYRATSRQVTGGNADVFTWFALTY. 181
30 6.000e-53gi|503993401|ref|WP_014227395.1| ferrous iron transporter B [Klebsiella oxytoca]  clstr ali  37  9..KAFSLAGAFLFPALAQAGNHHVVTVKGGDVEFQGAVVNAACAVDAGSEDLTVEMGQVRSNEFHGLGSWTDPQAFTITLKDCDTTVSQQVSVAFRGLTDGKDPGVLAVTDGAQSAQGVGLGIFDNQGNQIIPNTQPMNFTAIQDNTTVLNFVAKYRATSRTVVAGDANAQTWFTLTYL 185
31 8.000e-53gi|647322016|ref|WP_025759182.1| long polar fimbrial protein LpfA [Enterobacter cloacae]  clstr ali  27  1MKK----IIALFPVLAVMSSSVFAAASGDGTIKFTGEIVDSPCVISVDSQNQEVVLGQVKKSVFTAVGDKSSSRPFEIKLEECDISRKTKVNVSFSGIADETNDSLLSVNTEAGSASGVGIGIYDNANKLIDVNT-GKATTTLQAGQTVLYYTANYVATKAAVTTGYGNAEVDFNLTY. 173
32 3.000e-52gi|493711469|ref|WP_006661100.1| fimbrial subunit FimI [Providencia alcalifaciens]  clstr ali  42  1.MRELLAVSLLLFSPFLQAGNKWKVQLPGGGMRFQGELIAEGCTVETSDRNLVVNMGQVRTNAFKAPGQDSAPTAFDLHLRECSNAVSEYVSITFNGVANERNPDIFSIGDGPNTARGVGVAIFDSKNTLIPVNSAPRKVANLRDGDMTLHFVAKYRSTSENIMGGKANTQALFSLTY. 177
33 3.000e-52gi|639216395|ref|WP_024554136.1| fimbrial protein [Cronobacter helveticus]  clstr ali  26  1MKRFITSACAALLSGLILICS---AQAHDGTVYVSGKINETTCAVSPDSKNFTVDLGSVASKQFNNVGDGSDYRPFVIKLENC-AAAAQTVSVHFDGTPDSKNADLLAITSDTASAAGVGIAIYNQDKSIIPLGDESVKFPLTPDASATLNFYARYIANGDAIVAGTANASATFILTY. 175
34 4.000e-52gi|575544083|gb|ETX44502.1| hypothetical protein P805_01839 [Serratia marcescens BIDMC 44]  clstr ali  24  1MKLNKIMMAAVVAFGMTSVAHAAVQDQGHGKITFNGAIIDAACSISPESIDQTVELGQISKVALKDSG-TSTPRNFAIELENCGEDEANKVQVTFTGMEANGSNGLLGI---TGTAKGAGVAIVDSSGKKVTLGEPTKAQ-ELQNGNNTLNFSAYLQASGAAVVAGDFQAVADFTLAY. 178
35 7.000e-52gi|518286011|ref|WP_019456219.1| hypothetical protein [Serratia marcescens]  clstr ali  37  1MQIRQLVAVLALLSMSGGSALAHHVIIDGGMVHLRGALTEAACSVSTESAHQIIDMGQFRSNQFGDLGSFASPVEFNIRLTECSTAVSNTVGVAFYGVTDGKDPQVLKAGEGENAATGVGLALFDRNGVIIPPNTPPRIGMALHEGENILRFMARYRATSRQVVAGNADASTWFALTY. 181
36 8.000e-52gi|501082908|ref|WP_012133455.1| type-1 fimbrial protein subunit A [Citrobacter koseri]  clstr ali  28  24MKLKLMSSVIAGLMFAAGAAHADPVSVSGGTVHFEGELVNAACAVSTKSADQTVTLGQYRTASFTAVGDTSAQIPFTIVLNDCDPSVAATAAVAFSGQADGTNDSLLAVVSGDNTAGGVGIEILDNTSSPLKPGATFSTAQALVEGSNTLRFTARYKATAADTTPGQANADATFIMKY. 205
37 2.000e-51gi|446199191|ref|WP_000277046.1| fimbrin fimI [Escherichia coli]  clstr ali  41  1MYKKKLCAAVTLWLSVASAGNRHHVVIDGGITHFRGILTAEACTISTDSRSQTVNLGQFRSNQFNGVGSLTSPVGFSIRLTECSTAVSDQVKVAFYGVTDGKDPQVFKAGEGVNAASGIGLALFNELGQIIEPNTHSGFLSRLHEGDNTLRFHARYRATSREVTGGNANAFTWFALTY. 181
38 2.000e-51gi|640474022|ref|WP_024914523.1| fimbrial protein [Serratia fonticola]  clstr ali  42  1.MWKMGAGILLTLLLGPKAIADWNDRPLGGLMRFQGEVIAETCTVETKDQHLMVSMGHVTTDRFQLAGDEADPVLFDLHLQNCNPTVSRNVGVIFHGMADKNNPEMLSVGDEPGVATGVAVALFDNRGRFIPLNTAPRYWVPLQDGPLTLHFVAKYRATGQPVSDGLVNAQAWFALTY. 177
39 4.000e-51gi|486394505|ref|WP_001604058.1| long polar fimbria protein A [Escherichia coli]  clstr ali  32  1MKK----VVFALTALALTSGSVFAADSGDGTVKFTGEIVDSPCVLSVDSQNQEVVLGQVQKSIFAADGDKSPAKPFEIKLEDCDNSTLKKANVSFSGVGDAIKSDLVSVSTEAGAAKGVGIGIYDNKNTLVALNG-GKASVDLSKGQTVLYFTANYVATQIPVSTGYGNAQVDFNLTY. 173
40 5.000e-51gi|521292581|ref|WP_020456849.1| type-1 fimbrial protein subunit A [Enterobacter sp. R4-368]  clstr ali  26  1MKMKLMASSVA-AGLMLMAGAVQADTVSGGNIHFDGELVNAACAVSTASADQTVTLGQYRTASFPDVGATSGSVPFNIVLNDCDPAIFPTASVAFSGQADAADNTLLAVTSSSATASGVGIEILDNASKTLSPDGASSTAQALLEGTNTLHFSARYKATSATATPGQANADATFIMKY. 180
41 6.000e-51gi|569537959|gb|AHE60266.1| fimbrial protein [Escherichia albertii KF1]  clstr ali  30  1MEFLMKKVVFALSALALTSGSVFAADSGDGTVKFTGEIVDTPCVLSVDSQKQEVVLGQVQKSVFTAAGAKSPSKPFEIKLEDCDTGSGKTVKVGFNGVGDSDSNGELSVSTEAGAATGVGIGIYDNTNTLIKLNS-GEAETALKDGQTVLYFTANYVSTKDTVTTGYGNAEVDFNLSY. 179
42 7.000e-51gi|546163224|ref|WP_021805087.1| Fimbrial protein [Serratia fonticola]  clstr ali  28  1MKMNKIVMAMVMASGISAFGAMAATDQGSGNITFTGSIIDAPCSITPESSNQTVDLGQVSNSLLAKAG-TSTPRNFTIDLEKCDTTTKKNVVITFGGSKDTENDKLLGI---TGTAKGAGVALTDGSGTQITLGVPSTARGLL-AGNNKLNFSAYLQGNKATVTPGEFSSVANFTLTY. 184
43 7.000e-51gi|490209955|ref|WP_004108358.1| fimbrial protein BcfF [Klebsiella oxytoca]  clstr ali  28  8............ACMACCLLTTATADAHDGRVYVTGTITDNTCTLSPDSENINVEMGSVSNRQFYQAGDGSAWQPFAIDLQNCGSTVSG-VTVSFSGTANQRNTDLLALIDAADDATGIGIGLYDQDKHLIPPGQTS-EVIALSPGSAHLQFYARYIADGSAVTAGKANASATFILAY. 173
44 9.000e-51gi|493361084|ref|WP_006317526.1| MULTISPECIES: fimbria A protein [Serratia]  clstr ali  27  1MKLNKL-MLATVIAFASASVAHAASNQGSGKVTFTGEIIDAPCSVAPESVDQTVPMGQISSRLLAKEGK-SSSEPFSIELKDCSIATMKNVQVTFTGTPDPDNSKLLAL---SGTATGAGIMIYDNHSKDVELGTATDGQG-LTEGNNSLKFAAYLQGSSAAVVPGEFTSVANFTLAYL 176
45 1.000e-50gi|446690872|ref|WP_000768218.1| type-1 fimbrial protein subunit A [Escherichia coli]  clstr ali  26  1MKLKFISMAVALTLGVATSASAAPATVNGGTVHFKGEVVNAACAVNMNSVDQTVLLGQVRTKKLANLDDVSGPVGFNIQLDECDSTTSGSVKILFSGTPVAGKNNALAIQSSSGAATNVGIQILDSSGNPVTLNSDQSAVYTLTDGTNNIPFQARYIATGQS-TAGTANADATFKVQY. 180
46 1.000e-50gi|119351637|gb|ABL63534.1| FimA [Salmonella enterica subsp. enterica serovar Enteritidis]  clstr ali  29  24MKHKLMTSTIASLMFVAGAAVAAPVSVSGGTIHFEGKLVNAACAVSTKSADQTVTLGQYRTASFTAIGNTTAQVPFSIVLNDCDPKVAATAAVAFSGQADNTNPNLLAVSSASTTATGVGIEILDNTSSPLKPGATFSAKQALVEGTNTLRFTARYKATATATTPGQANADATFIMKY. 207
47 2.000e-50gi|490196879|ref|WP_004095415.1| fimbrial protein [Hafnia alvei]  clstr ali  27  19.KTCLICVVTGLFCRDVIAGNHHVVTVYGGQLNYKGAVVSAPCSVSIDSQNQLVTMGQVRVKEFDGIGSWSQSQAFTIKLEDCDTDLAPTAGVLLKGITDGKDPQVFATEHSQGSAKGVGIGIFDSQGNLIIPNSAPITFMSLIDGNNTISFSAKYRATENTVLAGSANAAISFEMVY. 195
48 2.000e-50gi|506356545|ref|WP_015876264.1| fimbrial major protein [Burkholderia glumae]  clstr ali  24  157MNTYSLHPVAGALLALAVSTS---AHAFDGTVNFNGNVVDAPCTISTDGKNLQVSMQDISTGAVLDG--SAPKTPFSIKLNNCSTAIKKTVQVTFSGTKAGD--GMLALTSESGAAKNVAIQLY-QDGKALKLDTTSAS-VKLKTGDNDIPFAAQYTSNGGTPVAGKANAIAQFTLSY. 325
49 2.000e-50METAHIT V1 GL0022199 [Complete] locus=scaffold6741_1:3761:4363:+  ali  26  14MKLSNIASTVIATLALVAGAAVAPVSVNGGTVHFKGELVNAACSVNTDSSEQTVNLGQYRTAKFTKVGDTTSNIPFTIELNDCDPAVAKTAAVAFTGQIDATDKTLLAVSSGNNSAKGVGIEILDSKSSTLTPGATFSAAQNLIEGTNTLNFTARYKATAATTEPGQANADATFVMKY. 199
50 2.000e-50gi|518283248|ref|WP_019453456.1| fimbria A protein [Serratia marcescens]  clstr ali  26  1MKLNKI--MLTAVLAFGVSSLAHAADQGHGKVTFTGSIIDAPCSISPETVDQTVDMGQVSNVALKNGGK-SAPRQFDIKLEQCDNSTLKTVTTTFEGKASTANKDLLGI---VGTASGASIAITDTASNPIKLGTATAPQ-NLGTGTNTLRFAAYLQGDGAAVVPGDFTAVADFKLAY. 173
51 2.000e-50gi|490249113|ref|WP_004147214.1| fimbria A protein [Klebsiella pneumoniae]  clstr ali  25  12MKLNKIVMALVLAFSTVSG--AQAADQGHGKVTFTGSIIDAPCSITPQSIDQTVDLGQISKEALLSGGK-STPRNFSIGLENCSPATKNKVQVTFTGMESAAKNGLLGI---TGTAKGASVAITQADGQIIKLGVPTKEQV-LQDGNNTLSFAAYLQGDGDSVTEGEFQAVTDFTLAY. 188
52 4.000e-50gi|493583881|ref|WP_006536896.1| fimbria A protein [Proteus penneri]  clstr ali  24  1MKLNKI-MIAAITFGMVSIANAAPTDQGHGTVKFEGSIIDAPCSITPDTVDQTVNLGQISNVILKDGGK-SSPKNFYIKLENCDTSLKKSVTVAFSGANSAGNPDLLGI---TGTAKGASIAITDGSGSVIKLGQSSNPQGIL-DINNTLAFSAYLQGTGAVIVPGEFSSIANFTMSY. 178
53 5.000e-50gi|639138767|ref|WP_024484219.1| fimbria A protein [Serratia fonticola]  clstr ali  21  1MKLNKIMMAAVIALGVSSVAHAAVKDQGHGKVTFTGSIIDAPCSITPDSIDQTIELGQISKVALKDGGK-STPRNFSIDLENCGKDNNNKVTVTFTGMESMATNGLLGI---TGTAKGASVAITDGTGKVIELGKATKAQ-LLQNGNNTLSFAAYMQGDGAAVTEGEFQTVADFTLAY. 177
54 5.000e-50gi|505181234|ref|WP_015368336.1| fimbrial protein BcfF [Enterobacter aerogenes]  clstr ali  31  5...........LYLCWGLALVASGALAHDGRVYVTGTITDNTCTLSPDSENIQVDMGTVSNRQFYQAGAGAEWQPFSITLQNCGSTASG-VTVSFSGTSDPQDGDLFAVNTGADTASGIGIALYDKNKQQIAPGAQS-DVLALTAGAASLQFYARYVADGAPVAPGAADASATFVLSY. 171
55 5.000e-50T2D.3927553 [KEGG:K07348] minor fimbrial subunit;|[COG3539] P pilus assembly protein, pilin FimA  ali  31  5...........LYLCWGLALVASGALAHDGRVYVTGTITDNTCTLSPDSENIQVDMGTVSNRQFYQAGAGAEWQPFSITLQNCGSTASG-VTVSFSGTSDPQDGDLFAVNTGADTASGIGIALYDKNKQQIAPGAQS-DVLALTAGAASLQFYARYVADGAPVAPGAADASATFVLSY. 171
56 5.000e-50gi|612275722|gb|EZQ69140.1| hypothetical protein AF53_03443 [Serratia marcescens BIDMC 80]  clstr ali  22  1MKLNKIMLAAVMAFGVSSVAHAAVKDQGHGKVTFSGSIIDAPCSIAPESIDQTVELGAISNVALKNGGK-STPRNFQIKLENCELTTNNTVSLTFSGSASEADSKLLGI---TGTAKGAGIAITDGAGTNIELGKASKAR-DLQNGANTLSFSAYLQASNATIVPGEFQSVADFTLAY. 181
57 6.000e-50gi|493362782|ref|WP_006319214.1| fimbria A protein [Serratia plymuthica]  clstr ali  27  1MKLNKI--MLATVLAFGVSSMAHAADQGQGKVTFTGSIIDAPCSIAPESVDQTVDMGQISNVALKNGGK-SMPRQFEIKLEQCDTTTMKTVTTTFNGDSSSANPDLLGII---GNASGASIAITDMASNLIKLGEATPPQT-LNDGNNTLRFAAYLQGDGAAIVPGDFTAIADFKLAY. 173
58 6.000e-50gi|490200743|ref|WP_004099235.1| fimbrin fimI [Klebsiella oxytoca]  clstr ali  50  15...............ALEAGEYWETMLPGGAMRFQGELLAEACSVEISDRSLTVNMGQIRTNMLHAPGEDADPVEFDIHLRDCNRNVSQYVGVTFNGVADGKNPDVISVGEGPGIAQDIGVAIFDASNTLIPLNSPPRRVASVVNGETILHFVAKYRATGHHVMGGKADAQAWFSLTY. 177
59 6.000e-50T2D.2923154 [KEGG:K07351] fimbrial protein;|[COG3539] P pilus assembly protein, pilin FimA  ali  29  1....MKKVLFALSALALTSTSVFAADAGDGTVKFTGEIVDAACVVSPDTQKQEVVLGQVNKSVFTAMGDKSTATPFKIKLENCDISTFKNVEISFNGVGDADNSKLVSVSTEPGAATGVGIGIYDNTNTLVDLNT-GKSATVLKEGQTVLYFTANYVSTKDAVTTGYGNAEVDFNLTY. 173
60 6.000e-50JGI.Meta JGI_HUM.1444637 7053882463 SRS017521_Baylor_scaffold_28794__gene_53713 long polar fimbria protein A [Human Stool microbiome from visit number 1 of  ali  29  1....MKKVLFALSALALTSTSVFAADAGDGTVKFTGEIVDAACVVSPDTQKQEVVLGQVNKSVFTAMGDKSTATPFKIKLENCDISTFKNVEISFNGVGDADNSKLVSVSTEPGAATGVGIGIYDNTNTLVDLNT-GKSATVLKEGQTVLYFTANYVSTKDAVTTGYGNAEVDFNLTY. 173
61 7.000e-50T2D.3432141 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  26  14MKLSNIASTVIATLALVAGAAVAPVSVNGGTVHFKGELVNAACSVNTDSSEQTVNLGQYRTAKFTKVGDTTSNIPFTIELNDCDPAVAKTAAVAFTGQIDATDKTLLAVSSGNNSAKGVGIEILDSKSSTLTPGATFSAAQNLIEGTNTLNFTARYKATAATTAPGQANADATFVMKY. 199
62 7.000e-50gi|612263398|gb|EZQ56980.1| hypothetical protein AF54_04445 [Serratia marcescens BIDMC 81]  clstr ali  25  1MKLNKI--MLAAVMALGVSSLAHAADEGHGKVTFTGSIIDAPCSIAPDSLDQTVELGAISNVALKNGGG-SNPRPFSIKLENCELTDAKKVALTFSGAKSAADETLLGI---TGSAKGAGIAITDGAGTIITLGTPSKAQGLL-NGSNTLAFSAYLKASGAVITPGDFQSVADFTLAY. 175
63 7.000e-50gi|639138408|ref|WP_024483865.1| fimbria A protein [Serratia fonticola]  clstr ali  22  1..MNLNKTLLAAVIAFGSASMAHAADQGHGKVTFTGSIIDAPCSISPDTVDQTVELGQISNAALKNGGK-STARNFNIQLENCDPAAKNKVAVTFTGMESAAGNGLLGI---TGTAKGASIAITQGDGEVIKLGKPTK-QQLLQDGNNTLSFGAYMQGDGAAITEGNFQSVADFTLAY. 176
64 8.000e-50gi|544754735|ref|WP_021181632.1| Fimbriae-like adhesin SfmA [Serratia fonticola]  clstr ali  27  3.NKQRFIKSVLGLALLSVGTVASAAIVSGGTVHFTGQIVNAACAVSADSLDQTVKMGQFRTANFTSVGARSNAVPFTIKLEDCDTKVSTTAAASFYGNQDANDPTVLNVVNTSGTASGVGIEISDHTGKVLTPGSMFSTAQTLVDGSNVLNFTARYKSTKADVTPGEADADATFKMQY. 184
65 1.000e-49gi|640473867|ref|WP_024914402.1| fimbrial protein [Serratia fonticola]  clstr ali  43  3.KMGAGILLTLLLGPKAIANNPRDEPSLGGLMHFQGEVIAETCSVETKDRNLMVSMGHITTDRFQLASDESGAVPFDLHLQGCNPTVSRNVGIMFHGMADKNNPEMLSVGEGPDVATGVAVALFDDRGQFVPLNTAPRYWIPLQDGPLTLHFVAKYRATGLSVNDGLANAQAWFALTY. 179
66 1.000e-49gi|493863066|ref|WP_006809816.1| type-1 fimbrial protein subunit A [Enterobacter hormaechei]  clstr ali  26  14MKLSNIASTVIATLALVAGAAVAPVSVNGGTVHFKGELVNAACSVNTDSSEQTVNLGQYRTAKFTKVGDTTSNIPFTIELNDCDPAVAKTAAVAFTGQIDATDKTLLAVSSGNNSAKGVGIEILDSKSTTLTPGATFSAAQSLIEGTNTLNFTARYKATAATTAPGQANADATFVMKY. 199
67 1.000e-49gi|490365263|ref|WP_004244927.1| fimbria A protein [Proteus mirabilis]  clstr ali  25  30MKLNKLALVLG-LGLSVVAGSALAADQGHGTVKFVGSIIDAPCSITPDTENQTVPLGQISTAALKDGG-RSNSRDFKISLENCTTETYKTVQTTFTGSEATEV--LEGSLGIEGIAKNAAVVITDAGGKQIKLGTPSAAQ-NLRDGNNDLNFAAYLQGSASAAVPGDFTAIATFALTY. 203
68 2.000e-49gi|545295469|ref|WP_021575757.1| type-1 fimbrial protein, C chain [Escherichia coli]  clstr ali  27  1MKLKFISMAVALTLGVATSASAAPATVNGGTVHFKGEVVNAACAVNMNSVDQTVLLGQVRSATLGSDGKTSGSVGFTIQLDDCDLTTTQSAKIIFSGTPVTGKTNVLALNSASGAATNVGIQILDSKGQPVELNSDAASEYTLTDGTNKIPFQARYYATGQA-TAGIANADATFKVQY. 182
69 2.000e-49gi|353634460|gb|EHC81031.1| Long polar fimbria protein A precursor [Salmonella enterica subsp. enterica serovar Senftenberg str. A4-543]  clstr ali  28  1MEFLMKKVVFALSALAVVSTSAFAAESGDGTIHFTGEIVDAPCVVSTDSQNQEVVLGQVKKNIFKAIGDKSVSKPFQIKLEDCDITSQTKVNVSFAGVGDADDATLVSVNTEAGAATGVGIGIYDNANKLVEMNT-GKSTTTLAAGQTVLYYTANYVATKDTVTTGYGNAEVDFNLSY. 190
70 3.000e-49gi|573012243|dbj|BAO35595.1| fimbrial protein [Serratia marcescens SM39]  clstr ali  23  1MKLNKI--MLAAVMAFGVSSLAHAANQGSGTVTFSGSIIDAPCSIAPESIDQTVELGAISNVALKNGSKASTPRDFHIQLEGCDPGKNNTVTLTFNGTASETDKKLLAI---TGEAKGAGIAITDANKNLIELGKASNA-IELQNGRNKLSFAAYLQGSSASIVPGEFQAVADFTLAY. 180
71 3.000e-49gi|490309966|ref|WP_004204685.1| hypothetical protein [Klebsiella pneumoniae]  clstr ali  48  20..................ANNIWTVTLGGGDVRFRGVIIAESCRVEAGDKHMIVDMGQISSNRFHHVGEDVNPVPFSIHLQECNTAVSDRVSVTFHGIADEKYPEVLSIGDKQDSAKGVSIALFDNEDRLIPLNSTPISWNRLYKGPKTLNFVAKYRATSNVVTGGIAKAHAWFALTY. 179
72 4.000e-49gi|648450392|ref|WP_026142143.1| fimbrial protein [Serratia sp. S4]  clstr ali  40  1......MALLIIAGGTAMAGNRHHVIIDGGRVHLRGVLTAAACSVSTESANQVIDMGPLSSNQFGDLGSYAPPIEFIIRLTECSTAVSNTVGITFFGVTDGKDPQVLKAGEGENAASGVGLALFDYKGDIILPNTAPLSWANLHEGENILRFMARYRATSRQVVGGNADASTWFALTY. 172
73 4.000e-49gi|490843316|ref|WP_004705388.1| fimbrial protein [Yersinia aldovae]  clstr ali  30  1MKK------LILAALVAASFSAPVYAAPPGTIRFEGEIVTGACGIDADSLDQTVNLGQVPSHMFKAIGDRSTAVPFEIVLTDCDTTTSKNATVTFTGTGHAEKSAILGV---TGAATHVGIRLQGGSNEYLDLGTVSKP-TLLSNGDNHLKFSAMYESTAANVTAGDADATAQFTVNYL 169
74 5.000e-49gi|516502766|ref|WP_017891204.1| hypothetical protein [Serratia sp. S4]  clstr ali  27  3.NKQRVFKSVLGLALLSAGTMASAAIVTGGTVHFTGQIVNAACAVSADSTNQTVNMGQYRTAHFTGVGTRSNAVPFTIKLEDCDTTVSTQASTAFSGSADATDPTVLTVSNTSGTASGVGIEISDRIGQVLKPGANFSNAQKLIDGANVLAFNARYKSVAAAVTPGQANADATFTMQY. 184
75 5.000e-49gi|573012720|dbj|BAO36072.1| fimbrial protein [Serratia marcescens SM39]  clstr ali  24  1MKLNKLMLATAIAFSTASVAHAAPTNQGSGTVTFSGEIIDAPCSITPDSVDQTVPMGQISSRILAKEGK-SSAEPFSIELKDCALNTMKNVKVTFTGTPDAVNSKLLAL---SGSASGAGIVIYDQHAKEVELGTATDGQG-LNEGNNALKFAAYLQGNSAAVVPGKFTSVANFTLAY. 177
76 6.000e-49METAHIT MH0025 GL0054416 [Complete] locus=scaffold33438_1:15992:16555:+  ali  27  1MKLKHVGMIVVSVLAMSSAAVSVTTTVNGGVIHFKGEVVNAACAIDSESMNQTVELGQVRSSRLAKAGDLSSAVGFNIKLNDCDTNVSSNAAVAFLGTTVTSNDDTLALQSSAGSAQNVGIQILDRTGEVLILGATFSAKTDLIDGTNILPFQARYIALGQSV-AGTANADATFKVQYL 187
77 6.000e-49T2D.2724108 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  27  1MKLKHVGMIVVSVLAMSSAAVSVTTTVNGGVIHFKGEVVNAACAIDSESMNQTVELGQVRSSRLAKAGDLSSAVGFNIKLNDCDTNVSSNAAVAFLGTTVTSNDDTLALQSSAGSAQNVGIQILDRTGEVLILGATFSAKTDLIDGTNILPFQARYIALGQSV-AGTANADATFKVQYL 187
78 6.000e-49JGI.Meta JGI_HUM.1461821 7053938643 SRS017521_Baylor_scaffold_52592__gene_109893 putative major fimbrial subunit fmlA [Human Stool microbiome from visit num  ali  27  1MKLKHVGMIVVSVLAMSSAAVSVTTTVNGGVIHFKGEVVNAACAIDSESMNQTVELGQVRSSRLAKAGDLSSAVGFNIKLNDCDTNVSSNAAVAFLGTTVTSNDDTLALQSSAGSAQNVGIQILDRTGEVLILGATFSAKTDLIDGTNILPFQARYIALGQSV-AGTANADATFKVQYL 187
79 6.000e-49gi|518286010|ref|WP_019456218.1| hypothetical protein [Serratia marcescens]  clstr ali  28  4.KQRVIKSVLAAVLLSAGTMATAATTVPGGTVHFTGQIVNAACAVSAGSTDQTVNLGQYRTANFKAVGDRSGAVPFKIQLQDCDTSVSTQASVAFSGTAVSSDANVLAVSNXXXXXXXVGIEIGDHAGKVLPPNGSFSTAQTLIDGVNVLNFTARYKATAASVTPGQADADATFTMQY. 185
80 8.000e-49gi|493736430|ref|WP_006685634.1| type-1 fimbrial protein subunit A [Citrobacter youngae]  clstr ali  25  24MKHKLIASSVIASLMLVXXXXXXPVSVSGGTVHFEGELVNAACAVSTQSSDQVVTLGQYRTASFTAVGDTTAQIPFTIVLNDCDPKVAATAAVAFSGQTDITNNNLLAVSSSSTTAGGVGIEILDNTSTALKPGATFSTAQALVEGTNTLRFSARYKATATSATPGQANADATFIMKY. 211
81 9.000e-49gi|496196483|ref|WP_008916320.1| fimbrial subunit FimI [Providencia sneebia]  clstr ali  47  1.MKGLMLGLLLLVSPLMEAGNKWQVQLPGGGMRFQGELIAEACSVEISDRNLTVNMGQLRTNMLNAPGQDTDPVIFDIHLRECSDAVSQYVSITFSGVANDQNPQIFSVGNGPDTATGVGLAIFDSKNTLIPINSAPQKIARTSNGDMTLHFTAKYRATSYQVTGGKADVQALFLLTY. 177
82 1.000e-48gi|578181280|gb|EUL41608.1| hypothetical protein P852_00993 [Enterobacter cloacae UCI 49]  clstr ali  29  28.............................GKVHFYGAVVNSSCSIDTQSFDQSVMMGQVRTGSFLGPGSWAEPVTFWIKLENCATSTSESASVTFNGLADLKDPQVFQAGFGSGAAKGVGIGIFDMRGNQVIPDSQPLAKMPLIAGENTLLFTARYRSVSMPVTAGDASAAVTFSVIY. 176
83 1.000e-48gi|501097383|ref|WP_012147399.1| fimbria A protein [Serratia proteamaculans]  clstr ali  26  1MKLNKIMMAAVLAFGATSMMAQAAVNQGSGTVTFKGAIIDAPCSITPETEDQTVSLGQISNVALKDGGQ-STPKNFQIKLENCELSAGNAVSITFSGASSVDDNNLLGI---TGTAKGAGIAITDGSGKLIELGKASSAQT-LQNGNNTLSFAAYLQASGAVVTPGEFQSVADFTLAY. 186
84 1.000e-48gi|491077109|ref|WP_004938731.1| P pilus assembly protein, pilin FimA [Serratia marcescens]  clstr ali  25  1MKLNKIMMAAVIAFGA--SSFAQAADQGHGKVTFTGSIIDAPCSIAPESIDQTVDLGQVSNVALKNGGK-SNPRPFEIKLEQCDTTTLKTVKTTFSGIASSTNKDLLGI---AGTASGAGVAI-TYGGQPIKLGQATAAQT-LNTGNNSLNFAAYLQGEGAAIVPGDFTAVADFTLAY. 172
85 2.000e-48gi|612152631|gb|AHW95302.1| hypothetical protein DI57_13150 [Enterobacter asburiae L1]  clstr ali  25  1MRLNMFRLIAVIIFTQIIFIFPETVLSAAGNVHFYGAVVNGACAINTQSLDQSVMMGQVRTSTFTETGSWAEPTAFWIKLENCDAGTSESASVAFNGLADSKDPQVFQAGFGSGAAKGVGIGIFDMKGNQVVPDTQPLAKMPLITGENALLFTARYRSVSTPVTAGDASAAVTFSVIY. 182
86 2.000e-48gi|503129998|ref|WP_013364659.1| ferrous iron transporter B [Enterobacter lignolyticus]  clstr ali  37  12......LLLSLVAAPSAYAGNHHYVNIHGGDVHFFGQVVNAACSVSADSRNQTVQMGQVRSNQFASLGDWEDPQPFQIALEDCDTAVSQNVGVLFTGESDGKDPLVFRAGYGAGAAHGVGIGIFDGAGNLLVPDTRPPWFAPLQEGETVLSYTARYRATDRRVKAGSASAQVWFNVIY. 183
87 2.000e-48gi|639138621|ref|WP_024484075.1| fimbria A protein [Serratia fonticola]  clstr ali  25  1MKANK--TLLAAVAVFGLSSLAHAADQGNGKVTFTGSIIDAPCSIAPDSADQTIELGQISKVALKDGGK-STPRNFDIQLENCSVSSQNKVQITFTGMKSPAKNGLLGI---TGSAKGASVAVTDGSGAVIELGKPSTAQ-ELSDGTNTLSFAAYVQGDGAAITEGEFQAVADFTLAY. 176
88 3.000e-48gi|505156963|ref|WP_015344065.1| P pilus assembly protein, pilin FimA [Serratia marcescens]  clstr ali  27  1MKLNKI--MLAAVMAFGATSFAQAADQGHGKVSFTGSIIDAPCSIAPESIDQTIDLGQVSSIALKDGG-TSNPRSFDIKLEQCDITTIKNVTTTFTGAASPTNQDLLGI---VGTASGAGVAI-TYGGKTVKLGEATAAQ-DLNEGNNTLHFAAYLQGEGAAVVPGDFSAVADFTLAY. 172
89 3.000e-48gi|491055798|ref|WP_004917443.1| fimbrin fimI [Providencia stuartii]  clstr ali  44  15...............LMEAGNKWQVQLPGGGMRFQGELIAEACSVETSDRSLIVNMGQLRTNMLNASGQDTDPVIFDIHLRECSAVASEYVSITFAGIANDKNPAIFAIDNGPNTATGVGLAIFDSKDTLIPINSSPRKIERVSNGDMTLHFVAKYRATSDQITGGKADAQALFSLTY. 177
90 3.000e-48gi|491047659|ref|WP_004909312.1| fimbrial protein domain-containing protein [Providencia rettgeri]  clstr ali  28  1MKMNKLLLVAITASSFAAINASAAVDQGSGTVTFVGSIIDAPCSISPESSNQTVDLGQVSNALLSKAGS-STPRNFSIDLEKCDTTTKKNVTITFGGSKDSVNDKLLGI---TGSAKGAGVVLTDGSGTQITLDAPSAARNLL-AGNNKLVFSAYLQGNTAEVTPGEFTSVANFTLTY. 177
91 4.000e-48gi|499529612|emb|CCI75972.1| fimA [Klebsiella pneumoniae]  clstr ali  26  61MKIKTLAMIVVALSLSSTAALADTTTVNGGTVHFKGEVVNAACAVDAGSIDQTVQLGQVRSAKLATAGSTSSAVGFNIQLDDCDTTVATKASVAFAGTADSSNTTVLALNSAAGSATNVGVQILDNTGTPLALGATFSAATTLNDGPNIIPFQARYYATGAATAG-IANADATFKVQY. 241
92 4.000e-48gi|501082615|ref|WP_012133172.1| ferrous iron transporter B [Citrobacter koseri]  clstr ali  27  1.MMNKVALGLFIAATVGCSASAFAATNGEGQINFTGEIIDSACQVVNGSNPLNVELGRVSKTVFSGAGSTSTPTKFDIQLKDCPEMVT-SAAINFGGTPDTDNSTTLALTPDTETATGVAIQLLDSSEQPVSLYTPSRQYPLTAGSTNDLEFAARYIQTQAAVTAGPANSVSTFTVIY. 178
93 4.000e-48gi|491097486|ref|WP_004959087.1| fimbrin fimI [Serratia odorifera]  clstr ali  38  12...TIISAALMLSSAVALAGNRHHVIIDGGQVKLRGAITAAACSVSTGSEAQIVEMGDVRSNQFSGLGSYSPPVAFSIDLTGCNRAIYHAVGVSFWGVTDGKDPLVLKAGNGAQGGPGIGLALFDDHGDLMVPNAPPSRLAMINDRETRLHFSARYRATSRQVTGGEANSWAWFALTY. 186
94 4.000e-48gi|553936801|ref|WP_023145404.1| fimbrial protein, partial [Escherichia coli]  clstr ali  29  10.........FALSALALTSTSVFAADAGDGSVKFTGEIVDAACVVSPDTQKQEVVLGQVNKSVFTTTGDKSAATPFKIKLENCDISTFKNVEISFNGVGDADNSKLISVSTEPGAATGVGIGIYDNTNTLVDLNT-GKSATVLKEGQTVLYFTANYVATKNAVTIGYGNAEVDFNLTY. 177
95 4.000e-48gi|560359536|ref|WP_023617411.1| ferrous iron transporter B, partial [Enterobacter sp. MR1]  clstr ali  32  8MRQVTRQSMLFFSVLLCVALPASATD--DGSVHFQGQVVNTGCSVSAESQDQIVRMGQIRNNEFAATGDWAAPTAFQITLEDCDTSVSQRAGVLFSGESDAKDPQIFRAGYGAGAAQGIGVGIFDATGHLLIPDTAPPWYAPLQNGANVLRFMAKYRSTQPHVQAGTADAQVWFNVVY. 183
96 5.000e-48gi|602777592|gb|AHO21858.1| fimbrial protein [Salmonella enterica subsp. enterica serovar Enteritidis str. EC20121180]  clstr ali  28  1MKHKLMTSTIASLMFVAGAAVAAPVSVSGGTIHFEGKLVNAACAVSTKSADQTVTLGQYRTASFTAIGNTTAQVPFSIVLNDCDPKVAATAAVAFSGQADNTNPNLLAVSSASTTATGVGIEILDNTSSPLKPGATFSAKQALVEGTNTLRFTARYKAXXESPGLGTA........... 174
97 5.000e-48gi|493867339|ref|WP_006813951.1| fimbrin fimI [Providencia rustigianii]  clstr ali  48  12............FSPFLQAGNKWKVQLPGGGMRFQGVLIAEACSVETSDRTLTVNMGQLRTNMLHAPGQDTAPVIFDIHLRECTQAVSEYVSITFSGVANDKNPDIFSVGDEPNTAQGVGLAIFDSTNTLIPINSTPRRIDRITNGDMTLHFVAKYRATSYEITGGKANAQALFSLTY. 177
98 6.000e-48gi|490860408|ref|WP_004722450.1| fimbrial protein [Yersinia ruckeri]  clstr ali  31  1MKKVLLTVMIAVSFSAAI-QAAPPVSGSPGTIRFEGEIVTGACGIDSDSLDQKVDLGQVPSHLFTAKGDRSTAAKFDIVLTDCDTTTSKNATVTFTGASHSENAALLGI---TGAATHVGIRLQSGSNEYLALGTATKP-ILLSNGDNRLQFAAMYEATDAGVTAGDADSTAQFTVNYL 174
99 7.000e-48gi|499457340|ref|WP_011144804.1| fimbria A protein [Photorhabdus luminescens]  clstr ali  26  1MKLNKLVMVLGLGATLAAGSVNAATNQGHGKVTFEGSIIDAPCSIHPGDDDQTVKLGQISNKALAGGGK-STPVPFNIRLLDCDANGKRTVTATFSGTPSAVNKDLLAI---VGSASGAAIGITNDNAKLIKLGQPSSPTIITDDSDSTMRFAAFLQGDGATIVPGDFTAVANFTLTY. 187
100 8.000e-48gi|636412066|gb|KDL89097.1| hypothetical protein AE02_05296 [Klebsiella pneumoniae MGH 76]  clstr ali  26  3MKKVVIAIGAVMAMSAGSAYAAGDATVTGGTVHFKGSLVDAACSVSTDSADQIVDLGQHPLHDFKAVGDKSELRPFTIKLEDCDTTVATTAAVAFSGSVDSTNTDLLAVDSSGSSATGVGIQILDEASAVVKPGSTFSTAHKLIDGENILNFKSRYVSTVASPTAGQANADATFIMQY. 189
101 8.000e-48gi|639223551|ref|WP_024560786.1| fimbrial protein [Cronobacter pulveris]  clstr ali  26  1MKRIMLVCTHLLLGLAGFS-----ATAHDGTINVLGKIVENSCAVTADSKTLTVDLGNVASKQFTRAGDGSVFKPFAINLEKCPTAV-KTITVHFEGTADSKNADLLALTTGASAAAGVGVGIYNADYSLIPFGDESAKFTPAGETTATLNFYARYVANGGTVTAGTANASATFVLTY. 173
102 8.000e-48gi|504406422|ref|WP_014593524.1| putative FimI fimbrial protein [Pantoea ananatis]  clstr ali  40  21MGYRMLVALLSLACFPLMAGQKWNVTLPGGRLSFSGEAIVAACQVDG--VEKTVDMGQISSNRFRYAGEYSPAVPFDIRLVNCSPRASHHVSVAFRGLTDTRMPSALSVGDAEDTASGVAIALADDEGHPVSVNSPLEPVWTLLNGTLSLHFIARYVSTTASVKGGRVDATATFLITYF 197
103 9.000e-48gi|514233570|ref|WP_016536219.1| fimbrial protein [Cedecea davisae]  clstr ali  24  1...MKKQLHALALLSVISGAAVSTANAADGTIQFNGEIIDAACTVSPASASQTVTLGQVSDKAFAAQGDTAGATAFQIDLTSCPATV-TSATVKFDGTAYQGDNSALALTQAPGAATGVGIQIRNADNSVLPLFTPSQSIALAQTGTNTLKFNAAYVAKAATVTAGPANATATFSVVY. 174
104 1.000e-47JGI.Meta JGI_HUM.0735506 7045160403 C3751227__gene_286500 protein fimF [Human Stool microbiome from visit number 1 of subject 158337416]  ali  30  1MRNKPFYLLCAFLWLAVS-----HALAADSTITIRGYVRDNGCSVAAESTNFTVDLMENAAKQFNNIGATTPVVPFRILLSPCGNAVS-AVKVGFTGVADSHNANLLALENTVSAAAGLGIQLLNEQQNQIPLNAPSSAWTTLTPGKNTLNFYARLMATQVPVTAGHINATATFTLEY. 175
105 1.000e-47gi|490383255|ref|WP_004262766.1| ferrous iron transporter B [Providencia rettgeri]  clstr ali  26  1MKKNLLASLIAATSIFAV----NNALAADGTIDFTGEIIDQACELAAGSDALKVNLGQVSKKALPNAGSTAAATKFTIKLINCPATV-TTASVKFDADSYIGDDEVIKLKEE----TGVGIQITDDTNKIVPLFTASKAYPLQQNVENNLDFRARYIAKSDTVTPGPANATATFTINY. 169
106 1.000e-47gi|516413669|ref|WP_017803067.1| hypothetical protein [Erwinia toletana]  clstr ali  23  1..MKFREKTVAAIMIMGYVFAANAADSGHGTVTFQGAIIDAPCSINPDSIDQTINLGQISAAALSASGKTSIPRPFQIKLENCTTATLSTVQTKFTGAASAYDKDSLAL---SGSASGASIVMLDGSNEKVKLNVATTPQT-LQDGHNTLNFNAYLQGSSATIVPGEFNSITNFTLAY. 176
107 1.000e-47gi|505189252|ref|WP_015376354.1| fimbrial protein [Serratia marcescens]  clstr ali  24  1MKLNKIMMAAVLAFGV--ASVAHAKDQGHGTVTFKGAIIDAPCSITPETVDQTVNLGQVSNVALKNGGQ-STPKNFQIKLENCELNAGNAVAITFTGAASVEDAKLLGI---TGTAKGAGIAITDGSGKVIELGKASSAQT-LGNGNNTLSFSAYLQASNAVITPGDFQSVADFTLAY. 182
108 1.000e-47gi|639142895|ref|WP_024485840.1| fimbria A protein [Serratia fonticola]  clstr ali  24  1..MNLNKTLLAAVIAFGSASMAHAADQGHGKVTFTGSIIDAPCSIAPESIDQTVDLGQISNAALANSGQ-STPRNFDIKLEDCSFAAKNKVQVTFSGMESVAGNGLLGI---TGNAKGASVAITDGTGTVIELGKPTKEQT-LQDGNGTLTFAAYMQGDGATITEGDFQAVTDFTLAY. 176
109 1.000e-47gi|526245239|ref|WP_020842593.1| type 1 fimbrae adaptor subunit FimF [Salmonella bongori]  clstr ali  32  1MMRNDILYGIGMLL------AASGVQAHDGRVYVSGTITDNTCSLSPGSENINVAMGAVSQRQFYRAGDGSAWQPFAIDLQNCGSTASG-VTVSFSGASDRHNTDLLALTAGENDASGIGIALYDQNKTLIPLGQES-DVVTLTPGQASLQFYARYLADGGTVASGNANASATFILAY. 172
110 1.000e-47gi|490363504|ref|WP_004243225.1| type-1 fimbrial protein subunit A [Proteus mirabilis]  clstr ali  28  3.KKKMLVKALFTVSVLSLSGVASAATVNGGKINFTGEIVNAACVVSTKSIDQTVNIGQYRTAQFDSVGKTVGNTDFYINLEACDTTVAQNASVSFSGVSDSNDKTVLAVSNGAGAATGVGIEITDHTGKVLPPGSVFSTAKQLIDGSNTLNFVARYKSTLDTVTPGHADADVTFKMQY. 185
111 1.000e-47gi|544754482|ref|WP_021181380.1| putative mannose-resistant/Proteus-like fimbrial protein [Serratia fonticola]  clstr ali  25  1MKLNKIMMAAVLAFGTVSG--AQAADQGHGKVTFTGSIIDAPCSISPESIDQTVELGQISKVALLGGGK-STPRFFSIDLENCSPATRNKVQVTFTGMASAAKDGLL---GTTGTAKGANVAITQADGEIIKLGEPTKEQV-LQNGNNTLSFAAYMQASSAAIIEGEFKAVADFTLAY. 177
112 1.000e-47gi|639209483|ref|WP_024547667.1| fimbria A protein [Cronobacter turicensis]  clstr ali  26  1MKINKLASAIILTMGMVAAG-ANAADQGHGKVTFTGSIIDAPCSITPESADQTVALGQVAAHTLKDGG-TSAPKSFTIDLENCGNTIGNSVSVTFSGTASTLDAKLLGL---TGEAAGAGIAIEDESGKVVDLGTPSSLY-KLTGTNPSLGFTAYLKGISDTITTGDFESVANFTMDY. 179
113 1.000e-47gi|498117681|ref|WP_010431837.1| ferrous iron transporter B [Enterobacter mori]  clstr ali  26  1MKKNIIAAAIVATAALSMS----NAFAAAGTVNFNGEILDAACTVDVGSQNQTVELGKYNKSEFAAAGDVTAATKFDIVLKDCPATV-TSASVRFDGTPDATDSTLLAIDSSAGAATGVGINLMTADKAQLPLGSNGYSYALSSTADNTLDFYAQYKSTVDSVTAGPANSVANFSVVY. 175
114 2.000e-47gi|491097488|ref|WP_004959089.1| type-1 fimbrial protein subunit A [Serratia odorifera]  clstr ali  29  3.KNLSRILIGTALLTTGASALAATATTYGGNIHFVGRIVNAACAVSADSTDQTVNLGQYRTAKFAAAGDYSGKVPFTIKLEDCDTAVSTKASVAFNGAADKTDNTVLGVSNXXXXXXXXXIEIRDHDNVLIPNGASYSAPFTLADGKNILHFTARYKATAKAVTPGEADADATFTMQY. 184
115 2.000e-47gi|573509195|gb|ETT09283.1| fimbrial protein [Providencia alcalifaciens F90-2004]  clstr ali  23  1MNRNIFKSLFSVILLF----SSQSAVSVDGNIEFIGEIIDQACEVKTDSKNIQVPLGSIPKANLPNVGSKSTPVLFTITLINCPVTVTR-ASVLFDAIPYPGDNTVLALKADTGVATGVGIQLTDKSNAIITLLTPSNSYTLLPNVDNPLNFTANYIAKASPVTPGPANGAATFLIVY. 173
116 2.000e-47gi|575848406|emb|CDL81788.1| putative fimbrial-like adhesin protein [Xenorhabdus szentirmaii DSM 16338]  clstr ali  28  1MKSK-----LLISSLFVTSLFAATANSADGVIRFEGEVIQNACKVHGDSADQTVDMEAVSVGAFKKVNDTASPRRFQIKLVDCPAEMKKNVTIRFDGPSDSHNRELLALTKVSNAATGVAIGIYEEDQTRVSVAGDSSKSPLHLGAEQELRFVAKYVATKDKVGPGSANAVTNFTVVY. 175
117 2.000e-47gi|516438605|ref|WP_017827517.1| ferrous iron transporter B [Proteus mirabilis]  clstr ali  23  1....MRKSFIAMLIATTSIFVANNALAADGTIDFTGEIIDNACELAAGSDALKVNLGKVSKTALPSAGVTAATTKFTIKLINCPATVS-TASVKFDAESYSGDDTVIALKQESGVATGVGIQIMDDANTVVPLFTASKTYPLKEGGENNLDFRARYIAKTDSVTAGLANANATFTINY. 173
118 2.000e-47gi|491415745|ref|WP_005273547.1| fimbrial protein [Yersinia bercovieri]  clstr ali  28  8..LTQKLLPFSLLALFPLATSSWAAEVAGGTINFNGSVVTTACAVSSDSANINVDMGQVRAATLSAAASEAPMKKFSIVLEDCDSSVSQDVAVTFSGTPDNDDPDSLAVNGGTGTAQNVAVRLYSEEGSVVKLGEASGA-VNLRDGINTLNFGAKYYSPKGGATAGDASTVATYTLTY. 185
119 2.000e-47gi|506490093|ref|WP_015965471.1| P pilus assembly protein, pilin FimA [Enterobacteriaceae bacterium strain FGI 57]  clstr ali  23  9..KMPRHFTFALTLLAMTSSVQAATPLGEVNIQLQGNIVDLSCVVNASDSAKEVQLGTWPTKQLQTAGSKTQAMPFSIRLTGCPPGA---VSITFAGTPDDQDNTLLALNGASQ-ASRVAVEILDEDKTRLPLQQESKEVAIDAQGDATLSFYANYISTADNPQPGSADADATFTLNY. 180
120 2.000e-47gi|575848346|emb|CDL81904.1| Similar to fimbrial subunit type 1 [Xenorhabdus szentirmaii DSM 16338]  clstr ali  26  1MKIKLI-----ISSLLVSSVFMSAVHAADGAIKFTGKITASACKVDSGSMDQPVNMGTVSSNSFNGMGSTSSPTRFNIKLTDCPKE-YKNAYVKFDGQTDRTNNRYLALQNNGSAAQGVALAIYELNNSPLAITQRSMAYPLIENQSNVLSFVAKYIATGDKVTAGSGNSLANFTITY. 176
121 2.000e-47gi|493873861|ref|WP_006820307.1| fimbria A protein [Yokenella regensburgei]  clstr ali  26  1MQLTKLVWVFGM-GAAVLAGQAQASDQGHGTVKFTGSIIDAPCSITPETIEQTVDLGEISNKSLLNGGK-SNPRPFDIKLESCDLSTDKTVTITFTGPESSAQPGYLAIVGSS--ASGAAIGITNDEGTNIPLGTASSA-TKTQQGDNTLTYSAYLKGNGTTVVPGSFTSVANFTLAY. 177
122 3.000e-47gi|503577745|ref|WP_013811821.1| MULTISPECIES: fimbrin fimI [Serratia]  clstr ali  61  15.............SATAQAGNRWHVILPGGNMQFQGEVIEEACSIALENKQMTVSMGQISSNNFHAAGAFSEPVHFDIHLQNCSTSVSQHVGISLHGVADSREPDLLAVNNEQDYSNNIAIAFFDEHERPIKLNHPPKFWKRIVDGPVTLHLLARYKAIQYPVMGGKANGQLWFFLTY. 179
123 3.000e-47METAHIT V1 GL0098794 [Complete] locus=scaffold1226_28:1986:2510:-  ali  26  1..MNGKLFKSALVCSSLLLGWQAHAGNGNGTVHFTGEIIDSTCEVTAPTQTQTVDLGKVNKSAFSGAGSTASVQAFQIDLENCP-DTYKKATARFDGTEDGD--GYLKLN--AGGATGVAVAIYNADNTLLKLYNQSVSADIDADGKATLPFMARYIATSATVTPGVANADSEFTITY. 172
124 3.000e-47T2D.2138504 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  26  1..MNGKLFKSALVCSSLLLGWQAHAGNGNGTVHFTGEIIDSTCEVTAPTQTQTVDLGKVNKSAFSGAGSTASVQAFQIDLENCP-DTYKKATARFDGTEDGD--GYLKLN--AGGATGVAVAIYNADNTLLKLYNQSVSADIDADGKATLPFMARYIATSATVTPGVANADSEFTITY. 172
125 3.000e-47gi|490365276|ref|WP_004244940.1| fimbria A protein [Proteus mirabilis]  clstr ali  25  1MKLKKLHLVLG-LGLSIIAGSALAADQGHGTVEFYGSIIDAPCSIDPDSGAQRIPLGQVSSSALKDGG-RSASKMFKIKLLQCSTETYKTVKTTFTGAEAPDV--LEGALGIEGIAKNAAVVITNAGGEQIKLGQASAAQT-LNDGNNDLNFAAYLQSSSKAAIPGDFTAIATFALSY. 174
126 3.000e-47gi|446690873|ref|WP_000768219.1| type-1 fimbrial protein subunit A [Escherichia coli]  clstr ali  26  1MKLKFISMAVFSALTLGVATSASAATVNGGTVHFKGEIVDAACAVSLNSFDQIVSLGQVRTAKLANDADKSAPVGFDIELSDCSTAALSNAAIIFSGSQMSGHNNILAVQGGAGTATNVGVQVTDYTGKPVVFGTTASTDYKLTDGTNKIPFQARYIAVDGQATAGTANADATFKVQY. 180
127 4.000e-47gi|495031041|ref|WP_007756588.1| Type-1 fimbrial protein, A chain precursor [Cronobacter dublinensis]  clstr ali  25  1..MKKFVLTAVLAGAACWATSSFAAANGEGQVNFSGEIIDSACEVNTASSPLQVSMGKIAKSVFSSVGATSTPTLFKIQLKNCPETVT-SASITFGGTPDTNNNNVLALKSETGVASGVGVQILDSSESPLNLLTPSSDYTLSGDVTNDLQFGARYIATSATVTAGKANAVSTFTVVY. 177
128 4.000e-47gi|503995722|ref|WP_014229716.1| ferrous iron transporter B [Klebsiella oxytoca]  clstr ali  25  1MKKKIVIAILAA----GSALSMTQAFAAAGTVNFNGNILDAACDIDVASQNQVVVLGDYYKTEFPVAGSRTAATKFDIILKNCPVTVTN-AKVRFDGTPDPDNSNLLAIDSSVGAATGVAINLMTADKADLPLGSNGYSYILSSTADNTLNFYAQYMSTAATVVAGPANSVANFSVVY. 175
129 4.000e-47gi|639137349|ref|WP_024482815.1| fimbria A protein [Serratia fonticola]  clstr ali  22  1MKLNKIMMAAVMTLSTLSM--AHAANQGAGTVTFNGSVIDAPCSIDPGSKDQTVELGDIATVQLKKGGK-STPQDFMIKLVGCEIETAQDVTTTFKGAESEALPGLLAMK---GSARGASIAINDTDGKLLPLTTASKKQKV-EDGLVTLRFSAHLQGDGAAITPGEFNTTADFTLAY. 173
130 5.000e-47gi|490229334|ref|WP_004127681.1| fimbrial protein [Klebsiella oxytoca]  clstr ali  22  1MKKNLLAVAL-----MATSVFASSAFASDGAVNFTGSITDAACTVDTASQNQDVFLGNIARTAFPVAGSLAAAKKFTLVLKNCPDTVTG-ATVRFDGAQVSGDNSVLALTAGSTTAKGVGVQISDDQNKVVPLYEDSSVYPLVSTADNKLSFSARYISLTDAVTVGDANAVTQFTVVY. 172
131 5.000e-47gi|518282078|ref|WP_019452286.1| hypothetical protein [Serratia marcescens]  clstr ali  23  1MKLNKIMMAAAVAFGL--SSTAFAADQGHGKVTFTGAIIDAPCSINPDSIDQTVELGQISKVALLNGGQ-STPRNFSIDLENCTFAVKNKVALTFTGMESNANPAN-GLLGITGTAKGASVAITDGSGAVIKLGKPTKTQ-ELQSGSNSLNFAAYLQGDSASITEGEFQAVADFTLAY. 183
132 5.000e-47gi|505181235|ref|WP_015368337.1| fimbrial protein BcfE [Enterobacter aerogenes]  clstr ali  26  1MRLIRYFFLLILLCGSGC-----YADDSGYNLEFTGTIVAQTCDIEISSLSQSIDLGQFSVEDFPSTGTTTKFKPFNINLKNCSRGITGS-KIWFTGTADSDNPALLALSDTGMGASGVGVEILDEDQDAVSINNTSSVVYPLKTGRNTLSFYIRYKSTRPTVTSGNATAVMYFDLQY. 177
133 5.000e-47T2D.3927554 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  26  1MRLIRYFFLLILLCGSGC-----YADDSGYNLEFTGTIVAQTCDIEISSLSQSIDLGQFSVEDFPSTGTTTKFKPFNINLKNCSRGITGS-KIWFTGTADSDNPALLALSDTGMGASGVGVEILDEDQDAVSINNTSSVVYPLKTGRNTLSFYIRYKSTRPTVTSGNATAVMYFDLQY. 177
134 5.000e-47METAHIT O2 GL0034457 [Complete] locus=scaffold11862_2:4298:4840:-  ali  28  1MKLKFISMAVFSALTLGVATNASAVTVNGGTVHFKGEVVNAACAVNTNSFDQTVNLGQVRSERLKVDGAKSNPVGFTIELNDCDSQVSAGAGIVFSGPAVTGKTDVLALQSSAGSATNVGVQITDHTGKVVPLDGTASSTFTLTDGTNKIPFQAVYYATGQA-TAGIANADATFKVQY. 179
135 5.000e-47T2D.2691343 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  28  1MKLKFISMAVFSALTLGVATNASAVTVNGGTVHFKGEVVNAACAVNTNSFDQTVNLGQVRSERLKVDGAKSNPVGFTIELNDCDSQVSAGAGIVFSGPAVTGKTDVLALQSSAGSATNVGVQITDHTGKVVPLDGTASSTFTLTDGTNKIPFQAVYYATGQA-TAGIANADATFKVQY. 179
136 6.000e-47gi|486174387|ref|WP_001534670.1| S fimbriae major subunit SfaA [Escherichia coli]  clstr ali  26  1MKLKFISMAVFSALTLGVATNASAVTVNGGTVHFKGEVVDAACAVSLNSFDQTVSLGQVRSAKLKNDGDKSAPVGFNIELVDCDTQTSNNVSIIFSGAQPAGKDKVLAVQGGAGTATNVGIKVLDYKGQEVSFGTTPSSEYVASSNSASIPFQAFYVAVNGQATAGTANADATFKVQY. 180
137 6.000e-47T2D.3762161 [KEGG:K07348] minor fimbrial subunit;|[COG3539] P pilus assembly protein, pilin FimA  ali  31  12..........FLSSVRFFVLAVSHALAADSTITIRGYVRDNGCSVAAESTNFTVDLMENAAKQFNNIGATTPVVPFRILLSPCGNAVS-AVKVGFTGVADSHNANLLALENTVSAAAGLGIQLLNEQQNQIPLNAPSSAWTTLTPGKNTLNFYARLMATQVPVTAGHINATATFTLEY. 181
138 7.000e-47METAHIT V1 GL0118531 [Complete] locus=scaffold6741_3:1187:1708:+  ali  22  1MRNGMRYLAVALFAL--CSPAHAETALGEINIQLYGNIVDFTCVAEGDDSNKTVTLGTWPTKQLRTTGSRTQPVPFTLKLTGCPPGA---ASVTFTGKMDGHDNSLLALNDAS-AASNVAVEILDRDKTRLALQQASQTVAVDAQGNAELSFYANYIATADNPQPGRADADATFMINY. 172
139 7.000e-47T2D.2141612 [KEGG:K07348] minor fimbrial subunit;|[COG3539] P pilus assembly protein, pilin FimA  ali  22  1MRNGMRYLAVALFAL--CSPAHAETALGEINIQLYGNIVDFTCVAEGDDSNKTVTLGTWPTKQLRTTGSRTQPVPFTLKLTGCPPGA---ASVTFTGKMDGHDNSLLALNDAS-AASNVAVEILDRDKTRLALQQASQTVAVDAQGNAELSFYANYIATADNPQPGRADADATFMINY. 172
140 7.000e-47gi|487416254|ref|WP_001683632.1| fimbrial protein FimA [Escherichia coli]  clstr ali  29  1MKLKFISMAVFSALTLGVATNASAATVNGGTVHFKGEVVNAACAVNMNSADQTVQLGQVRAAKLATAGATSGAVGFNIQLDDCDFGNSQSVKVIFAGASLSNHDDILATQSSAGAASGVGIQILDSKGGVVTLNSDTAAEYTLTTGTNKIPFQARYIAPDGQVTAGTANADATFKVQY. 183
141 7.000e-47gi|639141560|ref|WP_024485046.1| fimbria A protein [Serratia fonticola]  clstr ali  23  1MKLNQLVMALGLGVVMV-AGGANAADQGHGSVTFKGSIIDAPCSIDPETIDQTVNLGQVSNVALQADNNTSIPKNFQIRLEGCNLSTAKTVLTTFSGAEGAN-----GLLGITGTAKGASIAITDGTGKLIELGQASKPQG-IQDGSNTLVFSAYLQGDGASATPGDFSSVADFTLAY. 175
142 7.000e-47gi|501382422|ref|WP_012413988.1| fimbria A protein [Yersinia pseudotuberculosis]  clstr ali  24  1.MSNFKKSVLVAAVLSLSAFAAHAADQGKGKVTFTGSIIEAPCSITSEAADQVVELGQISTASLANMGS-SEPRSFSIGLEKCDVATMKNVSVTFDGTPDGVDAEMLKLI---GLADGAGIVITDEAGATIKRGVASVSKT-LDQGSNSLKFSAYLKGTSASVVPGEFSSVANFTLAY. 175
143 7.000e-47gi|578248851|gb|EUM08942.1| hypothetical protein L465_03034 [Enterobacter sp. BIDMC 29]  clstr ali  24  1MKLNK--VMMATVLALGVSSTAFAAEQGHGKVTFTGSIIDAPCSINPESADQTVELGQISNVALKNGGK-SNPRQFSIDLENCSFEAKNKVTATFTGMESSVVNGALSIN---GTAQGAGVVIAEADGNAVKLGQPTKAQV-LQDNNNSLNFSAYLQGASAAIVPGDFKAVADFTLAY. 181
144 8.000e-47gi|498303364|ref|WP_010617520.1| fimbria A protein [Plautia stali symbiont]  clstr ali  25  1MNMNKIVVALGLSMSLV-AGSAMAAGEGNGTVTFKGAIVDAPCSIELGSVDQTVELGQISNLALKD-GDRSTPRPFQIKLENCDTATKKEVTVTFGGTGSQVIPGKLAI---TGTASGAAIGI-NFGDTEIELGTATPAQ-KLMDGNNQLSFAAFLQGGGATIVPGEFQSVADFALNY. 173
145 9.000e-47gi|504695998|ref|WP_014883100.1| ferrous iron transporter B [Enterobacter cloacae]  clstr ali  28  1..MNKIALGLFIASVIGCSASAFAATDGEGQINFTGEIIDSACQVVNGSNPLNVTLGKVSKTVFTGAGSTSTATKFDIELKNCPETVT-AAAINFGGTPDANNNSTLALTPDADAATGVAIQLIDSSEQPVSLYTPSKEY-PLASGTNDLQFAARYIQTGAAITAGPANSVSTFTVIY. 177
146 9.000e-47gi|545160650|ref|WP_021515528.1| major type 1 subunit fimbrin (pilin) [Escherichia coli]  clstr ali  29  54.....................SVTTTVNGGVIHFKGEVVNAACAIDSESMNQTVELGQVRSSRLAKAGDLSSAVGFNIKLNDCDTNVSSNAAVAFLGTTVTSNDDTLALQSSAGSAQNVGIQILDRTGEVLVLGATFSAKTDLIDGTNILPFQARYIALGQSV-AGTANADATFKVQYL 212
147 9.000e-47gi|558084587|ref|WP_023479082.1| type-1 fimbrial protein, A chain [Enterobacter cloacae]  clstr ali  28  1MKTRPIVISLAASMMLFSGLAQARAPVPGGNIHFEGELVQVACAISVQSNSQTVAMGQYHTTLFSNVGDTTPPVPFTLTVNDCDRSVATQASVAFAGKADNVDPTLLALTAGASGATGIAIEILDSNSETLKPDGATSVAQNLASGNNTLQFAARYKATAAEVTPGSANADTMFIMKY. 183
148 9.000e-47gi|490856805|ref|WP_004718848.1| fimbria A protein [Yersinia ruckeri]  clstr ali  27  3MKLNKLKMVLGMIVVMAAAANAAPKDQGHGTVTFNGSIIDSPCSITPDTIDQTVNLGQVSNVALKDGGK-SKPKNFQIKLENCDXXXXXXXXXXXXGATSTGNPDLLGI---TGTARGASIAITNGSGDVLKLGESGKPQT-IQDGNNSLAFSAYLQGDGASATPGEFQSIANFSLAY. 178
149 1.000e-46gi|506490098|ref|WP_015965476.1| P pilus assembly protein, pilin FimA [Enterobacteriaceae bacterium strain FGI 57]  clstr ali  27  1MKLSTIASTVMASFVLMTAAQAAAVSVNGGSVHFKGELVNAACAVNTESSDQIVELGQYRTAKFTAVGDTTTNMPFTIVLNDCDPSVSATAAVAFSGQADATDATLLAVNATNNAAKGVGIEILDSKSKTLSPGATFSSAQTLLQGTNTLNFTARYKATADTAEPGQANADATFVMKY. 182
150 1.000e-46gi|446766292|ref|WP_000843548.1| type-1 fimbrial protein subunit A [Escherichia albertii]  clstr ali  22  1..MKSVFISSIIAVTLFATANTYAATTNGGVIHFEGELVNAACAVNTESADQVVSLGQYRTDLFNAVGATSASIPFTIELNDCDVSIAATAAVAFSGQADGNNDDLLAIVSGTNTATGVGIEILDNTSKTLKPGSVFSEAQSLITGTNVLHFSARYMGTGLSATAGQANADATFIMQY. 179
151 1.000e-46gi|504470340|ref|WP_014657442.1| fimbrial protein [Providencia stuartii]  clstr ali  22  1MKK----LFLLALVSSAMSTSVLAADMGHGKVNFKGSIIDAPCSISPDSIDQTVELGQISNVALVGGGKSSPRT-FDIALENCDMTGFKGVQLTFSGAAASFDNTN-KTLGIVGTGAGAGVQITNGSGNIITLGEPT-PFQNIQDGNNTLRFSAYLVGNGDTITPGEFSSVADFTLSY. 175
152 1.000e-46gi|521253401|ref|WP_020439966.1| fimbria A protein [Serratia plymuthica]  clstr ali  27  1MKLNKFMLAAVLALGATSMMAQADINQGRGTVTFKGAIIDAPCSITPETVDQTVNLGQVSNVALKDGGK-STPKNFQIKLENCDLNPGNAVSITFSGAASSFDPNLLGI---TGVAKGASIAITDGSGEVIKLGQATKAQT-LQNGNNTLSFAAYLQASSAAVIPGEFQSVADFTLAY. 186
153 1.000e-46gi|493872432|ref|WP_006818903.1| adhesin [Yokenella regensburgei]  clstr ali  19  1..MTNRFAWFAGCWLLSAGVVQAETPLGEINIELRGNVVDFTCVAEAGDSDKTVPLGTWATKQLRPTGSTTSQVPFSLKLTGCPP---GSASITFSGKPDPKDSTLLALNGNSQ-ASNVAVEIRDKDRSRLPLDQASQEVVVDAQGNVTLQFFANYIATAEDPQPGVADADATFMINY. 172
154 2.000e-46gi|640469909|ref|WP_024910586.1| fimbria A protein [Serratia fonticola]  clstr ali  28  1MKLNKLMLATVIAFSAVSVAQAAP-NQGGGTVTFDGDIIDAPCSVAPESVEQTVPMGQISSKVLANEGK-SSSEAFNITLKDCNFSTQRSVKIAFTGLPADGNSELLGL---AGTARGAGIQLVHGTNEKIAIDGTQISVNNLNAGDNILRFAAYLQGSSATVEPGDFTSVVNFTLTY. 175
155 2.000e-46gi|446096412|ref|WP_000174267.1| fimbria A protein [Salmonella enterica]  clstr ali  23  1MTLNKL-IATTIALGFICTANAAPLDSGHGTVKFKGSIIEAPCSITPDTVDQTVDLGQISNVVLKDGGK-SSPKNFYIKLENCDVSTVKTVSTTFTGAPSAGNPDLLGI---TGTARGASIAITDGAGSTIKLGDATKPQG-IQNINNTLAFSAYLQGTGADIVPGEFSSIANFTLAY. 179
156 2.000e-46gi|491055799|ref|WP_004917444.1| type-1 fimbrial protein subunit A [Providencia stuartii]  clstr ali  26  1MKVKSLALVIVALSLSSVAAVAETTTVNGGTVHFKGELVNAACAVDANSVEQTVRLGQFRTAKLAQAGDTSSPVGFNIQLNDCDTTVATSAKVAFRGAANAANPTVLAVSGSAGSATNVGIQILDSKSVPLELGATFSSAITLNDGNNVLPFQARYYALGAT-TAGIANADATFAVQY. 181
157 2.000e-46gi|500910545|ref|WP_012015814.1| fimbria A protein [Enterobacter sp. 638]  clstr ali  23  1.MNFKKAALASVMGMLLVAGAANAKDQGHGKVTFTGSIIDAPCSINPDSIDQTVSLGQVSNVALKAGAGTSVPRNFEIKLEGCDTTTLKSVKTTFTGAEGATDGSL----GITGTAKGASIILTNGDGVQIKMGEASAAR-QLQDGNNTLLFSAYLKGDGASATPGDFTAVADFTLAY. 176
158 2.000e-46gi|554683985|ref|WP_023183901.1| fimbrial protein [Salmonella enterica]  clstr ali  27  1..MNGKLFKSALVCSSLLLGWQAHAANGNGIVHFTGEIIDNTCEVSTTTKDQTVDLGKVSKSTFTGVGSTASVQAFQIDLINCP-DTYKKATARFDGTEDGD--GYLKLN--AGGASGVAIAIYNADNSLLKLYNQSASAAIGADGKATLPFLARYIATSAAVTSGVANADSEFTITY. 172
159 2.000e-46gi|503835211|ref|WP_014069205.1| adhesin [Enterobacter asburiae]  clstr ali  22  1....MRRLSKALLLVALVHANAHATTAGEINIELYGNIVDFTCVAEGSDSDKIVTLGTWPTKQLSTTGSRTQPVPFTLKLTGCPPGA---ASITFSGKEDGSDSGLLALNDSSQ-ASNVAVEIRDRDKTRLALQQASQTVAVDTQGNAELSFYANYIATADNPQPGRADADATFMINY. 171
160 2.000e-46gi|493521961|ref|WP_006476057.1| fimbrial protein [Burkholderia cenocepacia]  clstr ali  30  28MKKSILSAVALAALSTSAFA------AGTGTINFTGEIVAGACGIDSNSVNQTVQLGKVPTNKFKQAGDKSDPVSFDIKLTDCDTSIAQNAYFTFTGTSSAGQPKLLA---TIGSATNVGIRLQAASGEYLDNGAEQKAPTLLQNGTNTARFAAMYEATAAGVTPGTADGVANFTVRY. 196
161 2.000e-46gi|493863061|ref|WP_006809811.1| adhesin [Enterobacter hormaechei]  clstr ali  22  1MRNGMRCLAVALFALCPHAYAETA--LGEINIQLYGNIVDFTCVAEGDDSNKTVTLGTWPTKQLRTTGSRTQPVPFTLKLTGCPPGA---ASVTFTGKVDGHDNSLLALNDAS-AASNVAVEILDRDKTRLALQQASQTVSVDAQGNAELSFYANYIATADNPQPGRADADATFMINY. 172
162 2.000e-46gi|493365955|ref|WP_006322373.1| fimbria A protein [Serratia plymuthica]  clstr ali  23  1MKLNKI--MLAAAMTLGTISMANAANQGSGSVTFKGTIIDAPCSIEPGSLDQTVKLGDIASGQLKNGGK-SIPQDILIKLVGCDVETAKTVTTTFSGTESDATPGLLAMK---GSARGASIAINDIDGKVLALGKASKGQ-QIEDGQATLRFSANLQGDGAAIVPGEFNSVADFKLAY. 173
163 2.000e-46gi|573497826|gb|ETS98372.1| fimbria A protein [Providencia alcalifaciens PAL-3]  clstr ali  25  1MKLNKTLMAIAATTLIGFGANAAPVNHGNGKVTFTGSIITAPCSIDPSSIDQTVDLGQIADVVLKNGGTQSSPVMFDIKLIDCTVETGDSVNITFSGAAATNDPKSL--LAITGTAAGAGIQIVDSNNDPIVLNEVTKSEHKLQGTTNTLQFAAYVKGLGSDIVAGEFQAVTDFVLSY. 187
164 2.000e-46gi|503580864|ref|WP_013814940.1| MULTISPECIES: fimbria A protein [Serratia]  clstr ali  25  1MKLNKIMMAAVLAFGATSMMANAAVDQGHGTVTFTGSIIDAPCSITPETVDQTVDLGQVSNVVLKDGGK-STPRNFQIDLENCELTKTGDVSLTFTGMESSAKNGRLGI---TGTAQGASIAITDGAGSVIKLGTPTQTQT-LQNGNNTLSFAAYLQGDNASVVPGDFQSIADFTLAY. 181
165 3.000e-46T2D.2692700 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  23  20MKIKTLAIVVLSALSLSSTAALAAATVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLDQDGATSSAVGFNIQLNDCDTDVASKAAVAFLGTTDTNHTNVLALQSSAGSATNVGVQILDKTGTALALDGASSAQTTLNNGTNTIPFQARYYAIGAA-TPGAANADATFKVQY. 200
166 3.000e-46gi|499946493|ref|WP_011627227.1| ferrous iron transporter B [Shewanella sp. MR-7]  clstr ali  26  6.........ISLLALMAGLAISYNANASDGQINFTGTITDETCTVTNSSSPLSVTLGSVAKSAFSGVGSTAAATKFTIMLTGCPQSANNSVSVKFDGIADGTNKDVLALTAGEGVAEGVGIQLTEDNGTVLPLFSASSSFT-LADGDNKLNFIARYIATSATVTAGTANAVSNFTIIY. 175
167 3.000e-46gi|648277846|ref|WP_026058995.1| hypothetical protein [Enterobacteriaceae bacterium LSJC7]  clstr ali  26  7........................AWSYDVTININGIISESGCELDSRSKSFTVTLGDVVSTSLRGQGATSTAIPFSIFLINCN-SLANAVVVTFNGTPDATDSRLLRIFEEEGSASGVGIEILDHNNQAIAINSPAESHPLIPNADAQLQFYARYKSTG-AVTAGPANAVATFTLEY. 158
168 3.000e-46METAHIT V1 GL0019396 [Complete] locus=scaffold14526_9:346:882:+  ali  29  1..MNKVALGLFIATTVGCSASAFAETNGEGQINFTGEIIDSACQVVNGSNPLDVQLGKVSKTVFTGAGSTSTLTKFDIKLTNCPETVT-SAAINFGGTPDADNNATLALTPDTDAATGVAIQLMDASGQPVTLYTPSKQY-PLASGTNDLEFGARYIQTQAAVTAGPANSVSTFTVIY. 177
169 3.000e-46T2D.2144214 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  29  1..MNKVALGLFIATTVGCSASAFAETNGEGQINFTGEIIDSACQVVNGSNPLDVQLGKVSKTVFTGAGSTSTLTKFDIKLTNCPETVT-SAAINFGGTPDADNNATLALTPDTDAATGVAIQLMDASGQPVTLYTPSKQY-PLASGTNDLEFGARYIQTQAAVTAGPANSVSTFTVIY. 177
170 3.000e-46gi|504406036|ref|WP_014593138.1| fimbria A protein [Pantoea ananatis]  clstr ali  24  1MKLNK-AVKSFGLCAMMVAFGATAADQGHGEINFKGSIVDAPCSITAESANQTVDLGEVTNAALKNGGK-STPKAFTVKLEQCDTATSESVTATFTGAASAGNKDLLGI---TGTASGASIAITNGAGQIIKLGEESPAQS-IQDGTNSLAFSAYLQGDVATIVPGDFTSVANFTLAY. 179
171 4.000e-46gi|504470871|ref|WP_014657973.1| fimbrial protein [Providencia stuartii]  clstr ali  23  1MKMKSIAMATFMALGLASA--ANAADQGHGKITFKGAIIDAPCSISPNSIDQTVELGQISNMALVDGGK-STPRPFEITLDNCDITLAKGVQLTFSGAAASFDNTN-KTLGIVGTGAGAGVQITNGSGNVVTLGTAT-PFQQIQNGNNTLNFAAYLKGNGDTITAGDFSSVADFTLSY. 177
172 4.000e-46gi|639141210|ref|WP_024484706.1| fimbria A protein [Serratia fonticola]  clstr ali  22  1..MTMNKTLLAVAVIFGMSSLAHAADQGHGKVTFTGSIIDAPCSIAPESSDQTVELGQISNVALQDGG-MSKPKSFDIKLDGCSPAAKNKVAVTFAGIESVAGNGLLGI---TGGAKGASVAITDGAGTVIELGKPTKEHV-LQGDNNTLTFAAYMQGDGAAATEGDFQAVTDFTLAY. 176
173 4.000e-46gi|493872427|ref|WP_006818898.1| type-1 fimbrial protein subunit A [Yokenella regensburgei]  clstr ali  29  15MKLKTIAALVATLGLVATAANADAVSVNGGTVHFKGELVNAACAVSTASSNQTVELGQYRTATFTKTGDTSAKIPFSIVLNDCDPTVAATAAVAFTGQIDAQDKTLLAIASGDNTAGGVGIEILDSSGTLTPNGSVFSAAQNLIQGTNTLHFSARYKATADTTAPGQANADATFVMKY. 196
174 4.000e-46T2D.3274692 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  26  1MKKSLVLVALTATAALSMS----HAFAAAGTVNFVGNILDTACEVDVASQNQQVNLGNFYKTEFPSSGTKAAAKDFNIVLKNCPTTVTST-KVRFDGTPDLTNPNLLAITSTSSAASGVAINLMTADKVDLPLGENSYNYILSSTQDNTLKFYAQYISTTASVTPGTANSVANFSIVY. 175
175 4.000e-46gi|583709272|gb|EWF71383.1| hypothetical protein L385_03368 [Klebsiella pneumoniae MGH 39]  clstr ali  25  1MKNMSLKVMSLAFIMTASSAAFADVNGGSGTIHFTGTVIDAPCSIAPESIEQTVELGSVALSSLKTAGSHSRPATGEIKLVDCTTTTYSKVGVTFSGTPDATVAALLANDSS---AQGVGVRLLDQDGKAIELGSETE--YPLGNG-ATIIYQAYVEANGNTVTAGDIRSDATFKLNY. 180
176 4.000e-46gi|546164300|ref|WP_021806160.1| Fimbrial protein [Serratia fonticola]  clstr ali  26  1MNKNLLAVAV-----LXXXXXXXXXXXXDGKVNFAGEIIDQACTVHSDSENQTVTLGKVFVGAFKGAGVTAASKDFSLILQDCPDTV-KAATVRFDGIQVAGNDAVLALTDEPGVATGVGVQIADNNNKVINLHTDSSVYPLSSTEDNVLGFVARYYATSATVTAGKANAVSNFTIIY. 173
177 4.000e-46gi|486177647|ref|WP_001536563.1| S-fimbrial protein subunit SfaA [Escherichia coli]  clstr ali  27  1MKLKFISMAVFSALTLGVATNASAAPANGGTVHFKGEVVDAACAVNTNSANQTVLLGQVRSAKLANDGEKSSPVGFSIELNDCSSATAGHASIIFAGNVIATHNDVLSLNSAAGSATNVGIQILDHTGTAVQFGATASTQFTLTDGTNKIPFQAVYYATGKS-TPGIANADATFKVQY. 181
178 5.000e-46gi|502224345|ref|WP_012737267.1| ferrous iron transporter B [Klebsiella pneumoniae]  clstr ali  26  1MKKTITIVCFMLA--------AGSAMAADGTINFTGSITDQTCTVDSGSQNLNVNLGKVAQTALNAAGMKAAPTRFTLSLSDCPDTVTG-ANVKFDGTSDGVNQNLLALDNGTGIATGVGIEIADKNGTAIPLHTASPDYT-LAAGANSLDFIARYVSTGAAVTTGTANGTSQFTINY. 169
179 5.000e-46T2D.3279886 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  24  1MKKTMLSACFML--------AAANAMAADGTIHFTGSITDQTCKIDTGSQNLPVNLGNVAQTALNGAGMRAAPTQFTINVSECPETVTG-ANVKFDGTSDNNDQSLLALDSGTGIATGVGIQIADKNGTAIPLHSASSDYT-LAEGANALDFVARYVSTGPAVTIGTANGTSEFTIIY. 169
180 5.000e-46METAHIT MH0008 GL0025811 [Complete] locus=scaffold13109_11:784:1311:+  ali  27  7............LLGALFTLGAPAAFAADSTITISGYVRDNACAVAGESKDFTVDLQDNAAKQFYAVGATTPPVPFRIVLSPCGTSV-TAVKVGFTGVADSVNTSLLKLDAGTSAAAGMGVEILDQQQSRLPVNAPSSTWTTLTPGTNILNFYARLMATQVPVTAGHVNATATFTLE.. 173
181 5.000e-46METAHIT MH0079 GL0017572 [Complete] locus=scaffold53628_1:2648:3253:+  ali  26  20MKIKTLAIVVXXXXXXXXXXXXXTTTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLKQAGATSSAVGFNIQLNDCDTTVATKAAVAFLGTADATRTDVLALQSSAGSATNVGVQILDRSGNALTLGATFSAQTTLNNGTNTIPFQARYYAIGEA-TPGAANADATFKVQY. 200
182 5.000e-46gi|499198240|ref|WP_010895780.1| SefA [Serratia entomophila]  clstr ali  27  1MKINKIASVL-LLASGLTAFGANAADQGSGRVTFTGSIIEAACSVNPESSDQEVDLGQIAASQLADGGS-STPRNFEILLENCDADKANTVTVTFGGSAADSSNQLLGI---TGTASGAGVAVTDGSGNLITLGQATGAR-ELIEGSNTLNFSAYLQGISTEISTGEFQSVADFTLAY. 174
183 5.000e-46gi|497340217|ref|WP_009654430.1| MULTISPECIES: ferrous iron transporter B [Enterobacteriaceae]  clstr ali  24  1MKKTMLSACFML--------AAANAMAADGTIHFTGSITDQTCKIDTGSQNLPVNLGNVAQTALNGAGMRAAPTQFTINVSECPETVTG-ANVKFDGTSDNNDQSLLALDSGTGIATGVGIQIADKNGTAIPLHSASSDYT-LAEGANALDFVARYVSTGPAVTTGTANGTSEFTIIY. 169
184 5.000e-46gi|569537117|gb|AHE59424.1| fimbrial protein FimF [Escherichia albertii KF1]  clstr ali  29  11..............CAFLWLVASSALAADSTITIRGYVRDNGCFVAAESTNFTVDLMENAAKQFNNIGATTPVVPFRILLSPCGNAV-TAVKVGFTGVADGNNANLLALESHSSSAAGVGIQLLNEQQNQIPLNAPSSSWTTLTPGKNTLNFYARLMATQVPVTAGHINATATFTLEY. 176
185 5.000e-46gi|504694785|ref|WP_014881887.1| MULTISPECIES: fimbrial protein [Enterobacter cloacae complex]  clstr ali  27  1MKGNTLKSIVVLSSLFF--GAQTHAANGNGTVHFTGEIIDSTCEVSTGTKDQTVDLGKVNKSTFTGVGSMASVQAFQIDLLNCP-DTYKKASARFDGTEDGD--GYLKL--SSGGASGVAIAIYNADNSLLKLYNQSTPAT-ISSGKASLPFMARYIATSATVTAGTANADSEFTITY. 171
186 6.000e-46gi|495230492|ref|WP_007955263.1| fimbrial protein [Pseudomonas sp. GM25]  clstr ali  28  1MKKIVAVTAATVVMGLAFANAASPASGNPGTVRFIGEIVSGACGIDANSLDQTVSLGQVPSNQFKAIGDRSTPTKFDIVLTDCDTATQKNARFTFSGVQDPAVPALFA---TTGLAQNVGIRLQASAGEMLDNGKEQVAPVVLQNGNNTVTFAAMYEATAATVTTGEADSVANFTVAY. 176
187 6.000e-46gi|639216401|ref|WP_024554142.1| fimbrial protein [Cronobacter helveticus]  clstr ali  34  1MRQKKRLCSTLILSGFLLSLPVQAITDYDGDVRFFGEVVNAACAVAVDSQDQTVLMGQVRSNSFTDLGEWTDPHPFRIKLEDCSTNVSQNVGVMFSGETDGKDLLVFRTGNGAGAAEGIGIGITDATGQLIIPNTAPARYAPIQEGETVLHYTARYRSTSRTVKAGNASAQVWFNLFY. 184
188 6.000e-46gi|575850200|emb|CDL87344.1| Similar to fimbrial subunit type 1 [Xenorhabdus cabanillasii JM26]  clstr ali  24  1MKTKLIISSLFVSSVFMSLAHAANGNIQDGEIRFTGKVIADACKIDPTSKNQTVNMGTISTNSFNGVNSTAAATHFSIKLTDCPK-INEYASVKFDGQLDNINNALLALDNSPGAADGIAVGIYEQNNTPIPMAKTSS-QKIIENQKIEMNFIAKYVATKQTITPGTGNAVANFTIVY. 178
189 6.000e-46gi|500911849|ref|WP_012016396.1| adhesin [Enterobacter sp. 638]  clstr ali  23  1.MRKTMLIAVMTLLGAPMQGSLAATPLGEINIELYGNIIDFTCVAEGSDSNKSVTLGTWPTKQLSTTGSRTQAMPFTLKLTGCPPGA---ASITFTGKIDTHDPQLLALNDASQ-ASNVAIEIRDQDKMRLPLQQASQEVVVDVQGNAVLAFYANYIATANNPQPGRADADATFMINY. 173
190 6.000e-46gi|502861993|ref|WP_013096969.1| ferrous iron transporter B [Enterobacter cloacae]  clstr ali  25  1MMKNKM---MITLLAVGSALTATHAFAAAGTVNFNGNILDSACDVDVASQNQVVVLGDYYKTEFPTTGARTAATQFNIVLKNCPVTVTN-AKVRFDGTPDATNSSLLAIDSSAGAATGVAINLMSADKADLPLGSNSYSYVLSSTADNTLSFYAQYISTAATVTAGPANSVANFSVVY. 176
191 6.000e-46gi|505192245|ref|WP_015379347.1| fimbrial protein [Serratia marcescens]  clstr ali  25  1MRLRALALLSCAPWWFAAMPAAANTELIGAPVQFHGTVVSRPCNIEPQSADQLVEMGTVIVKTLYRYGHTT-PVPFSIKLTDCKTTVFKSVSVTFSGAEDGELPGKLAINNG---ANGAAIALFDHQGADISLNKATSA-VALQNGPNNLNFTAYVQGRPSAITEGEFTSVANFVLAY. 178
192 7.000e-46gi|490216814|ref|WP_004115193.1| MULTISPECIES: fimbrial protein FimF [Klebsiella]  clstr ali  24  1MMRKNLYLLGAILSLVSFSTP-----AADSTITISGYVRDNTCAVAGESKDFTVDLMNNAAKQFNAVGTTTPLVPFRIVLSPCGGSV-TAVKVGFTGIADSDNTSLLKLDSGVSAASGIGVQILNGSRAPLVLNAPSSAWTTLKPGTNTLNFYARLMAARVPITAGHVNATATFTLE.. 174
193 7.000e-46T2D.3805101 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  25  1MKNMSLKVMSLAFIMTASSAAFADVNGGSGTIHFTGTVIDAPCSIAPESIEQTVELGSVALSSLKTAGSHSRPATGEIKLVDCTTTTYSKVGVTFSGTPDATVAALLANDSS---AQGVGVRLLDQDGKAIELGSETE--YPLGNG-ATIIYQAYVEANGNTVTAGDIRSDATFKLNY. 180
194 8.000e-46gi|498114113|ref|WP_010428269.1| adhesin [Enterobacter mori]  clstr ali  20  8........IAAGVLMMLHAGAQAATALGEINIEMSGNIVDFTCVAEGNDSDKVVTLGTWPTKQLRTTGSRTQPMPFTLKLTGCPPGA---ASITFSGKADGSDSGLLALNDGS-TAGQVAVEIRDADKTRLDLQQASQPVTVDAEGNAVLSFYANYIATADNPQPGRADADATFMINY. 173
195 8.000e-46gi|499458949|ref|WP_011146413.1| fimbrial protein [Photorhabdus luminescens]  clstr ali  24  1MKAKLI-----ISSLLASSVFISVANAADGKINFTGNIIANACKIDTDSANQNVNMGTISSNAFSGVDSTAAATPFSIKMSDCPPE-YTHAQVKFDGQIDNRNNNLLALSNDKGVADGVAIGIYEEDNTLIPLAKASKSQAFTDQKTAELKFIAKYVATAQAISPGSGDAVANFTIVY. 175
196 9.000e-46gi|595620999|gb|AHM77756.1| FimF protein precursor [Klebsiella pneumoniae 30684/NJST258_2]  clstr ali  27  41............LLGALFTLGAPAALAADSTIAISGYVRDNACTVAGESKDFTVDLQDNAAKQFYAVGATTPPVPFRIVLSPCGTSV-TAVKVGFTGVADSVNTSLLKLDAGTSAAAGMGVEILDQQQSRLPVNAPSSTWTTLTPGTNILNFYARLMATQVPVTAGHVNATATFTLE.. 207
197 9.000e-46gi|489143349|ref|WP_003053114.1| Fimbrial protein [Comamonas testosteroni]  clstr ali  24  9.RLKYIHSLAAFALGLLMAGMALPALALDGIATFKGNLINAPCTLRPADEDLKVDLGQIFQNDFYQTG-RSDSKPFTIHLDDCDAGLASSVKVKFSGSENTSLPGLLALDTGGGT-RGVAIAIENAAG-VLPINTQTSA-LPLNAGSNDLHFTAYVQGESKTIVPGPFVATATFTFQY. 187
198 9.000e-46gi|490223914|ref|WP_004122273.1| type-1 fimbrial protein subunit A [Klebsiella oxytoca]  clstr ali  28  1MNKLAVIVFXXXXXXXXXXXXXDPVTVNGGTVHFKGEVVNAACAVDAGSLDQTVQLGQVRSAKLAAAGNTSAPVGFNIQLNDCDITVSEKAAIAFAGTANSTNPTVLALQGSAGGATNVGVQILDRTGTPLALGATFGAQTTLSNGTNVIPFQARYFATGVA-TAGTANADATFKVQY. 180
199 1.000e-45gi|577076939|gb|EUD12932.1| fimbrial protein [Providencia alcalifaciens 205/92]  clstr ali  22  1MKKNLLASLIAASSIFAV----NSALAADGTIDFTGEITDQACELAAGSDALKVNLGKVSKKALPSAGSTAAATKFTIKLINCPTTV-TSASVKFDATSYPGDDSVLKNAGQSGVAKGVGIQITDDVNTVIPLFTASKAYPLKDGVENNLDFRARYIAQTDSVDVGLANANATFTINY. 175
200 1.000e-45gi|502386190|ref|WP_012776913.1| fimbria A protein [Photorhabdus asymbiotica]  clstr ali  27  33MKLNKLVMALGLGVVLAVSVNAANPSQGHGTVTFTGSIIDAPCSITPETVDQVVPMGAISNAALKNGG-RSSSRSFKISLENCTTDTISTVTTTFVGAKSNGGDGLLGIE---GTAKGAGIAITDAGGNKIKLGTPSPA-VALHDGNNDLNFAAYLQGTPDAVVPGEFTGIANFQLAY. 210
201 1.000e-45gi|499644784|ref|WP_011325518.1| fimbrial protein [Burkholderia pseudomallei]  clstr ali  28  41MKKALLSAVACAALSTSAFA------AGTGTLNFTGEIVAGACGIDAGSVDQTVRLGFVPANTFKAAGDKSTPQNFDIKLVDCDTSVAKNAYFTFTGTSNATQPKLIA---TVGSATNVGIRLQSASGEYLDNGAEQKGPVVLSNGTSVARFAAMYESTAASVTPGTADGVANFTVRY. 209
202 1.000e-45gi|639142058|ref|WP_024485521.1| fimbria A protein [Serratia fonticola]  clstr ali  24  1..MFMKKTLLAAVIALGSVSVAQAGELGHGKVTFNGSIIDAPCSISAKSIDQTVELGQISNVALKDGGKT-EPHHFSIDLESCDLGTTNKVVITFSGAESTAQQGLLAI---SGTAKGASVAIAQGNGELIKLGTATKEQV-LQNGSNSLKFAAYVQGTAATITEGSFQASADFTLAY. 177
203 1.000e-45gi|639223547|ref|WP_024560782.1| fimbrial protein [Cronobacter pulveris]  clstr ali  22  1MKKHVLALVVTALMAGGTVSAAQAADVAGGTVNFIGEVVNAACAVSADSVDQTVTLSQVRTVRLATAGQAAGQKDFQIKLEDCDTTVSTAAAVMFNGQEDADVAGTLANTAGAGAAKNVALQLYGPDGKVLPMGDKSSS-ITLVDGSNVVPLSVDYIATKAASTPGNVAAVATFNMIY. 180
204 1.000e-45gi|501083974|ref|WP_012134485.1| fimbrial protein FimF [Citrobacter koseri]  clstr ali  26  1MMMKKPLYFLGAVLTLACV----NVFAADSTITISGYVRDNACAVAGESKDFTVDLMNNAAKQFNAVGATTPLVPFRIVLSPCGNSV-TAVKVGFTGTEDSSNTCLLKIDSGASAAAGMGVQILNNQQTMLPLNAASSAWTTLTPGTNILNFYARLMATQIPVTAGHVNATATFTLE.. 175
205 1.000e-45gi|640698518|ref|WP_025122546.1| MULTISPECIES: hypothetical protein [Serratia]  clstr ali  24  1MKKNLIAAAVLASSTLGMS-----AFAVDGQVNFTGEIVDVACQVTNSKANLKVNLGKVSKSTFKAAGDVASATKFSLQLTACPDTVT-SAQVKFDGTSVNGDNSVLALTQDAGVAEGVGIQLSDDSNNLLPLFENSRTYELKPNVANDLSFVARYVATEATVKAGPANSTASFTINY. 173
206 1.000e-45gi|496187225|ref|WP_008911732.1| minor F1C fimbrial subunit [Providencia burhodogranariea]  clstr ali  37  3.KLISLIVVLCSASFHVLAGDKHHVIIDGGMVHLRGGLVEAGCSVSTEDEQNIINMGKLRTNQFKGAGSYTEPVTFKIKLTDCSTAISEKVSISVFGSINDRDPQIFKLEQSDAAAKGVGIALFDTNGEIILPNMLPTKWISFHEGESILSFNARYRATDMQVIGGKANASLWFNLIY. 179
207 2.000e-45gi|493872428|ref|WP_006818899.1| fimbrial protein FimI [Yokenella regensburgei]  clstr ali  28  1..MIRKFCWIGVFCLVAIPASAHRVVVDGGSVHMRGQLVNGACAVSPESENMRIDMGQYRTNSFSGVGNFSTTVPFSIRLVDCHTDVSRLVGVAFQGLTPAEDPQVFVASTRVGGASGLGLGLFDQRQQLIEPNAPPLNYEPINSSEMTLHFSARYRVISLPLIPGNIHSDVWFTLVY. 180
208 2.000e-45gi|652343951|ref|WP_026741142.1| type-1 fimbrial protein subunit A [Lonsdalea quercina]  clstr ali  26  1MRKTLLGALIGASILSAGYASA-ATTVAGGTVHFTGQIVNAACAVSSTSANQTVNLGQYRTANFTAVGAYSGKVPFTIKLEDCDPTVSTTAAVAFSGSADGNDNTVLSTSNSSGAAAGVGIEISDSKGTVLSPGAAFSSPQTLITGSNTLNFNARYKSTLATVTPGEADADATFTMQY. 182
209 2.000e-45gi|491172716|ref|WP_005031083.1| type-1 fimbrial protein subunit A [Acinetobacter bereziniae]  clstr ali  25  1MKK-----LGLLAAACVMSSASFAAPVNGGTVHFVGELVNAACAVSTDTADQTVDLGQHRTARLAVAGDKSGPVPFNIQLVDCDASVTNGVSFAFNGQTVSTNNKLLAVNGGGGAATNVGIEITDYASKILAVGSDFSTEKAIIDGTNTFPFTARYVATGAS-TPGKANADATFVVNY. 177
210 2.000e-45T2D.2919414 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  24  1MKRNIIGGAFTLASLML----AGHALAEDGVVHFVGEIVDTTCEVTSDTADQIVPLGKVSKNAFSGVGSLASPQKFSIKLENCPAT-YTQAAVRFDGTEAPGGDGDLKVTGQAIAATGVGIRIFNSDNSQVKLYNDSAYTAIDAEGKAEMKFIARYVATNATVTAGTANADSQFTVEY. 188
211 2.000e-45JGI.Meta JGI_HUM.1438223 7053857087 SRS017521_Baylor_scaffold_16051__gene_28337 lpfA [Human Stool microbiome from visit number 1 of subject 160502038]  ali  24  1MKRNIIGGAFTLASLML----AGHALAEDGVVHFVGEIVDTTCEVTSDTADQIVPLGKVSKNAFSGVGSLASPQKFSIKLENCPAT-YTQAAVRFDGTEAPGGDGDLKVTGQAIAATGVGIRIFNSDNSQVKLYNDSAYTAIDAEGKAEMKFIARYVATNATVTAGTANADSQFTVEY. 188
212 2.000e-45gi|495127477|ref|WP_007852288.1| PapA [Cronobacter sakazakii]  clstr ali  26  1MKFSKVSLA-AAMGLMLAAGMANAQDQGHGKVTFTGSIIDAPCSIHPDSIDQTVGMGQISNVALKANGNTGTSVPFEIKLENCDVSTLKTVKTTFTGAEGATDGSL----GITGTAKGASIILTNGDGQQLKLGEASAAH-QLQEGNNTLLFSAYLQGDGASATPGDFTAVADFTLAY. 176
213 3.000e-45gi|502860959|ref|WP_013095935.1| adhesin [Enterobacter cloacae]  clstr ali  21  8.........FAALALTMCQANAWSATAGEINIQMYGNIVDFTCVAEGSDSDKTVTLGTWPTKQLSTTGSRTQPMPFTLKLTGCPP---GSASITFSGKTDGSDSGLLALNDAS-TANNVAVEIRDADKTRLALQQASQPVAVDAQGNAVLSFYANYIATADNPRPGRADADATFMINY. 173
214 3.000e-45gi|639126292|ref|WP_024474426.1| fimbrial protein [Morganella morganii]  clstr ali  22  1..MSMKKVVLALAVSSVMAMTAQAANQGGGKINFHGEVIDAACSIDANSLKQTVELGSVAKVQLAKGGK-STPVDFTIQLHNCDITSGKTATVSFNGIAGDSAKGLDKAFGVSGPASGMGVVITDAGGNVIAPGDTSNAFT-LNDGDNELNFKAYMQGDSNAVAPGAFTATADFVMAY. 178
215 3.000e-45gi|501408459|ref|WP_012440025.1| fimbria A protein [Erwinia tasmaniensis]  clstr ali  24  1MKLNKIMMVAAIAFGA--SSIAHAANQGQGVVKFEGSIIDAPCSINPDTVDQTVNLGQVSKIALKDGGQ-STPKEFQILLENCEIEEGKNVSLTFTGVKAA--SGNLAIN---GEAKGASILLSDTSGKPIKLGTATAAH-KITEGKNILRFNAALQGDGKAVTPGNFTSVADFTMAY. 172
216 3.000e-45gi|490362058|ref|WP_004241821.1| Fimbriae-like adhesin SfmA [Morganella morganii]  clstr ali  28  4.KQRLVMSVVALAVLSASQLSMAATTVTGGTVHFTGRIVNAACAVSADSTDQTVNMGQYRTAFFNAKGKKSGDVPFSIKLEDCDTSVSTKASVSFSGLSSADDPTALQTSNSAGAAKGVGIQIADHLGKVVKPGSVFSTAQNLVDGVNVLNFSANYISTQATVTPGGADADATFTMQY. 185
217 3.000e-45gi|15042714|gb|AAK82430.1|AF396083_9 MrfH [Photorhabdus luminescens]  clstr ali  24  1MNYFKLFVLRVGLMIVATAVYCNQVVQAADNMRFYGALVEEPCTIKPGDEDIRLDLGTIAEKYLYLHG-RTNSEPFQLRLSGCDMSVGKSIKLTFSGVENRQLPGLLALSAGSQ-ASGIAIGIETAEGKRLPLNKDGDAY-PLKKGENVIILKAYVQAEPTTIKRGAFHAIATFNLNY. 180
218 3.000e-45gi|516438115|ref|WP_017827027.1| type-1 fimbrial protein, A chain [Proteus mirabilis]  clstr ali  30  1..MSKLNKSLCALGVTLSIFSAPAALA-SGTINFTGEITDQACTVDGSSKNLTVDLGKVSSKSLATKGEVAGLKDFTIKLIDCP--VDTTVAVRFGGTRDASDRDILAIEQVSGGATNVGIALFEKDASQIKLYDDSQD-VQITGTEINLDYVARYKAT-DAATPGPANGSAVYSIQY. 172
219 3.000e-45gi|545289339|ref|WP_021572264.1| type-1 fimbrial protein, C chain [Escherichia coli]  clstr ali  28  1MKLKFISMAVFSALTLGVATNASAVTVNGGTVHFKGEVVNAACAVNTNSFDQTVNLGQVRSERLKVDGAKSNPVGFTIELNDCDSQVSAGAGIVFSGPAVTGKTDVLALQSSAGSATNVGVQITDHTGKVVPLDGTASSTFTLTDGTNKIPFQAVYYATGQA-TAGIANADATFKVQY. 185
220 3.000e-45gi|502386197|ref|WP_012776920.1| exotoxin [Photorhabdus asymbiotica]  clstr ali  21  1MKYFKLFVLRIGFMVIATTAYCNQAVQAADNMRFYGALVEEPCTIQPGDEDIKLDFGTIGEKYLYQHG-RTNSEPFQLRLSGCDISVGKSIKLTFSGIENTQLPGLLALGAGS-LASGVAIGMETAEGKRLPLNKEGDTY-PLKEGETLIELKAYVQAEPATIKRGTFHAVATFNLNY. 180
221 3.000e-45gi|503580247|ref|WP_013814323.1| MULTISPECIES: fimbrial protein [Serratia]  clstr ali  24  1MKKNLLALAVVSASVFTTS-----AFAADGVVNFKGSITDQSCTVDTTSKNKEVVLGKVSKDAF-TAGKTAGAKQFSLVLKNCPKTVSG-ATVRFDGTKVVGQAGLLTLTEATDAATGVGVQLLDDQNSVINLGVDSRIYTLVSTGDNTLDFMARYYAY-AAVGTGSANATANFTVVY. 170
222 4.000e-45gi|503132337|ref|WP_013366998.1| ferrous iron transporter B [Enterobacter lignolyticus]  clstr ali  22  1..MKKIVIGALIASSLCGSVSVFAATNGEGQVNFTGEILDSACEVVNNSNPLNVNLGKVSKTAFSGIGSTADTTQFAIQLKNCPETVS-TAAITFGGTPDTDNNNVLALTAGTGVAAGVGIQLLDSSQQPLSLYTASQPYTLQSTATNNLEFAARYIQTQSTISAGPANAVSTFTVVY. 177
223 4.000e-45gi|496187896|ref|WP_008912403.1| major mannose-resistant fimbrial protein [Providencia burhodogranariea]  clstr ali  26  1MNLNKIALVLG-LGLSITAGVANAADQGHGTVTFVGSIIDAPCSITPETSDQIVPMGQISTAELKDGG-RSNSRAFKIALENCTTETLKTVQTTFAGAASPITDGSLAIE---GKAQNAAIVITNAGGKQIKLGTPS-DAVTLRDGNNDLNFAAYMLGDTDAATPGEFKAIATFALNY. 173
224 4.000e-45gi|501081513|ref|WP_012132109.1| ferrous iron transporter B [Citrobacter koseri]  clstr ali  27  2MKKNMIAMALSAAAILSIS----HAIAYDGTVKFVGQVLDTACTVDIGANNMTVDMGSVYKTAFTNAGDEASTTKFTLRLINCPSSV-TSARVKFDGVNHSGNTDLLALSADPGSASGVAIRLMTADRAPLGLNQNGYSYSLLDMVDNQLDFYAAYVATSVPVVPGVVNAVANFTVNY. 176
225 4.000e-45gi|514235602|ref|WP_016538251.1| fimbrial protein [Cedecea davisae]  clstr ali  32  19..MIRKILLLVILAAANPAQAKRVVVINGGDVHMQGELVNGACAVAPESQEMTVQMGQYPSNAFKDVGSYAPPIPFTLRLTDCRPEVYDHVGIAFQGSTPAEDPQVLATSSVTGASSGIGLALFDQQQQLIIPNSEPATYLPITTQEMSVHFTARYRSVSKHMTPGNIRSDVWFTLVY. 198
226 4.000e-45gi|490382913|ref|WP_004262424.1| fimbrial protein [Providencia rettgeri]  clstr ali  26  1MKKIIATAIFAALCVG------QVANAKDGTVKFVGDIVTAPCEVAQNSWDQTVQMAQVKTATFADAGAKSADKKFQISLLTCDVTQFKNVSVSFAGQTNGDDATLLALDGGQGAAENVGIAIYDSKGKKLALGTATAD-TALQVGSNTLYFSAAYVSTKKDVKAGSANATADFNLTY. 171
227 5.000e-45gi|639137961|ref|WP_024483422.1| exotoxin [Serratia fonticola]  clstr ali  23  37..........................ADDNNVHLHGALVAEPCVIPPGDEEITLDFGTIIDKYLYLN-TRTLGQAFEIHLEECDLTLGKTVSVRFSGTESSALPGLLALDGSSG-ATGIAIGLETPSAQPLPLNQAS-DKLLLQAGSTNIALKAYVQGEPDAIERGPFSAVATFNLEY. 190
228 5.000e-45gi|653022525|ref|WP_027274423.1| fimbrial protein [Leminorella grimontii]  clstr ali  23  5.........VLLGIAIAAGSLCSAVQASDGTINFTGSITDKTCTIDSGSKSLNVPLGNVSKASLHGAGMKSSPTSFQIGLSGCPETA-KAATVKFDGKATGSDQSLLALNGVDGVATGVGIEISDVNNNPIALYTASPEFT-LVQGANTLKFVARYVSTGPVVTTGPADGTSQFTIVY. 172
229 5.000e-45gi|545170419|ref|WP_021524833.1| type-1 fimbrial protein, C chain [Escherichia coli]  clstr ali  25  1MKLKFIPMAVALTLGVATSASAAPATVNGGTVHFKGEVVNAACAVNANSFDQTVQLGQVRTEKLKADGDKSAAVGFNIELSDCDTKVSNGASILFSGTTVATKNNVLALQGSSGTATNVGVQVLDHTGSAVTFGNTPTASYTLSDGTNKIPFQALYIATGQS-TAGTANADATFKVQY. 181
230 5.000e-45gi|490362059|ref|WP_004241822.1| Fimbrial protein [Morganella morganii]  clstr ali  32  3.KLISTVFLLCGISAGAYAGNKTHTIIDGGMVHLRGGLVEAGCTLSTNSENDVIDMGEFRTNQFKGTGSYSGNIPFKLVITNCSTAVSSKVGLSVFGYINEKDPQIIKLEDSDEAAKGVGIAILDSDGDIIIPDNIPSKWINFHEGENVLHFNARYRATDMQVTGGKANASVWFHLTY. 179
231 5.000e-45gi|501082903|ref|WP_012133450.1| adhesin [Citrobacter koseri]  clstr ali  19  1....MRLLLAIFCSVLLSPLCRADTALGEINIELRGNVVDFTCTAVTGDSNKTVELGTWPTKQLKTSGDTTQPVPFSIKLEGCPPGA---ASMTFSGTPAAG-TSLLALDDAV-MAQKVAIEIRDSDRSRLPLEQASQSVSVDENGNATLTFYANYIALADGVQPGVAKADATFMINY. 169
232 6.000e-45METAHIT O2 GL0006295 [Complete] locus=scaffold61048_9:271:765:-  ali  32  3...................LAVSHALAADSTITIRGYVRDNGCSVAAESTNFTVDLMENAAKQFNNIGATTPVVPFRILLSPCGNAVS-AVKVGFTGVADSHNANLLALENTVSAAAGLGIQLLNEQQNEIPLNAPSSAWTTLTPGKNTLNFYARLMATQVPVTAGHINATATFTLEY. 163
233 6.000e-45T2D.3697791 [KEGG:K07348] minor fimbrial subunit;|[COG3539] P pilus assembly protein, pilin FimA  ali  23  2MKYNNIIFLGLCLGLTTYS-----ALSADSVIKISGRVLDYGCTVSSDSLNFTVDLQKNSARQFPTTGSTSPAVPFQITLSECSKGTTG-VRVAFNGIEDAENNTLLKLDEGSNTASGLGIEILDANMRPVKLNDAGMQWIPLVEQNNILPYSARLKSTQKSVNPGLVRASATFTLE.. 175
234 6.000e-45gi|584248060|gb|EWG67493.1| Fimbrial subunit type 1 precursor [Enterobacter sp. DC1]  clstr ali  18  5...........TTLAVFFMLPIISAYAVDGSVNFTGEIVDAACKVDVGSSALSVDLGKVQKSALTGDGSTASATKFTLKLSSCPSTITK-AAVKFAGTPYDNDDSILALTSGTGVATGVGIQLLDAGNAVLPLFTDSTSYTLVADDENDLDFYARYIQKGTTVVAGKANATASFTIDY. 171
235 6.000e-45gi|496196481|ref|WP_008916318.1| fimbrial subunit [Providencia sneebia]  clstr ali  24  7.........IFSATLLMSMLFSSTAFAADSTITIKGNVKDNTCAVAPGSQSQVVDLLNNPVKQLYAVGEVTAVVPFQIDLTPCGESVI-AVKVGFVGIADVNNNALLALESGNSNASGVGIQILDGSRTPLELNANSSSWTPLVAGGNTLHFYARLMASKLPVVAGHVRATATFTLE.. 176
236 7.000e-45gi|501096817|ref|WP_012146849.1| fimbria A protein [Serratia proteamaculans]  clstr ali  24  1MKLNKIMMAAVVAFGM---SSMAHADEGHGKVNFAGSIVDAPCSISPETVDQTVNLGQVSNVALKDGGK-STPKNFQIDLENCTVATGKTVQVTFTGAKAQETNKNL--LAITGSASGAGIAMTDTSGALVELGKGGTAQM-LQNGNNTLQFAAYMQGLTAAVVPGDFTAVTDFTLTY. 178
237 7.000e-45gi|491030221|ref|WP_004891908.1| fimbrial protein [Klebsiella pneumoniae]  clstr ali  28  1MKKSLILVALTATAALSTS----HAFAAAGTVNFVGNILDTACEVDVASQNQQVNLGNFYKSEFPNSGTKAAAKDFNIVLKNCPTTVTST-KVRFDGTPDLTNPNLLAIDTASSAASGVAINLMTADKVDLPLGENSYNYVLSSTQDNTLKFYAQYISTTAPVTPGTANSVANFSIVY. 175
238 7.000e-45METAHIT MH0025 GL0054419 [Complete] locus=scaffold33438_1:20335:20865:+  ali  23  1MKYNNIIFLGLCLGLTTYS-----ALSADSVIKISGRVLDYGCTVSSDSLNFTVDLQKNSARQFPTTGSTSPAVPFQITLSECSKGTTG-VRVAFNGIEDAENNTLLKLDEGSNTASGLGIEILDGNMRPVKLNDAGMQWIPLVEQNNILPYSARLKSTQKSVNPGLVRASATFTLE.. 174
239 8.000e-45gi|490860172|ref|WP_004722214.1| hypothetical protein [Acinetobacter guillouiae]  clstr ali  29  5MKLALLSTALSALTLSVSAFAADPVTVNGGTVHFTGEIVNAACAVSTESSNQTVDLGQYRTARLAVAGDKTTPVPFQIKLVDCDPTVQATAAVAFYGQSVTSNANLLSVAAGSTAATNVGIEIADDTSKILGVGASFSTPKTLITGDNTLQFSARYVATGAS-TPGQANADATFVVKY. 186
240 8.000e-45gi|490210901|ref|WP_004109300.1| hypothetical protein [Klebsiella oxytoca]  clstr ali  31  5..RKKLCLCVCLYILGTAVTFAENRTQYGGVVHLRGAVTDGTCAVSTESENKQVYMGQVQSSRFEELGAWADPVAFSLVLVDCTVASEKQVGIMFNGVSDGKDPLVFRAGEGANAAQGVGIGIFSASGELIIPNTRPQLLTSLNGETVTLPFTARYRATSRQVIAGDASSNVFFTLYY. 180
241 8.000e-45gi|502752342|ref|WP_012987326.1| fimbrial protein [Xenorhabdus bovienii]  clstr ali  24  1MKFKLI-----ISSLFVSSLFATTANATIGTVNFKGEITDKTCEIDAASANQTVNMGKVSVKEFSGENKVAAATKFSIKLTECPTEI-KNALVKFDGSSHESKGKLLALTTDSKNAKGVAIGIYDNSDNLVGLYKDSKSYA-IEKGAAELPFIAKYVATSDNVSAGSANAVARFTVVY. 172
242 8.000e-45gi|493177042|ref|WP_006176992.1| adhesin [Enterobacter cancerogenus]  clstr ali  21  1.MRSVTRYAAAAALLMFHASAGANTALGEINIQLYGNIVDFTCVAEGSDSDKTVPLGTWPTKQLRTTGSRTQPMPFTLKLTGCPPGA---ASITFSGKADGSDNSLLGLNEASD-ATHVAVEIRDRDKTRLALEQASQPVTVDALGNAELAFYANYIATADNPQPGRADADATFMINY. 173
243 9.000e-45gi|578256325|gb|EUM16387.1| hypothetical protein L465_00200 [Enterobacter sp. BIDMC 29]  clstr ali  31  2MKYATQYVLLALGLIACTSGHALASE--DGQVTFMGQVVNAACTVNTDSQDLVVHMGQVRSSQFISTGDWAMPTPFQIKLEECDASVSQRAGVLFYGETALKDPQIFHXXXXXXXXXXXXXXXFDATGHLLIPGTTPLWKAPLQGGENVLRFIAKYRSTAPHVQAGNADAQIWFNVIY. 177
244 9.000e-45gi|493362764|ref|WP_006319196.1| exotoxin [Serratia plymuthica]  clstr ali  22  1MKMKKRYGVVTCFSMGFFVNAAQAASPPQVSVLYSGNLVAEPCTLLPENENVIVDFGSVVDKYLYLN-HRTHGVPFQLNLTDCDLGLGKTLKVTFNGPESTALPGLLALSAESQ-ASGIAIGMETEQGQPLPLNAASGKY-PLQDGNTVIRLQAYVQGEPAAITRGPFNAIATFNLEY. 181
245 1.000e-44gi|493874248|ref|WP_006820688.1| ferrous iron transporter B [Yokenella regensburgei]  clstr ali  27  1...MINKKMILVALATGAVLTAVNANAADGTVNFTGEIIDQACTVDIGSNNMTVDLGRVARTAFQNTGDESDSTKFTIKLINCPSTVT-SAQVKFDGANDSNNSDLLAITSGSAAAGGVAIKLMTADKSLLGLNQNSYSYPLVTTADNNLDFYAAYKSTAASVSAGTANAVANFTVNY. 176
246 1.000e-44gi|490220779|ref|WP_004119151.1| ferrous iron transporter B [Klebsiella oxytoca]  clstr ali  25  1MKKTIVIAMLAA----GSALSMTQAFAAAGVINFTGKILDKACDVDVASQNQTIDLGSYNKSEFPTSGTRTAAKEVKIVLKNCPDTVNG-AQVRFDGTPDLTNSSLLAIDSSTGAASGVAINLMTADKADLPLGSNSYNYPLSSTADNTLMFYAQYISTAANVVPGQANSVTNFSVIY. 175
247 1.000e-44gi|493867559|ref|WP_006814164.1| fimbrial protein [Providencia rustigianii]  clstr ali  23  1MKFNKTIMAIAATSLISFSAFSAPVNHGNGKVTFTGSIISAPCSIDPASLDQTVDLGQIADVVLKNGETQSSPVMFDIKLIDCTVETGDTVNVTFSGAAAENNGNPL--LAITGTAGGAGIQIVDSNNAPIVLNEKTKSTHKLQGVTNTLQFAAYIKGLGTEIIPGEFQAVTDFILTY. 187
248 1.000e-44gi|500229034|ref|WP_011899127.1| fimbrial protein [Aeromonas salmonicida]  clstr ali  19  1..MFRTFWIGLLLCPSLAVMAAPRAGEDGNTLHLHGRIIDQPCLVSPESADQSVDMGVVDVRELYSAGAGAQ-VPFVIRLTNCKPGIFRMAKVTFSGSADQQMSGALAF--SAGSAKGAGIRLYDATQSPLDLGTPSRGYVLGNSTENELNFFARVEGHPDAIKPGDYTAVANFIVAY. 182
249 1.000e-44gi|493734811|ref|WP_006684031.1| ferrous iron transporter B [Citrobacter youngae]  clstr ali  25  1..MEKRILAVATAAVLFSALSCGIANAADGQIKFTGSLTADACKVDTTSADQTVSMGKVAISAFTDGGTKASPTKFSLKLTDCPDTVTSAV-VKFDGNADASNTDLLALDSDSDAA-GVGIEIADNTGAAIPIHQASTAY-PLAVGDNTLEFVARYVSDTATVTAGAANATSDFTINY. 174
250 1.000e-44gi|639209232|ref|WP_024547425.1| ferrous iron transporter B [Cronobacter turicensis]  clstr ali  26  1MKKNVFAVAFATVAVL----SASSVFAADGTVNFTGEIIDQACTVEIGTSNLTVDLGKVAKSSFAAVGDDASITKFSMKLKACPESIT-SAKVKFDGPNDATDSSLLALTSETGVAKGVAIALMTADKTDLGLNSVSDSYALKATEENTLDFYAAYRSTAATVVAGKANSTATFSINY. 175
251 1.000e-44gi|500023779|ref|WP_011704497.1| fimbrial protein [Aeromonas hydrophila]  clstr ali  20  1....MLRTLLISLMLSPLIAVAAIPRAGDGKLNLHGRIIDQPCVVAPESLEQEVEMGVVDVKQLYANGA-GEQVPFSIRLTNCKPGIFRMAKVTFTGSKDAQLSGGLAFT--AGIAKGAGIRLYDVTQTPLDLGTPSRGYLLGGSADNELQFFARVEGHPDAIQPGDYSAVANFIVAY. 182
252 1.000e-44gi|501074369|ref|WP_012125283.1| ferrous iron transporter B [Cronobacter sakazakii]  clstr ali  24  1.MMKKILLMTTMAALACSSSLTWAATTGEGQVNFTGEILDAACEVNSQSSPLAVDLGKISKTAFTGIGSTTNITSFVLQLKNCPETVTK-ASIKFGGTADTNNVDVLALTGGTGAASGVGIQLVDADGTPLNLYTASADYALTGTATNNLEFGARYIQTGATVTAGVANGSSTFTVTY. 178
253 1.000e-44gi|653023063|ref|WP_027274958.1| hypothetical protein [Leminorella grimontii]  clstr ali  19  1MNKYLLISALCVGASLVSS-----AQAYDGQVNFKGTILDTACTVDINSKNLDVNLGRVAKTVFTSVGDVSTAMPFSLKLTGCPAAVTTDAKIRFEGTTVAGKTDVLDLASGS-VATGVGVQIKDNAGQKIVFGSDSSKY-PLSEGANSLDFTAYYISTNTAIVSGSANAVANFTVVY. 172
254 1.000e-44gi|514233093|ref|WP_016535742.1| putative PRS fimbrial major pilin protein [Cedecea davisae]  clstr ali  23  9.KMKKFIFTVAFGAMVCASAASAVGIGGSGKVNFSGSIVDAPCSMDPNTADQTVELGATSNLHL-SNGSSSTPKPFKILLEGCSGETLGSVTTTFKGLQADEDTTLLRLI---GSASGAAIAINDYKGRQIKMGEASPAY-NLATGNNELDFSANLKGFGKPVVPGEFTAIANFTLDY. 183
255 1.000e-44gi|559233616|ref|WP_023582659.1| fimbrial subunit [Proteus hauseri]  clstr ali  25  1MKKNLLAIFIASSSIFAV----NNVLAADGTIDFTGEIIDNACELASGSDALKVNLGKVSKTALPSTGSTAAATKFTIKLINCPTTVS-SAAVKFDAESYSGDDSVIALKKETGVASGVGIQITDDTNTVVPLFTASKIYPLKTGAGNNLDFRARYIAKSDTVTAGPANGNATFTINY. 175
256 1.000e-44JGI.Meta JGI_HUM.0745415 7045188284 C3789086__gene_314381 predicted fimbrial-like adhesin protein [Human Stool microbiome from visit number 1 of subject 158  ali  23  1MKYNNIIFLGLCLGLTTYS-----ALSADSVIKISGRVLDYGCTVSSDSLNFTVDLQKNSARQFPTTGSTSPVVPFQITLSECSKGTTG-VRVAFNGIEDAENNTLLKLDEGSNTASGLGIEILDGNMRPVKLNDAGMQWIPLVEQNNILPYSARLKSTQKSVNPGLVSASATFTLE.. 174
257 1.000e-44gi|503995637|ref|WP_014229631.1| fimbrial protein [Klebsiella oxytoca]  clstr ali  29  1MNKSLIAVGLLAGVMSAS------AFADDGRIEFYGSITDSACTINHMTNPLTVMMGNVSSKAFNGAGSTASATKFIIELKDCPKSA-KSATVKFDGTADSSVGTILALTQQPGVAKGVGIQLMDNKNVVVPLYTASSAY-PLQPGGNSLAFVARYYATSNTVNAGFANSTSTFTLNY. 171
258 2.000e-44gi|516505537|ref|WP_017893975.1| hypothetical protein [Serratia sp. S4]  clstr ali  22  6.MYWRRAIRLGIAGVMLAGAIGQPAAAEE-NMRFHGTLVAEPCVIPPGEEEIQLDFGTIVDKYLYLN-TRTHSQPFALHLAECDLSLGNTVSITFSGTENTKLPGLLALDGGS-SASGVGIGLETQEGKALPLNSASEKF-RLSAGSNMINLQAYVKGEPEAIQRGTFSAVTTFTLEY. 183
259 2.000e-44gi|514966368|ref|WP_016654670.1| hypothetical protein [Acinetobacter rudis]  clstr ali  25  1MNIIKLLIVGCVLCAPVL----HADPLVKINLRFKAMIVDRTCTVSPESQNINVALGTWGTKNMVNVGDQTRPIPFSIRLTDCS---AKNVSLSFKGPQDTTNPQFLALSDDS-TATNVAIQILDKDRQLLPIETFTKPVAVDTNKNLQLNFFANYFATRKNVTAGTANSTANFVLNY. 170
260 2.000e-44gi|639216402|ref|WP_024554143.1| fimbrial protein [Cronobacter helveticus]  clstr ali  23  1MNKHVLAMVVALLAGGVMSAAQADVTVNGGTINFKGEVVNAACAVSADSVDQTVTLGQVRTVRLATAGSAANQKAFNIKLEDCDTTVATAAAVIFNGQEDANVAGTLANTAGAGAASHVALQLYGPDGNKLAIGDTSSK-VTLVDGSNVIPLSVDYIATDAAATPGNVAAVATFNMVY. 179
261 2.000e-44T2D.3804711 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  21  1MKPFLRLFFFCIILMHLGSAS---TMAHDGTVYIVGTVKSKTCIISPDSENLIVRMSDVATGQFTNQKNNTPWEHFAINLENCGAGL-NNISTHFEGTPNQGNADLLSLTGGPGYASGVAIGIYNPDKTLIPLGDESQLFTLSNNQTATLDFYARYLADGGAVSPGTANAAATFILTY. 175
262 2.000e-44gi|635727443|gb|KDF09219.1| hypothetical protein AF41_02112 [Citrobacter sp. MGH 55]  clstr ali  26  7............LLGAIFSLVSASAFAADSTITISGYVRDNACAVAGESKDFTVDLLDNAAKQFSHIGATTPVVPFRIVLSPCGTSV-TAVKVGFIGIADNDNTRLLKLDSGTSAAAGMGIEILNGQQTTLPLGSATLPWTTLTPGTNTLNFYARLMATQLPVTPGHVNATATFTLE.. 173
263 2.000e-44gi|485712190|ref|WP_001344484.1| type-1 fimbrial protein, A chain [Escherichia coli]  clstr ali  29  54..................................KGEVVNAACAIDSESMNQTVELGQVRSSRLAKAGDLSSAVGFNIKLNDCDTNVSSNAAVAFLGTTVTSNDDTLALQSSAGSAQNVGIQILDRTGEVLILGATFSAKTDLIDGTNILPFQARYIALGQSV-AGTANADATFKVQYL 199
264 2.000e-44gi|504470279|ref|WP_014657381.1| fimbrial protein FimF [Providencia stuartii]  clstr ali  22  4......KLKIFSATLLTSVMFSASAYAADSTITIKGNVKDNTCAVAPGSQNQVVDLLNNAVRQLYAIGEVTPLVPFQIELTPCGASVL-AVKVGFVGIADANNTSLLALEPGTSNASGAGIQILDGSRTPLVLNANSNAWTPLVAGSNTLQFYARLMASNLPIVAGHVRATATFTLE.. 176
265 2.000e-44gi|449467072|ref|XP_004151249.1| PREDICTED: type-1 fimbrial protein, A chain-like [Cucumis sativus]  clstr ali  26  1MKLSNIASVIATLALIAGAAHAAPVSVNGGTVHFKGELVNAACSVNTDSSEQTVNLGQYRTAKFTKVGDTTSNIPFTIELNDCDPAVAKTAAVAFTGQIDATDKTLLAVSSGNNSAKGVGIEILDSKSSTLTPGATFSAAQNLIEGTNTLNFTARY....................... 164
266 2.000e-44T2D.2976128 [KEGG:K07355] fimbrial-like protein;|[COG3539] P pilus assembly protein, pilin FimA  ali  22  26..RRMRRVLFSCFCGLLWSSSGWAVDLGTININLHGNVVDFSCTVNTADKDKTVDLGRWPTTQLLSAGDTTALVPFSLRLEGCPP---GSVAILFTGTP-ASDANLLALDDPA-MAQTVAIELRNSDRSRLALGEASSTEEVDANGNVTLNFFANYRALASGVQPGVAKADAIFMINY. 197
267 2.000e-44gi|504695745|ref|WP_014882847.1| adhesin [Enterobacter cloacae]  clstr ali  20  1..MRNGIRFITVALFALCTQAQAETALGEINIQLYGNIVDFTCVAEGNDSDKTVTLGTWPTKQLSTTGSRTQPMPFTLKLTGCPPGA---ASITFSGKADGSNNGLLALNDAS-TASRVAVEIRDADKSRLDLQQASQPVTVDAQGNATLSFYANYIATADNPQPGKADADATFMINY. 172
268 2.000e-44gi|544768073|ref|WP_021193390.1| hypothetical protein [Ralstonia sp. AU12-08]  clstr ali  27  24.............................GTITFNGEIVAGACGISPDTLDQTVPLGQVPAHVFAKLGDRSQAVPFNVQLTDCDTTTAKNAFFTFTGTADTVTPGLFA---TTGSAGHVGVRLQTAAGEYLNNGTEQKAPVVLSNGNNTIQFAAMYEATAATVTPGLANSVANFTVRY. 169
269 2.000e-44gi|493867331|ref|WP_006813944.1| fimbrial protein [Providencia rustigianii]  clstr ali  24  1MKK----IILATLISGVMSSSALAVDAGSGTVTFSGSIIEAPCSIAPGEENQEVALGQVSNVTL-DNGSESSAQPFQIKLEGCNLKGDNQVAVTFKGTEAGTNTGYLQI---TGDATGAAVKIMNGSGAQIKVN--SSAKQNYVEGNNTLKFQASLIGLPLPVTPGQFQAVTNFTLAY. 176
270 3.000e-44gi|491497229|ref|WP_005354939.1| fimbrial protein [Aeromonas veronii]  clstr ali  20  14...........LLGVTAAPRASNDLELLGNTVHLHGRIIDQPCVVSPESLDQEVEMGVVDVKELYANG-VAELVPFSIRLTNCKPGIFRMAKVTFTGSQDTELSGGLAFT--AGIAKGAGIRLYDVAQSPLNLGSASRGYLLGGAADNELQFFARVEGTAKNIQPGDYSAVANFIVAY. 182
271 3.000e-44gi|493362467|ref|WP_006318899.1| fimbrial protein [Serratia plymuthica]  clstr ali  24  1MKKNLLAVAVLTA-----SAFTASVFAADGTVNFKGSITDKSCTVDTASQNQDVILGAISKTAFATAGSSAGGKEFSLVLKDCPNTVTK-ATVRFDGTRVPGPVGLLALTDVADKANGVGVQLLDDSNNAINLGNDSREYALVSTGANTLKFFARYYAFG-TVSVGKADATTNFTIVY. 172
272 3.000e-44gi|612268807|gb|EZQ62337.1| hypothetical protein AF54_02185 [Serratia marcescens BIDMC 81]  clstr ali  22  1..MNLNKTMMAAVLAFGTISGAQAADQGHGKVTFTGSIIDAPCSIDPKSIDQTVDLGSVSNVSLLNGGN-SDPKPFEIHLEKCSLDTAKTVTTTFDGAA-----GKNGLLGMTGDAKGASIAITDGSNNVIELGKPTAGQLISAGATATLAFSAYLKGDGASIVPGKFQSVANFILNY. 174
273 3.000e-44gi|495778586|ref|WP_008503165.1| fimbrial protein BcfF [Enterobacter sp. SST3]  clstr ali  21  1MKPFLRLFFFCIILMHLGSAS---TMAHDGTVYIVGTVKSKTCIISPDSENLIVRMSDVATGQFTNQKNNTPWEHFAINLENCGAGL-NNISTHFEGTPNQGNADLLSLTGGPGYASGVAIGIYNPDKTLIPLGDESQLFTLSNNQTATLDFYARYLADGCAVSPGTANAAATFILTY. 175
274 3.000e-44gi|493713493|ref|WP_006663080.1| fimbrial subunit [Providencia alcalifaciens]  clstr ali  24  1MKKHVIASLIATSTLLISA----NGFAKDGDINFTGEIIDNACQLATGSDAIQVNLGKVSKTALPSTGSTAAGTKFTIQLEKCPAAV-TSATVKFDGVAYDGNNNVLQVTNTSGVATGVGIQIQDVKGVTVPLYSISNPYTLQETVVNNLDFTARYIAMSDTVTAGQANSTATFTINY. 175
275 3.000e-44METAHIT unmapped GL0303630 unmapped_[Complete]_[mRNA]_locus=scaffold718072_1:446:958:-  ali  26  1MKKTMLSACFLLV--------AGNAVANDGTIHFTGSITDQTCTVDSGSQNMNVDLGKVAQTALNAAGMKASPTRFTLSLSDCPDTVTG-ANVKFDGTSDGVNQNLLALDSGTGIATGVGIEIADKNGAVIPLHTASMDY-PLAAGSNTLDFVARYVSTGTAVTTGTANGTSQFTINY. 169
276 3.000e-44T2D.2484265 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  26  1MKKTMLSACFLLV--------AGNAVANDGTIHFTGSITDQTCTVDSGSQNMNVDLGKVAQTALNAAGMKASPTRFTLSLSDCPDTVTG-ANVKFDGTSDGVNQNLLALDSGTGIATGVGIEIADKNGAVIPLHTASMDY-PLAAGSNTLDFVARYVSTGTAVTTGTANGTSQFTINY. 169
277 3.000e-44gi|446750562|ref|WP_000827818.1| fimbrial protein [Escherichia coli]  clstr ali  24  1MKRNIIGGAFTLASLML----AGNALAEDGVVHFVGEIVDTTCEVTSDTADQIVPLGKVSKNAFSGVGSLASPQQFSIKLEKCPAT-YTQAAVRFDGTEAPGGDGDLKVTGQAIAATGVGIRIFNSDNSQVKLYNDSAYTAIDAEGKAEMKFIARYVATNATVTAGTANADSQFTVEY. 188
278 4.000e-44gi|570280480|gb|ETO44112.1| type-1 fimbrial protein subunit A [Morganella sp. EGD-HP17]  clstr ali  26  1MKLNIIASVVXXXXXXXXXXXXDPVIVNGGTVHFTGELVNAACAVSTESSNQTVELGQYRTAKLAASGDMSTPVPFKIKLVDCDPAVATTAAVAFSGQSMTGDATLLAVNSGTNAAQNVGIQISDTASKVLSPGADFSATKTLIQGTNVLDFTARYVAKGAT-TPGQANADATFVVKY. 181
279 4.000e-44gi|159794884|pdb|2JMR|A Chain A, Nmr Structure Of The E. Coli Type 1 Pilus Subunit Fimf  clstr ali model  33  2...........................ADSTITIRGYVRDNGCSVAAESTNFTVDLMENAAKQFNNIGATTPVVPFRILLSPCGNAVS-AVKVGFTGVADSHNANLLALENTVSAASGLGIQLLNEQQNQIPLNAPSSAWTTLTPGKNTLNFYARLMATQVPVTAGHINATATFTLEY. 154
280 4.000e-44gi|449328150|gb|AGE94451.1| fimbrial protein [Citrobacter amalonaticus Y19]  clstr ali  20  1MKLMTFSFLLLTGAVL-----SNGVQAVDNNVHFSGALVAEPCRIPDGDSNIKLSFGSVIVKGLYQY-QRTKSQPFIIYLENCDPALMKTVSVTFEGTPDDELTTMLALEPSS-VAKGVAVGLELVDGTPLAINKAS-PYQPLSQGNNALTFNAYVQGKPSAITPGDFNAIATFVLVY. 175
281 5.000e-44gi|447004780|ref|WP_001082036.1| fimbrial protein BcfE [Salmonella enterica]  clstr ali  23  1..MNRSHCALFAMGLILCPQINASADDLAYNLEFTGTIVAQTCDIDISSLSQSIDLGQFAVGDFPSTGTTTKFKPFNINLKNCSRGIAG-AKIWFTGEPDPDNPALLAITDTGMGASGVGVEILNDDQDTISINNADSVVYPLKAGRNTLSFYIRYKSTRPTVTSGNATAVMYFDMQY. 180
282 5.000e-44gi|639192199|ref|WP_024531354.1| hypothetical protein [Serratia fonticola]  clstr ali  24  1MKRKLISSLIAASSMAFPMISSAATTVNGGTIKFTGEVVNAACAVDAGSSNMTVPLGQVRTAMLNQAGAKSGHQSFTIVLKDCDTTVSTKASVAFQGVASGSTGGVLGLSGGAGQATNVGIQLFDNDTTPLKVGTQFSTPKTLSDGENRLSFMAAYYATGVA-TAGSANAEANFKVQY. 188
283 5.000e-44T2D.3436823 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  24  1MNKKLMMAMLAAGSVLTM----TNAFAAAGTVNFNGNILDSACDVDVASQNQVVVLGDYYKTEFPTAGARTAATQFNIILKNCPVTVTN-AKVRFDGTPDLTNASLLAIDTSAGAATGVAINLMTADKADLPLGSNSYTYALSSTADNTLNFYAQYISTAASVTAGPANSVANFSVVY. 175
284 5.000e-44gi|501097333|ref|WP_012147351.1| MULTISPECIES: fimbrial protein [Serratia]  clstr ali  24  1MRLRALAMLSCTPFWFTTLPTLADTELVGSPLQFHGTVVSRPCNIEPQSADQVVEMDTVIVKTLYRYG-HSNPVPFNIKLTDCKTSVFKSVNVTFSGTEDSELPGKLAINNGTNGA---AIALFDSKGADIDLNQATSA-VALQDGANILNFTAYVQGHPKTITEGEFSSVANFVLAY. 178
285 5.000e-44gi|491012445|ref|WP_004874154.1| P pilus assembly protein, pilin FimA [Yersinia mollaretii]  clstr ali  35  11......FVVLSLPGAFASGHNNTVVTLPGGELNFIGDVIDAACLVDIDSRKQEIRLDQVNNAQFTASGSSVSAAPFSIQLNNCSVTTSQSVGISFIGVADERDPTILATITERNMANGVGIALFDADNNLLPINAPPKDFSLLSRGTNTLHFFAKYRSTLPVVTSGSSNAAANFMVTY. 182
286 5.000e-44CGD_mhc6a.1027207 GBUI7QQ02IGD9I|GBUI7QQ02IGD9I|metagene|gene_1  ali  25  2.....................SAFAAGNPGTITFNGEIVAGACGISPDTLDQTVPLGQVPAHVFAKLGDRSQAVPFNVQLTDCDTTTAKNAFFTFTGTADTVTPGLFA---TTGSAGHVGVRLQTAAGEYLNNGTEQKAPVVLSNGNNTIQFAAMYEATAATVTPGLANSVANFTVRY. 155
287 5.000e-44gi|556425945|ref|WP_023310872.1| major type 1 subunit fimbrin (pilin) [Enterobacter cloacae]  clstr ali  26  1..MKKVILGLFIAAALGCSASSFAASTGEGQINFTGEIIDSACQVVNGSSPLNVALGKVSKTTFTGAGSTSTLTKFDIQLKDCPETVT-SAAINFGGTPDADNNTTLALTPGATTATGVAIQLVDSSEQPVSLYTPSKQYPLTPGTTVTLEFGARYIQTQAAITAGQANSASTFTVIY. 177
288 6.000e-44gi|497856679|ref|WP_010170835.1| fimbrial protein FimF [Pseudomonas sp. PAMC 25886]  clstr ali  23  1MKKY-------LCVLGLMPCFASHSYAADTSISITGYLKDNTCSVSVDSKGFTVDLMSNAAKQLNRVGATTVPVPFKIVFDKCGSSTTG-VRIIYGGTSDEDNNTLLKIGAGTNAASGLGIQILDSDKQPIPLNAASLSWSPLIAGSNTLNFYACLMATRSPVTAGVVNATADFTLE.. 172
289 6.000e-44gi|493178092|ref|WP_006177567.1| fimbrial protein [Enterobacter cancerogenus]  clstr ali  27  25.......................QAFASNGIVHFTGEIIESTCEVSTGTKDQTVDLGKVNKSTFTDVGSTASVQAFQIDLVNCPQT-YKKANARFDGTEDGD--GYLKLNN--GGAAGVAIAIYNADNSLLKLYNQSKTADISAEGSASLPFMARYIATSSTVTAGLANADSEFTISY. 175
290 6.000e-44gi|640473284|ref|WP_024913842.1| ferrous iron transporter B [Serratia fonticola]  clstr ali  24  1MKKNIIVVTLVAAAAMGSVS----TFAADGQINFTGEIIDAACEVVNNVNNLAVTLGRVAKTAFDGKGTTAAATGFTLQLKNCPATLTG-ATVKFDGTTVAGDNSVLALTQEAGVAQGVGIQLSDSSQDALPLNTASASYPLASTGTNNLDFVARYVATATTVTAGPANATASFTINY. 174
291 6.000e-44gi|446366062|ref|WP_000443917.1| type-1 fimbrial protein subunit A [Escherichia coli]  clstr ali  25  12..MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNTDSADQVVTLGQYRIDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNLLAISTNTTTATGVGIEILDNTSAILKPGNSFSTNQNLIPGTNVLHFSARYKGTGTSASAGQANADATFIMRY. 190
292 6.000e-44gi|497339430|ref|WP_009653643.1| fimbrial protein BcfA [Klebsiella sp. OBRC7]  clstr ali  23  16MKKAFMVKSVVLAMVMAGGISSAMATVNGGTVEFKGSVVDAACAVTADTTNQVVNMGQVRLAAFTGKDSVANQTPFTIKLADCDTTIASQASVTFDGNAAAGEAGVLDNTSGAGNAAGVGIQIYDKDGSALDLGTASQA-VTLIDGDNTLNFSADYYQTADTATAGSVDTTATFNVTY. 200
293 6.000e-44gi|498976561|ref|XP_004528351.1| PREDICTED: protein FimF-like [Ceratitis capitata]  clstr ali  23  1..MIMIARAVPLITATLLALCAGARADGGSTIEISGYVRDNACEVAGDSKDFEVDLLKNSVRQLRTVGAATPQVLFRIFLSRCGGSA-TAVRVGYSGPADDENSALLRLDPGGSAASGAGIQILDHQQVPLPINAPPASWITLHPGSNTLNFYARLMATRVPVTAGQVRATATFTVE.. 177
294 6.000e-44gi|491095558|ref|WP_004957162.1| exotoxin [Serratia odorifera]  clstr ali  24  12.KQTSRRGSALLGVGIVLAGLMTQPAAADENMRFHGTLVAEPCVILPGEERIQLDFGTIVDKYLYLN-TRTHSQIFTLHLAECDLSLGNTVSVTFSGSENANLPGLLALDGGS-SASGIAIGLENRDGTALPLNSASDKY-RLAAGSNQIALQAYVQGEPKTIGRGEFSATATFSLEY. 190
295 6.000e-44gi|490366551|ref|WP_004246215.1| fimbrial protein FimF [Proteus mirabilis]  clstr ali  22  1.MTNNIKGILTTLWLFFLSLSPNVAYSADSIIQITGYMRDNTCAVAPESQYQTIDLLNNEVKRLYKVGETTPFIPFHIILEPCGESVI-AVKFYFNGISDRNNPSLLALDPIATSASGVGIQILDSERSPIPINPSSDQWIPLVAGSNTVFFYSRLMASDMPVLAGKIKASATFTLEY. 179
296 6.000e-44gi|446526065|ref|WP_000603411.1| adhesin [Salmonella enterica]  clstr ali  21  1..MILRRVFITIGCVLLSPLSQANSSLGEVNIELRGNVVDFTCAVVAGDSNKSVNLGTWPTKQLHAAGDATQPVAFSLKLEGCPP---GSASITFSGTPAPG-TALLAL-ADTEMAQKLAIEIRDGDQRRLPLEQASKAVDIDNNGNATLKFYANYIALADGVQPGLANADATFLINY. 171
297 7.000e-44gi|612276606|gb|EZQ70016.1| hypothetical protein AF53_02902 [Serratia marcescens BIDMC 80]  clstr ali  23  1.MNKVILTLLVGLGAGGVLNMAQAATTPEVSVLYRGSLVAEPCTLLPEDENILLDFGTVIDKYLYLNG-RTNSKPFQLHLIDCDTSLGKMVKMTFSGTESLPLPGLLALDAGS-EAKGIAIGLETQDGQALPLNQQSRGQ-EITNGNNVITLKAYVKGEPDAITRGIFTAVATFALEY. 179
298 7.000e-44gi|446872228|ref|WP_000949484.1| type-1 fimbrial protein subunit A [Escherichia coli]  clstr ali  28  4..KQHVTKSILGLALLSAVPVASAAVVTGGTVHFTGQIVNAACAVSAESVDQIVKMGQFRTANFTSVGMRSHAVPFTIKLEDCDTNISTTAAVSFYGNLDANDPTVLAVSNXXXXXXXVGIEISDYTGKLVKPGSVFSTAQNLVDGANVLSFTARYKSTLASVTPGQADADALFKMQY. 184
299 7.000e-44gi|571190651|emb|CDL37878.1| FIG00510038: hypothetical protein [Escherichia coli ISC11]  clstr ali  27  1MWQMIGKGVALAGMLCVLPVFAHTVILESGRLHLRGQLVNGACTVATDSQNLRVQMGQYRTNAFSGTGSASTSVPFSLRLTSCSSDVYDHVGIAFAGVTPAEDPQVFLASGDASAASGIGLALFDQRQRQIIPNALPLHYAPIITQEMTFHFTARYRAVSENITPGTLRSDVWFTLVY. 179
300 8.000e-44gi|505739116|ref|WP_015700780.1| fimbrial protein [Pantoea ananatis]  clstr ali  24  1MKLNKLASVLALGLSMAAISNVYAANQGQGKITFTGSIIDAACSISPETSDQEVSLGQIAASQLADNG-TSKPVNFEIDLQHCTTTTAPSVKVTFGGSPAEGDNTWFGI---TGTASGAGVVITDASSNKIPVGGTTEMARELIEGDNTLGFSAYLQGLGDKVTTGEFSSIADFTLAY. 194
301 8.000e-44gi|639188612|ref|WP_024527848.1| fimbria A protein [Serratia fonticola]  clstr ali  22  1MKLNILALVVAA--GFMSNAFAVATEAGKGQIKFTGSIIEAPCSITPGTSNQNIELGQISSTALQDGGK-STPVTFQIDLEKCDTTSLPGVTATFTGPASANNTDLLGI---TGSAKGASIVLTDGAGTPIKFGTPTAKQ-LIMDGSNTLVFSAYLQGDGVSIIPGEFTSIANYALAY. 174
302 8.000e-44gi|573502616|gb|ETT03006.1| fimbrial protein [Providencia alcalifaciens PAL-3]  clstr ali  24  1MKKQIIASLIATGTLLISANS----FAKDGDINFTGEIIDNACQLASGSDAIQVNLGKVSKTSLASTGSTAAATKFSIQLENCPAAV-TTATVKFDGVSYEGDSSVLQLTGASGIAKDVGIQIQDAKGVTVPLYTESNEYTLKETVVNNLDFTARYIAMSDAVSAGLANSTATFTINY. 175
303 8.000e-44gi|544913467|ref|WP_021323234.1| f15 p-fimbriae major subunit precursor [Photorhabdus temperata]  clstr ali  24  28MKLNKLVMALGLMALVASSVNAANPSQGHGTVTFTGSIIDAPCSITPETVDQVVPLGSISNVSLKNGG-RSSSKSFKISLENCTTETINTVTTTFIGAKSSI-TGGEGLLGIEGSAKGAGIAITDGGGNKIKLGTPSPA-IALHDGSNDLNFAAYLQGDPDAVVPGDFTGIANFQLTY. 205
304 9.000e-44gi|639141502|ref|WP_024484989.1| ferrous iron transporter B [Serratia fonticola]  clstr ali  27  1MKKNLIAVAVLATSVFGVASSMAAV----GQVNFTGEIIETPCVVNTPANPLEVKLGTVSKTEFTGAGSTAAATKFTLQLKDCPATVS-SATIKFDGTSVAGDNSVLALTQVSGVATGVGIQLSDDSNTVLPLYTASKAYPLLVGVVNDLDFVARYIATAATVTAGPANSMASFSVVY. 176
305 9.000e-44gi|496195577|ref|WP_008915414.1| fimbrial major pilin protein [Providencia sneebia]  clstr ali  25  1....MKKIILATLISGAMSASALAVDAGQGTVTFEGSIIEAACGIAPESTDQTVNLGQVASAQLAGGG-MSRPVNFTIELVDCDTSISDTXEVTFTGGINPNLADSLAIQ---GTASGAGVVITGLDAVPVKLGSXSAGXIALQDGDNSLLFSAYLKGDSTTIVPGFFTALTNFTMQY. 171
306 9.000e-44gi|502862497|ref|WP_013097473.1| ferrous iron transporter B [Enterobacter cloacae]  clstr ali  23  1MKKKMI--IAGIAAGMACASVSVFASSGEGQINFTGEIIDSACTVVNGSNPLNVSLGKVSKSAFTGSGSTTSTTRFSIQLKDCPETVT-SASVTFGGTPDSNNKDILAVTSGTGSASGVGVQLLDKTENPLSLYTASAAYTLTGTTTNDLQFGARYIQTGGTVSAGLANAASTFTIVY. 177
307 9.000e-44gi|485714604|ref|WP_001346722.1| fimbrial protein [Escherichia coli]  clstr ali  24  28.KKTLLSMATALLSGVAFNALADDPNQGSGKITFKGEVIDAPCSIAPGDEDQTINLGEVADTVLKS-GQKSLPVDVTIHLQDCGTNTVDKVKITFSSASDATDSNLLKNTGNIGGATDVGVRLVKSDNTNVTLGTPITINFPTTNSYQELNFKARMESLGRTATPGNVQAQANYVLDY. 211
308 9.000e-44gi|493444735|ref|WP_006400116.1| fimbrial protein [Burkholderia multivorans]  clstr ali  26  1..MKKTLLTAAALAVLSTSAFAAGANSGTGTINFTGEIVAGACGIDSGSDNQTVNLGKVPTNVFKQAGDKSTATNFDIKLTDCDTSVAQNAFFTFTGTSSAGQPKLFA---TIGSAQNVGIRLQSASGEYLDNGVEQKAPTVLQNGTNIARFAAMYEAVAADVKPGTADGVANFTVRY. 173
309 9.000e-44gi|505190175|ref|WP_015377277.1| fimbrial protein MrfG [Serratia marcescens]  clstr ali  24  7...NRRRSALLGAGMVMAAGIMAQSAAAAENMRFHGTLVAEPCVIQPGDEDIQLDFGTIVDKYLYLN-TRSHSQTFALHLTECDLSLGNTVAITFTGTENAKLPGLLALDAGS-LASGIGIGLEDSSGKALPLNRAS-DKFRLSAGNTTLTLQAYVQGEPEAIQTGTFSAVATFTLEY. 183
310 9.000e-44gi|446750559|ref|WP_000827815.1| fimbrial protein [Shigella flexneri]  clstr ali  25  1MKRNIIGGAFTLASLML----AGHALAEDGVVNFVGEIVDTTCEVTSDTADQIVPLGKVSKNAFSGVGSLASPQKFSIKLENCPAT-YTQAAVRFDGT------------GQAIAATGVGIRIFNSDNSQVKLYNDSDYTAIDAEGKAEMKFIARYVATNATVTAGTANADSQFTVEY. 162
311 1.000e-43gi|497270634|ref|WP_009584851.1| putative type-1 fimbrial protein, A chain [Acinetobacter sp. WC-743]  clstr ali  27  1MKKISL-----IAFALVASSTSFAATVPGGEIHFTGDLVNAACAVSAGSDGQTVPLGQHRVASFKKAGDTTSPVPFKIELVDCEAAVTKGVSIAFKGPTVATNPKLLSVGAGTSAAKGVGIQIADSSSTPLALGTGFTKETLINDGTNTFQFTARYVSTVDALTAGKANADATFIVNY. 181
312 1.000e-43gi|490858713|ref|WP_004720755.1| fimbria A protein [Yersinia ruckeri]  clstr ali  24  1MKLNKIVLGITLVFGIAAFSQAATADLGHGTVTFTGSIIDAPCSIDSGTIDQTVDLGPVSKVALDNKG-TSTPKDFKIKLEKCNIGDGKSVTAKFTGAE-GNTTGLLGI---TGTAAGASVVMKDGKGELIELGK-SSDAQKLQNGNNTLLFSAYLQGNGASVVPGDFSSVANFTLDY. 178
313 1.000e-43gi|504709980|ref|WP_014897082.1| fimbrial protein [Burkholderia cepacia]  clstr ali  28  15....................STSAFAAGTGTINFQGEIVAGACGIDSGSVNQTVQLGKVPTHTFTKAGDKSTPVKFNIVLTDCDTKVAKNAYFTFTGTSNSAQPKLLA---TIGSASNVGVRVQSASGEDIDNGVEQAAATQLQNGNNVVTFGARYEATAADVTPGTADAVANFTVRY. 169
314 1.000e-43gi|490203123|ref|WP_004101580.1| ferrous iron transporter B [Klebsiella oxytoca]  clstr ali  28  1MNNKIIMATFAIS----XXXXXXXXXXXDGTINFTGEILDQACTVDIGSNNMTVDLGRVARTSFQSTGDESDATKFTIKLINCPASV-NSAKVKFDGANDLNNSDLLAITQGPAAASGVAIKLMTADKSLQGLNQNSYSYPLVTTADNNLDFYASYQATQAVVTAGPANAVANFTVNY. 175
315 1.000e-43gi|562747212|ref|WP_023654327.1| Protein fimF [Erwinia piriflorinigrans]  clstr ali  25  5...........LSILYLLSFLAWDTHAADSTITITGYLKDGGCSVAVDSQDFTVDLMSNAARQLYRPGAVTPAVPFNIVLDACGESVTGL-RVGYTGTSDSDNTALLKLDAGDNAASGMGIQILDKDRGAIPLNAAQEAWITLTPGSNTLIFHARLMATRTPVTAGLVNATANFTLE.. 172
316 1.000e-43gi|573011231|dbj|BAO34583.1| fimbrial protein [Serratia marcescens SM39]  clstr ali  21  1MKMTPRRRWATAGLLLFSLGASGMVRAAD-NLYMHGALVAEPCVIQPGDEDIQLDFGTVVDKYLYLN-QRTLSQPFELRLSECDLSLGKTVSITFKGEENPQLPGLLAL-AASSEASGIAIGMETAQGRPLPLNSAGGKY-PLQNGSTVIAVQAYVRGEPKTIGRGAFNAIATFNLDY. 179
317 1.000e-43gi|447098930|ref|WP_001176186.1| hypothetical protein [Escherichia albertii]  clstr ali  21  1..MQLKKVLGFVSGIILSSCSWAADPLGTINIELHGNIIDFSCTVNTADIDKTVELGRWPTKQLLSAGDTTALIPFSLRLEGCPP---GSASVTFAGTP-ATDNSLLALDDAV-MAQNVAIELHNSDRGRLPLGESSQTVAVDANGNVTLNFFANYIALASGVQAGAAKADATFMINY. 171
318 1.000e-43gi|488394024|ref|WP_002463409.1| fimbrial protein [Escherichia hermannii]  clstr ali  27  1.....MTSKLTLAVVLAAMSMSASVLAADGTVNFTGTITDKACTVDTGSKNQTVDMGTVATTAFGAKGDTAAAKSFTIKLTTCPTDVTTNAAVRFDGMAKDGDPSVLALDAAS-VATDVGIQIKDNANKVVKLFENSSVYT-LVQGDNNLNFTARYISTADTVGAGTANSSAQFTIIY. 172
319 1.000e-43gi|494955140|ref|WP_007681168.1| Type-1 fimbrial protein, A chain precursor [Cronobacter condimenti]  clstr ali  26  1..MKNVLLSTLLTGMACCAGSAFAASTGEGQINFTGEILDSACEVNSAASPLSVTLGKVSKSSFSTVGATSAPTTFDIELKNCPESITST-SITFGGTADANNNDVLALKAETGAATGIGVQLLDASSQPLSLYTASADYTLSSGATNKLTFGARYIATAPTVTAGLANAISTFTVVY. 177
320 1.000e-43gi|640699517|ref|WP_025123495.1| MULTISPECIES: hypothetical protein [Serratia]  clstr ali  29  1MKKTLMTLALVASGFVASS-----VYAADGTIEFSGEITDSACIVDSASQNLQVPLGKIASNSFSGQGSYSAATNFTLKLKSCPLATS-TVTVKFDGASVPGDNSVLAL--ALGGATGVGIELSDANQKVVKLFTNSTPYTLNTGADTDLNFTARYKALSSTVTPGAANASVQFSIIY. 172
321 1.000e-43gi|493867167|ref|WP_006813786.1| ferrous iron transporter B [Providencia rustigianii]  clstr ali  22  1MKKYTFTVLIAGITFLPNSL----TFAADGTIEFIGDIIDQACEIKTESKNIQVQLGRIPKANLPNVGSKSIPVKFTITLVNCPVSI-NSATVSFDATSFPGDNSVIALKAIPNAASGVGVQLTDNKSAVITLLTPSNEYPILPTVENSLDFTANYIAKAIPVVAGSANASATFLISY. 173
322 2.000e-43gi|493707675|ref|WP_006657352.1| hypothetical protein [Providencia alcalifaciens]  clstr ali  27  6MKLKLIAIALPISLALSHTAFATPVTVGGGIVNFAGAIVNTPCVIDNDDASQTVNLGQYRQDAFTGKSSVSSPVGFDIKLTGCATETFKNASLTFAGITVPDEEKILAPVASQGTATGVGIQILQNSKLVNVDGLKATDVVKLNEGDSTLRFQAQYIALADEVTAGSANASADFTITY. 197
323 2.000e-43gi|493867336|ref|WP_006813948.1| fimbrial protein FimF [Providencia rustigianii]  clstr ali  24  1..............MLTFMLLCQNAFAADSTINIKGNIKDNTCAVAPGSQNQVVDLLINAVKQLHSNGEVTPLVPFSIDLTPCGTAV-TAVKVGFVGIADGNNKSLLALEAGSANASGVGIQILDGARTPLVLNADSNSWTPLMAGSNTLHFNARLMASKTPVVAGHIRATATFTLE.. 165
324 2.000e-43gi|446746124|ref|WP_000823380.1| fimbrial protein [Salmonella enterica]  clstr ali  24  1...MKRKITAAIAVFFTTISIASSVFAHDGTVNFTGKIIEAGCKIDGSTTDKDVELGEISRTAFTTSGDTAATTPFSLVLTECPASLGKSVNVKYEGTPDNINNDYLQLTGDSGVAKGVAIELLNADLSSLPLGTESNAVTEDAPAETNLNFFARYVSTEASVTAGTANATVNFTLTY. 183
325 2.000e-43gi|490386518|ref|WP_004266015.1| fimbrial protein domain-containing protein [Providencia rettgeri]  clstr ali  22  1MKLKSITTSIFITLGLVS--FANAADQGHGKVTFKGSIIEAPCSISPDSIDQTVELGQISNMALVSGGK-STPRSFDIALENCDVTATKGVQLTFTGAAASFDATS-KTLGIVGTGAGAGIQITNGGGNIVTLGTAT-PFQNIQSGDNTLRFSAYLKGNGTTITAGDFSSVADFTLSY. 177
326 2.000e-43gi|503131484|ref|WP_013366145.1| ferrous iron transporter B [Enterobacter lignolyticus]  clstr ali  27  1MINNNMITATIVASAVLCLTT---ANAADGTINFTGEIIDQACAVDIGSNNMSVDMGRIARTSFQSAGDESDSTKFTIKLINCPATV-TSAKVKFDGANDQNNSDLLAITQGASSADGVAIKLMTADKTLLGLNQNSYSYPLVSAADNNLDFYAAYKSTQTAVTAGLANSVASFTVNY. 176
327 2.000e-43gi|41464|emb|CAA29154.1| unnamed protein product [Escherichia coli]  clstr ali  30  1MRNKPFYLLCAFLWLAVS-----HALAADSTITIRGYVRDNGCSVAAESTNFTVDLMENAAKQFNNIGATTPVVSFRILLLPCGNVVSRRKGWVYW-RADSHNANLLALENTASAASGLGIQLLNEQQNQIPLNAPSSAWTTLTPGKNTLNFYARLMATQVPVTAGHINATATFTLEY. 175
328 2.000e-43gi|514233362|ref|WP_016536011.1| putative PRS fimbrial major pilin protein [Cedecea davisae]  clstr ali  21  1..MNMKKIVLAMAMSSAMIAGANAADQGHGKITFEGTVIEAACSINPDSLDQTVSLGSIARHQLLSGGK-STPRDFSIKLEDCDAKIGSNAEVTFNGPAGDQGEGLDKTFATTGVAAGVGVVITQAGGVIVEPNKPATA-IALNDGENELAFQAYAQGGTTTVATGAFSATANFVMNY. 175
329 2.000e-43T2D.2689091 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  24  1MLKKTLLSMFATALLSGVAFNALAANQGSGKITFKGEVIDAPCSIAPGDEDQTINLGEVADTVLKS-GQKSLPVDVTIHLQDCGTNTVDKVKITFSSASDATDSNLLKNTGNIGGATDVGVRLVKSDNTNVTLGTPITINFPTTNSYQELNFKARMESLGRTATPGNVQAQANYVLDY. 186
330 2.000e-43JGI.Meta JGI_HUM.0747929 7045193904 C3794534__gene_320001 fimbrial protein [Human Stool microbiome from visit number 1 of subject 158337416]  ali  24  1MLKKTLLSMFATALLSGVAFNALAANQGSGKITFKGEVIDAPCSIAPGDEDQTINLGEVADTVLKS-GQKSLPVDVTIHLQDCGTNTVDKVKITFSSASDATDSNLLKNTGNIGGATDVGVRLVKSDNTNVTLGTPITINFPTTNSYQELNFKARMESLGRTATPGNVQAQANYVLDY. 186
331 2.000e-43gi|646213297|gb|KDP99523.1| fimbrial protein [Cronobacter sakazakii]  clstr ali  26  6...........LLFCVALALTSAGVQADDDNVHFSGALVSEPCNLPDADKDIHLDFGTIVEKYLYQH-ERTKSQPFSIHLEECDPSVLSTVSVTFQGTADTVLNNLLALDASS-TAKGVAIGLELADGTPLPVNKPS-PFTQLNSGNTTLVFNAFVQAAGKNLTPGDFTAISTFLLNY. 174
332 2.000e-43gi|490366554|ref|WP_004246218.1| fimbrial subunit [Proteus mirabilis]  clstr ali  23  1MKLNYLKLFVISALSVGSVFAVSAVTVNGGEIFFKGELVNAACAVDSSSDGQIVKLGQVRTAKLAKAGDFSENTNFTIQLNDCDSKVASTAKVAFTGVSAAGQDDVLAVSSSSGGAKNVGIQILDSKSAPMSFGAGFGNATKLHDGKNIIPFQARYYALGAT-EPGIANANATFAVQY. 187
333 2.000e-43gi|497856674|ref|WP_010170830.1| type-1 fimbrial protein, FimA [Pseudomonas sp. PAMC 25886]  clstr ali  27  3.KINLINSVIAASLLSVGVAHADITTVNGGTIHFQGEVVNAACAVDTGSTDQTVQLGQVRTAALSAAGQTSTAVGFNIQLNDCDTSVSSQASVAFTGVTDPTNTEALALSSAAGAATNVGVQVLDRVGTPLTFGATFSNPLTLNDGTNTLPFQARYIATG................... 163
334 3.000e-43gi|515614476|ref|WP_017047076.1| hypothetical protein [Vibrio ordalii]  clstr ali  26  1MKKTIIASAMMMLSASVFAAAAE--DTGHGVVNFTGAIIDAPCSIAPESMDQTINMGLISNDLLEKQGET-PVRPFSIHLESCSTETAKAATVTFSGRSDSVEKKNLAI---SGAGKGAAIALVNQDDSVIELGTKTKA-ISIVEGDNVLQFGAKLVSEGDKATPGEFKATTNFIISY. 175
335 3.000e-43gi|496187889|ref|WP_008912396.1| fimbrial subunit [Providencia burhodogranariea]  clstr ali  22  1MMNRQFKKLIFILLL----PYAGTVFAIPDNLHFHGILVEEPCTIKPGDESVRLDFGNVPDKNLYAYG-RTVSEAFTINLSECDTSIGKSVNVTFFGTSNLVLPGYLALQNNS-SATGFAIGIEDIDGTFLPVNTQSNK-LSLQNGTTALKFKAYLKGEPDAIKRGPFNAIATFKLDY. 176
336 3.000e-43gi|503993406|ref|WP_014227400.1| fimbrial protein [Klebsiella oxytoca]  clstr ali  26  1MKPATLFFPLLMTFAGVHSASADDIDSGQVELDMTGTIVAESCDIDTASQNQTIHIGDFSAGIFQSVGDTSEWKQFDIKLNNCTSAISQS-TVAFSGTSDGSDPSLLALSDTSGGASGVAIELLDSSMNTIAINSTDNGY-PITQGNNDLTFRLRYKATAVPVTPGNASSVLYFDVSY. 179
337 3.000e-43JGI.Meta JGI_HUM.1463549 7053944145 SRS017521_Baylor_scaffold_54224__gene_115395 sfm fimbrial protein, A chain [Human Stool microbiome from visit number 1 o  ali  24  1..MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNTDSADQVVTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNLLAIVSSTNTATGVGIEILDNTSAILKPGNSFSTNQNLIPGTNVLHFSASYKGTGTSASAGQANADATFIMRY. 179
338 3.000e-43METAHIT MH0025 GL0130088 [Complete] locus=scaffold22423_1:6004:6546:-  ali  25  1..MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNTDSADQVVTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNLLAISTNTTTATGVGIEILDNTSAILKPGNSFSTNQNLIPGTNVLHFSARYKGTGTSASAGQANADATFIMRY. 179
339 3.000e-43T2D.2726288 [KEGG:K07352] type 1 fimbrial protein;|[COG3539] P pilus assembly protein, pilin FimA  ali  25  1..MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNTDSADQVVTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNLLAISTNTTTATGVGIEILDNTSAILKPGNSFSTNQNLIPGTNVLHFSARYKGTGTSASAGQANADATFIMRY. 179
340 3.000e-43gi|503309261|ref|WP_013543922.1| fimbrial protein [Variovorax paradoxus]  clstr ali  26  1...MQKSVLVKFASLAVAGVLSQGAFAADGTINFTGEIVDAPCSISPNSQNMTVPLGKVSRTAFDGVGKKATPAKFKIDLLGCGATA-KGATVTFSGTADLDDATNLRLANGVGAASGVAIELGDSAATKIPLGSPSGVYT-LGLGDNSLNFQAAYVATKTAVTVGPANSVAQFTVAY. 184
341 3.000e-43gi|490209957|ref|WP_004108360.1| fimbrial protein BcfE [Klebsiella oxytoca]  clstr ali  28  7...........LFLALLCGSPFCQAGDTGNNLEFTGTIVAQTCDVEISSVSQSIDLGQFSVEDFPATGTTTKFKPFNINLKNCSRGITGT-KIWFTGTADSDDPSLLALTDTGMGASGIGVELLDEDQDDVSMNNSESVVYPLKAGRNTLSFYIRYKSTRPVVTSGNATAVMYFDLQY. 177
342 3.000e-43gi|495736313|ref|WP_008460892.1| adhesin [Enterobacter sp. Ag1]  clstr ali  23  1.MNKFILSALALVPILCVPSVKAASPLGEINVELHGTIVDYTCVVETGGDNKTVKLGSWPTKQLRTAGSTTQAMPFNLKLTGCPPS--GTASITFNGK--STGTGLLALNAAS-TAKNVAIELLNEDKSRLLLNDASKTMPVDANGDVTLKFWANYIATADNADAGLANADATFLINY. 172
343 3.000e-43gi|505488987|ref|WP_015673633.1| P pilus assembly protein, pilin FimA [Serratia marcescens]  clstr ali  25  1MKKNLLAVAVX-----XXXXXXXXXXXXDGQVNFTGSITDVACEIDANSKNQTVNMGKIATTAFVGAGSTAGDRRFSLILKNCPASVT-AAAVRFGGKMVPGADGVLALTDATDMAEGVGIQITDEHNNVINLGLDSAVFPLVSTADNKLNFMASYYALANKVTPGSANAVAQFTIVY. 176
344 4.000e-43gi|501411148|ref|WP_012442714.1| minor fimbrial subunit PmfF [Erwinia tasmaniensis]  clstr ali  24  1..MNSIIIAAALLFAVLSSAPAMAAVLIGGDLRFEGEVVAYPCSVAPESERVPVNFGEISTKSLYINGK-SIPVPFSIRLQDCNPGLLNTVSVTFSGDENPNLANHLAIKATAGGASGVGIGLLEADNTPVSLGVPTTP-VTIGDSVMQLDLQAFVEAEPDTLTAGPFSATAYYLLNY. 181
345 4.000e-43gi|573498909|gb|ETS99428.1| putative type-1 fimbrial protein, A chain [Providencia alcalifaciens PAL-3]  clstr ali  26  1MKFKLIAIALPISLALSANVFAAPVTVSGGVVNFAGTIVNTPCVIDNDDASQTVNLGQYRQDGFDGKDSVSSPVGFDIKLTGCATETFKNASLTFDGNTILDEEKILAPVASQSGATGVGIQILQNNKLVTVNGSKATDAIKLNEGDSTLRFQAQYIALANEVTAGSANASANFTITY. 191
346 4.000e-43gi|556463226|ref|WP_023315071.1| hypothetical protein [Enterobacter cloacae]  clstr ali  24  1MKLNAIASAIILSSSIL----SGAALASDGTVHFRGEIIDSACEITTVTKEQNVDLGKVSKTAFNGVGSTSAPTQFTISLEKCPPT-YTKASVRFDGTEATGTPGDFTGTGDAVTATGVAIRIYNADNSQVELYKDSAT-TDIVDTKADLKFIARYIATSTTVTPGTANADSQFTVEY. 185
347 4.000e-43gi|495105320|ref|WP_007830143.1| fimbrial protein [Variovorax sp. CF313]  clstr ali  28  3.....KTIFVKLATLAVAGMLSQGAFAADGTVNFTGEIVDAPCSISPNSQNMTVPLGKVSRTVFATIGKKSTPAHFTIDLLGCGATA-KGATVTFSGTADLDDASYLRVANGVGAASGVAIELGDSAGTKIALGSPSGEYV-LGLGDNSLKFQAAYVATRTAVTVGPANSVAQFTVAY. 188
348 4.000e-43gi|503132592|ref|WP_013367253.1| adhesin [Enterobacter lignolyticus]  clstr ali  22  6.........IALLMGIAIALPALATPLGQVNIELTGNVVDFTCVAEGSDSDKSVSLGRWPAKQLRQAGSTTTAVPFTLRLTGCPPGA---ASITFAGKADGADPSLLALNASS-SASRVAVEIRDNDRRRLPLQQASRDVAVDAQGNVMLQFYANYIATADDPQAGSADADATFMINY. 171
349 4.000e-43METAHIT O2 GL0056557 [Complete] locus=scaffold67262_7:2006:2569:-  ali  24  1MLKKTLLSMFATALLSGVAFNALADDQGSGKITFKGEVIDAPCSIAPGDEDQTINLGEVADTVLKS-GQKSLPVDVTIHLQDCGTNTVDKVKITFSSASDATDSNLLKNTGNIGGATDVGVRLVKSDNTNVTLGTPITINFPTTNSYQELNFKARMESLGRTATPGNVQAQANYVLDY. 186
350 4.000e-43gi|496187226|ref|WP_008911733.1| fimbrial subunit [Providencia burhodogranariea]  clstr ali  28  4.KQRLIKSVIGLTVLSASGLGVAATTVTGGTVHFTGTIVNAACAVSANSTNQTVNMGQYRSAFFDAVGKKSGNVPFSIKLEDCDTTVSKKVSVSFSGLTTADNVTALSTSNXXXXXXXXXIQIADHLGQVLKPGSVFSTAQNLVDGANVLNFSANYISTKAVVTPGAADADATFTMQY. 185
351 4.000e-43gi|639210832|ref|WP_024548956.1| ferrous iron transporter B [Cronobacter turicensis]  clstr ali  24  1MKKQFIFAAIAMTAAGG-----EYTHAADGTVNFTGSIVDQACVVDIGTNDMTVDLGNVAKSSFTASGDESPETKFTLTLKSCPETI-TSARVKFDGLNDATNSSLLALTPEQGVAKGIAITLRTADKAGLGLNAVSDSYPLVSTGENTLDFYSAYRSTSDTVVAGKANAVATFTMDY. 174
352 4.000e-43gi|505189112|ref|WP_015376214.1| fimbrial protein MrfG [Serratia marcescens]  clstr ali  23  20.........ALLLVPMLMAAPLSALAAGDNNLYLHGALVAEPCVIPPGDEEITLDFGTIIDKYLYLN-TRTLGQAFEIHLEECDLTLGKTVSVTFTGTENQALPGLLAIDGGS-AATGIAIGFETPSAQPLPLNTQSGK-SLLQDGGNTIALRAYVQGEPQTIGRGAFSAVATFNLEY. 190
353 4.000e-43gi|515919109|ref|WP_017349692.1| hypothetical protein [Pantoea sp. A4]  clstr ali  23  1..MNLNAKMMALLVAMGISGAVNAANTGSGTVTFTGAIIDAPCSINPNSVDQTVNLGQISNAELATNTGTSTPQPFYIKLENCTTATLKSVQSTFTGPKSLWDADSLGIN---GSAEGASIILKDGSGAKIKLGEKTTAQA-LQDGNNTLSYSAYLQGGGAVIKPGNFQTVSNFTLSY. 176
354 4.000e-43gi|490379781|ref|WP_004259301.1| fimbria A protein [Providencia rettgeri]  clstr ali  21  5.KMKLNKLALVLGLGLAVVAGSASANQGGGQVTFKGSIIDAPCSIPPGSQAFEVQMGAIATSALNGGGK-SIARDFNIQLEQCDITTLKTVQTTFTGIPSTSVTDGLAI---AGTAKNAGIVITDYNGTKIALGAKSPSQTLLT-GANTLRFQAYLQGDDDAAVPGEFDAIATFALSY. 180
355 5.000e-43gi|640731873|ref|WP_025154719.1| ferrous iron transporter B [Morganella morganii]  clstr ali  25  1MKKT-----LLASLLTSVTFICSYANAADGQIKFSGSVIDNACDVTNNLANLNVNMGKISKSVFNNAGVTASSSTFSLVLKNCPNTVSG-AQIKFDGTSASGDNNVLSLTQETGVAKGIGIQLTDDTNTVIPLYSASKNYELKPNKENELNFIARYISISDDVEPGAANAVANFTINY. 174
356 5.000e-43gi|505806585|ref|WP_015704344.1| fimbrial protein BcfA [Enterobacter aerogenes]  clstr ali  23  1MKKHLLVMVAMTAGGMSCAANADTATVSGGTVNFTGQVVNAACSVSADSIDQTVTLSQVRTSKLTAAGMVANQKDFSIKLEDCDTTVSQNAAVIFNGQQDSSLAGSLANTAGAGSATNVALQLYGPDGQVLNIGDTSGT-ITLIDGENTVPLSVDYVATGAA-TAGNVAATATFSMVY. 179
357 5.000e-43gi|612278659|gb|EZQ72055.1| hypothetical protein AF53_02163 [Serratia marcescens BIDMC 80]  clstr ali  23  1MNKYMLNSLLLVGVPLAMTTITKAA-AADGTINFTGNVTDQTCTVVAGSANQTIPMGNISAKAFKSAGDTALPTKFSIALTSCPETVTK-ASVKFDGTYAQGNSTLLSLNSESGVATGLGVALYEADGTQIPMASFSNAQSVQKDINNVFTYVAKYMATSDKVTVGPANATTQFSISY. 177
358 5.000e-43gi|491305269|ref|WP_005163272.1| fimbria A protein [Yersinia enterocolitica]  clstr ali  26  1MKLNK--TILAAGLVLGFASMANAADQGQGTVTFNGSIIDAPCSIAAGSDAQTVEMGQISNVALQNGGK-SSAHDFKIKLENCDTTTLKTVTTTFGGAESAAVPGLLGI---TGVAEGAGIAIVDGTGSVITLGTATEQQT-LVTGNNTLAFSAYLQGSSDAIKPGSFSSVADFTLAY. 173
359 5.000e-43gi|489310334|ref|WP_003217751.1| fimbrial protein FimF [Pseudomonas fluorescens]  clstr ali  25  1MKKY-------LCILCLMPCLANQSYAADTSISITGYLKDNSCSVSVDSKDFTVDLMSNASKQLNHVGTTTVPVPFTIVFDKCGGSTTG-VRVGYSGTSDNDNIALLKIDEGVNAASGMGIQILNSDKQAIPLNTTSLRWTHLIAGSNTLNFYACLMATHSPVTAGVVNATANFTLE.. 172
360 6.000e-43gi|491073671|ref|WP_004935293.1| hypothetical protein [Serratia marcescens]  clstr ali  24  1MMEKK---VIMLAFVAAACSSALPALAADGQVNFTGNIVDAACKVTNDSNPLNVVLGDVARTAFAGGGSTSSATKFTLEVTDCPDTV-KSATVKFDGAADNGDSNVLQLTQETDVATGVGIQLSDISNSVLPLYTASTAYPLASGSKNNLDFTARYISTQADVTAGKANSVATFTLNY. 178
361 6.000e-43gi|506490737|ref|WP_015966115.1| P pilus assembly protein, pilin FimA [Enterobacteriaceae bacterium strain FGI 57]  clstr ali  24  1MMRKLIVSALALLAISPSFSVLAMGELIGGDLSFKGVVVAYPCSIAPESERVPVDFGEISTKSLYATGK-STPVPFSIKLQNCNPGVFNAVTVTFSGTENSNMTDRLAIKAVTGNAGGIGIGLLESDQTPIKLDVPTNA-TAITDTALQLNFLAFVEGEGGTLTTGPFTATANYTLNY. 182
362 6.000e-43gi|505192241|ref|WP_015379343.1| fimbrial protein [Serratia marcescens]  clstr ali  23  1..MTIRLCGLLLIALSVGSAAAAAKNQGHGKVSLGGTIVETPCGIASDSLDQTVDFGLISMTDASQDGQSGSRRHFTIKLVNCELAIYRAANVTFDGTADSGDPSLLGVY---GEAQGVAIELLNDAGTPIPLGSTTADY-QIVAGDNTLRFGAQLRLHPDKARAGGFSSLAKFTLSYL 183
363 6.000e-43gi|643853886|ref|WP_025263705.1| fimbrial protein FimI [Enterobacter sacchari]  clstr ali  25  1MMRTGLTQAFMLCMMPLL---AKAAVVDGGRVHLRGSLVNGACAVAPDSEDLHVQMGQHRTDAFSGIGSFSPSTGFALRLTACDADVSRYVGVVFSGQTPPEDPQVFVAHSTGGGAEGIGLALFDQQQRQIIPNSMPHAYSPLVADEITLHFSARYRAITERITPGHLRSDVWFTLVY. 177
364 6.000e-43gi|511289029|ref|WP_016349296.1| type I pilus assembly protein FimF [Aeromonas hydrophila]  clstr ali  20  1...MLRTLWIGLALCPLLAVTAAPRAGDDNTVHLHGRIIDQPCVIAPESLDQAVDMGVVDVRELYANG-TGAQVPFVIRLTNCKPGIFRMAKVTFTGSQDAQLSGGLAF--SAGSAKGAGIRLYDVTQSPLTLGTPSRGYLLGGTTENELQFSARVEGHPDAIQPGDYTAVANFIVAY. 182
365 7.000e-43gi|493863065|ref|WP_006809815.1| fimbrial protein FimI [Enterobacter hormaechei]  clstr ali  29  17.RRMTRTGILLCALAIAPAVNAHTVVIDGGKVHLRGELVNGGCAVAPDSQNMRVDMGQYRTNAFSGVGSFSTNVPFTVRLLDCSVDVSRTVGIQFQGVTPAEDPQVFLATSRPGVSSGVGLALFDEQQRQIIPNATAVSWLPINTRELAFHFSARYRAISEHLVPGTIQSNVWFTLIY. 197
366 7.000e-43gi|490379879|ref|WP_004259399.1| fimbrial protein [Providencia rettgeri]  clstr ali  22  1..MKIKSIAMATLLVLGGASAANAADQGHGKVTFKGAIIEAPCSIAPESIDQTIELGQISNMALADGGK-SSPKTFDIALQNCNSSLTKGVQLTFTGASASFDEDS-KTLGIVGTGSGAGVQITSGNGEIVTINTAT-PFQQIQDGSNTLQFSAYLKGNGSTITAGEFSSVADFTLSY. 177
367 7.000e-43gi|639223550|ref|WP_024560785.1| fimbrial protein [Cronobacter pulveris]  clstr ali  25  1MNKFNLACLVLLFTGL------PAANAAD-NLKFTGTIVGSSCDIDTSSTNQDVTIGQFSPADFPSVGTTTAAVKFNIKLKDCSGSITGS-KILFSGTSDNSDTSLLALSDTGKGATGIGVQILDANQSPISINNTDSDVYPLIGGDNTLVFYLRYKSTKADVTAGDATAVMYFDMNY. 175
368 7.000e-43gi|497781028|ref|WP_010095212.1| fimbrial protein [Burkholderia ubonensis]  clstr ali  30  1...........MLAALVAAFGSTSALAADGTVNFHGKIVATTCKVN--NANIQVPLGAIGVEQLAEAGRESRRVPFQIELNECNDQLSG-VRAQFEGVSHNDDPTLLAIGSGKDDAKGVGIQLMDEGGAQIGINSET-DTFQLTPGSNVLSFNANYVSTSNDVEAGAANGTASFTLNY. 163
369 7.000e-43gi|619738425|gb|AHY13664.1| ferrous iron transporter B [Citrobacter freundii CFNIH1]  clstr ali  26  1MKKNVIAKTLSAAAILM----ASNAMAYDGTVIFNGEILDSACTVDGGSNTLMVDLGRVAKTAFVSTGDEASTTKFTLRLKDCPASVA-AAKVKFDGAHDGNDSSLLAITQGSGSASGVAIRLKTADSVNLGLNQDNGTYMLSSTADNNLDFYAAYVATAVPVLPGAANAVANFTVNY. 175
370 7.000e-43gi|505736968|ref|WP_015698640.1| P pilus assembly protein, pilin FimA [Rahnella aquatilis]  clstr ali  25  1...MNKRNSFILLLGTMLCFSHSVAHAADGTINFTGQIVATTCDVNGGTTDINVDLGTVAATSFTAAGATSSPTAFTISLTNCPTT-FTAAAVKFDGTADAVDNQLLEV---TGGATGVGIEIADNQGTPIPLYTASRFYPIDATAEVDMNFIARYKSTAATVGEGAANATSQFTINY. 173
371 7.000e-43gi|490366218|ref|WP_004245882.1| fimbrial protein [Proteus mirabilis]  clstr ali  26  1MHKLMLIVALSLLFTTKGS-------AYDTLVHINARVTGNTCTVETNSKRITVKLGQIATKDFISTTQRTPVIPFSIKLVDCQPEAS-AVKVSFNGRADPIDNALLAIDAT--GAKGVAISIMDNSGASIDINDKSQSYTLLPNQDNTLQFYARYVATQLPVQAGSANATATFLLEY. 171
372 7.000e-43gi|495729741|ref|WP_008454320.1| type-1 fimbrial protein subunit A [Enterobacter sp. Ag1]  clstr ali  28  1MKIKNLAL-VALSALSLSSGAAYAVTVNGGTVHFKGEIVNAACAVDAGSVDQTVQLGQVRSARLAAAGSTSSAVGFNIQLNDCDTTVSTKASVAFSGVAVTGKTDTLAIQGAAGSATNVGIQILDNTSTPLALGATFSAKTTLNDGTNIIPLQARYI...................... 158
373 7.000e-43gi|545276156|ref|WP_021563425.1| hypothetical protein [Escherichia coli]  clstr ali  26  1MKLKHVGMIVVSVLAMSSAAVSVTTTVNGGVIHFKGEVVNAACAIDSESMNQTVELGQVRSSRLAKAGDLSSAVGFNIKLNDCDTNVSSNAAVAFLGTTVTSNDDTLALQSSAGSAQNVGIQILDRTGEVLVLGATFSAKTDLIDGTNILPFQARYIA..................... 167
374 8.000e-43gi|506320732|ref|WP_015840507.1| type-1 fimbrial protein subunit A [Pectobacterium carotovorum]  clstr ali  25  1.MHKSLLNTLIGASLLSSSVTVFAATVAGGTVHFKGEIVNAACAVSTNTADQIVNLGQYRTARFTGVGTYSGKVPFTINLEDCDSTVSTTAAVAFTGTADSNDNTVLAVSNXXXXXXXXXIEISDRTGAVLTPNGAVSAPQTLNDGSNVLAFNARYKATQATTTPGAADADATFTIDY. 182
375 8.000e-43gi|490214757|ref|WP_004113140.1| hypothetical protein [Klebsiella oxytoca]  clstr ali  25  1MKISKIASAVVL--TMGVASFAAQADQGSGKVTFWGSIIDAPCSIKNGYGDQRIELGQISNTHLDNGG-ISTPRPFDIELENCGDPMYNTVTVTFNGGNVPNDMTMLAI---TGQAAGAGVRIQDYSGTMVTLDKPTAGRI-LGIGDNTLSFSAYLIASVTNVTPGDFEAVTNFTLAY. 180
376 8.000e-43gi|446843231|ref|WP_000920487.1| F7-2 fimbrial protein [Escherichia coli]  clstr ali  19  1....MLKSTLGIAIAFSLCAVAHAANQGQGVVNFKGTVIDAPCGIDPDSADQTIDFGQISKSHLNSNG-ISVKKDLNIKLVNCDLSAKKTVQVTFNGATVNGHKDELGTAGDTGTA----VVISGQDGKLISFGTPGTAQ-NLKDGENTLHYSSWVKASDGTVKEGAFTAVADFNLSY. 172
377 9.000e-43gi|490967769|ref|WP_004829570.1| hypothetical protein [Acinetobacter bereziniae]  clstr ali  22  1MKLSLLSIAALSVLSGSAFAVEPPVTIEGGKVQFTGDLVNAACAVTTGSQNKPVVLGQYRTASLAEDGDSTSPVPFELNLTDCDPTVQATASVAFQGTPATTGSTLLQVNGDGNTAKNVGIQITDHTAKALGIGTVFSTPQTLIKGNNTLKFNAFYKATGES-TPGQANATATFFVKY. 180
378 9.000e-43gi|578248844|gb|EUM08935.1| hypothetical protein L465_03027 [Enterobacter sp. BIDMC 29]  clstr ali  22  13..LWRKKVAGLLLTQALITFAVPPVTAAD-NVHLYGALVAEPCVIPPGDEEIQLDFGTIVDKYLYQN-TRTLGQPFEIRLAECDISLGKTVRVTITGMENTALPGLLAIDAGSG-AKGIAIGLETLEGKPLPFNKSSDDYV-LQAGNNMIALKAYVQGEPQAIANGPFNAVATFSLEY. 189
379 9.000e-43gi|559224991|ref|WP_023581058.1| fimbrial protein [Proteus hauseri]  clstr ali  26  1MKLNKLGLVLGLGLTVA-AGSAFAADQGHGTVEFWGSIIDAPCSIDPNSGDQRVPLGQVSANALKDGG-RSVSNTFKIKLLQCSTETYKTVQTTFTGAEAAALPGSLGIE---GLAKNAAVVITDAGGTQIKLGEPTKAQT-IRDGSNDLNFAAYLQGSSDAAVPGDFTAIATFALTY. 174
380 9.000e-43gi|505805644|ref|WP_015703409.1| fimbrial protein [Enterobacter aerogenes]  clstr ali  23  1MKKLIISALVAASFAAVSTPTFAGATVNGGTIHFEASVVNAACAVDANSINQTVQLGQFKLSDFSKKGDETSRIPFSIKLNSCDPAVASTAAITFVGTPSESEQDVFALQ-GAGAAKNIALKLVDSQNKQIAPGQVSTG-VKLIDGSNELNYSASLISTSDEVSAGNANAVTNFMVTY. 192
381 9.000e-43gi|515944367|ref|WP_017374950.1| hypothetical protein [Enterobacteriaceae bacterium LSJC7]  clstr ali  23  1MKFNLIASALFMSLGLAT-MTVNAAEQGSGTITFSGAVIDAPCSVNPDASEQDVYLGQVALHQLSDGGS-SKPRDFKINLENCAALVAPSVKVKFEGVPADGDDDT--AFATRGDASGIGVVITDKSGKPIKVGGESDARELL-AGNNALGFSAYVLGMGKDVSVGEFESIVDFSLSY. 185
382 1.000e-42gi|495778592|ref|WP_008503171.1| MULTISPECIES: fimbrial protein BcfA [Enterobacter]  clstr ali  25  1MKKHVLAMVIATAMVSGVAMNAQAVTVSGGTVNFVGQVVNAACSVAADSVDQTVTLSQVRTVKLTTKGMQANQKDFKIVLEDCDTTVSQNAAVIFNGQQDAALAGSLANTAGAGSATNVALQLFGPDGNVLNIGDTSSN-VKLINGENTIPLSVDYIATGAA-TPGNVSSTATFQMVY. 179
383 1.000e-42JGI.Meta JGI_HUM.5858471 7039436802 C1744827__gene_157578 fimbrial-like protein sfmF [Human Stool microbiome from visit number 1 of subject 159814214]  ali  22  1....MRRVLFSCFCGLLWSSSGWAVDLGTININLHGNVVDFSCTVNTADKDKTVDLGRWPTTQLLSAGDTTALVPFSLRLEGCPP---GSVAILFTGTP-ASDANLLALDDPA-MAQTVAIELRNSDRSRLALGEASQTEEVDANGNVTLNFFANYRALASGVQPGVAKADAIFMINY. 170
384 1.000e-42METAHIT V1 GL0046306 [Complete] locus=scaffold70519_2:3444:3986:+  ali  24  1MKKQVIAMAVAGALAGGMAINAQAVTVSGGTVNFVGQVVNAACSVAADSVDQTVTLSQVRTVKLTTVGMQANQKDFKIVLEDCDATVSQNAAVIFNGQQDPAVEGSLANTAGAGSAKNVALQLFGPDGQALNIGDTSSN-VKLINGENIIPLSVDYVATGAA-EPGNVSSVATFQMVY. 179
385 1.000e-42T2D.2154519 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  24  1MKKQVIAMAVAGALAGGMAINAQAVTVSGGTVNFVGQVVNAACSVAADSVDQTVTLSQVRTVKLTTVGMQANQKDFKIVLEDCDATVSQNAAVIFNGQQDPAVEGSLANTAGAGSAKNVALQLFGPDGQALNIGDTSSN-VKLINGENIIPLSVDYVATGAA-EPGNVSSVATFQMVY. 179
386 1.000e-42gi|500023022|ref|WP_011703740.1| type-1 fimbrial protein subunit A [Escherichia coli]  clstr ali  25  20MKIKTLAIVVLSALSLSSTAATTPTTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTATLKQAGATSSAVGFNIQLNDCDTTVATKAAVAFLGTADSTHPKVLALQSSAGSATNVGVQILDRTGNELTLGATFSAETTLNNGTNTIPFQARYFATGAATPG-AANADATFKVQY. 202
387 1.000e-42gi|475955345|gb|EMU21868.1| fimbrial protein (pilin), partial [Acinetobacter baumannii ABNIH17]  clstr ali  19  40MKK-------FIFIAASSLFNIAAAQAADGTITINGLVTDNTCTIDTGDKNLTVNLPTVSSQSLKNAGDVAGRTPFQINLTNC-ASVGKVATYFEPGATVDFNTGRLLNQATSGAAANVNIQLLGSNNAVIPVQDNSQWVNVSAGGNADLNYYAEYYATGAS-TAGTVTSQVKYTIIY. 216
388 1.000e-42gi|554923964|ref|WP_023196213.1| fimbrial protein BcfA, partial [Salmonella enterica]  clstr ali  25  27................................KFVGQVVDAACSVSADSVDQTVTLGQVRASKLTEAGMVANQKDFTIKLEDCDTQTSQNAAVIFNGQQDANQPGSLANTAGAGSATNVALQLYGPDGQALNIG-ESSSTVTLNDGENVIPLSVDYIATG-TATAGNVTATATFSMVY. 171
389 1.000e-42gi|491328914|ref|WP_005186875.1| fimbrial protein [Yersinia intermedia]  clstr ali  28  1MSNFKKSAFIIALASSAFISQAFAADEGNGRIHFTGTVINAPCSIAPNSTDISVDLGQVANKVLETGNKYSQNVQYSIDLQDCDLTAMSKVSVTFGGVSDATSPALLAN---TGSAGGAGIRLIDTNGALLKVGDTGAD-VNLVTGPNQIVFAARVEATGAPVTTGTIVSQATYALNY. 184
390 1.000e-42gi|504696417|ref|WP_014883519.1| ferrous iron transporter B [Enterobacter cloacae]  clstr ali  24  1.MMIMKKNIILAMIATGSALMMGNAFAAAGTVNFNGNILDSACDVAVASQNQVVVLGDYYKTEFPTTGSRTAATKFNIILKNCPVTV-TSAKVRFDGTPDMTNTDLLAIDTSAGAATGVAINLMTADKADLPLXXXXXXXXXXXXADNTLDFYAQYISTAAAVTSGPANSVANFSVVY. 178
391 1.000e-42gi|503130079|ref|WP_013364740.1| fimbrial protein [Enterobacter lignolyticus]  clstr ali  24  3.NKTLLAAVTATLMVGASFNASADDNQGSGKITFTGEVISAPCSIAPGDEDQTIKLGEVADTVLNTAGQYSLPVPVTIHLQDCGTNTIDKVKVTFTSPGDATDPNLMKNTGNVGGASGVGVRLLDAGSNKVTLGTPVTVAFTTTNAYQELNFQARMESLTNNATPGNLKAQANYVLDY. 186
392 1.000e-42gi|619734431|gb|AHY09671.1| fimbrial protein [Serratia plymuthica]  clstr ali  24  1MKKLIILTTLCGTGYLFPAI----ATAADKEIDFFGTVVNRPCNIEPQSADQVVEMDTVIVKTLYRYG-HSNPVPFNIKLTDCKTAVFKSVNVTFSGTEDSELPGKLAINNGTNGA---AIALFDSKGTDIALNQATSA-VALQDGATVLNFTAYVQGHPKTITEGEFSSVANFVLAY. 174
393 1.000e-42gi|499457686|ref|WP_011145150.1| exotoxin [Photorhabdus luminescens]  clstr ali  23  1MKYLKLFVLRVGFMVIAATVYGHQGVQAADNMRFHGALVKEPCTIKPGDEDIQLDFATISEKYLYLHG-RTHSEPFLLRLSGCDMSVGKSFKLTFSGIENTQLPGLLALSAGSQAA-GIAIGIETAEGRRLPLNKEGDAY-PLKEGENLIALQAYVQAEPQTITRGAFHAIATFNLNY. 180
394 2.000e-42gi|489927786|ref|WP_003831118.1| adhesin [Citrobacter freundii]  clstr ali  22  11......ALLVMLPILIFSSLCHAASSLGEINIELRGNVVDFTCAVIASDSNKSVELGTWPTKQLQTSGDTTQPVAFTLKLEGCPP---GSASITFSGTPAPG-TTLLALDDAV-MAQKVAIELHDSDRTRLPLEQASQTVGIDENGNATLTFFANYIALADGVQPGLARADATFMINY. 177
395 2.000e-42T2D.3940879 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  24  1MKKHLLAMVAMAAGGMTCAANADTSTVSGGTVNFTGQVVNAACSVSADSIDQTVTLSQVRTSKLTAAGMVANQKDFSIKLEDCDTTVSQNAAVIFNGQQDSSLAGSLANTAGAGSATNVALQLYGPDGQVLNIGDTSGA-ITLINGENTVPLSVDYVATGAA-TAGNVAATATFSMVY. 179
396 2.000e-42gi|501097328|ref|WP_012147346.1| MULTISPECIES: fimbrial protein [Serratia]  clstr ali  22  1..MTKRIWGVVLIALSVCSAEATAKNQGHGTLNLGGEIVETPCGIASESLDQTVDFGLISMTDAALDTQIGSRRNFEIKLVNCELAIYRAATVTFDGTADSRDPELLAVY---GEAQGVAIELLTAAGIPIPLGSTTADY-QIVAGDNTLRFSAQLRIHPDRARAGGFSSLAKFTLSYL 183
397 2.000e-42gi|639218475|ref|WP_024555978.1| ferrous iron transporter B [Cronobacter pulveris]  clstr ali  22  1..MKNIVLSTVIAGIASCSVSAFAVSTGEGQVNFTGEILDSACEVNTLSSPLQVNLGKISKTVFTGVGSAATPTSFALQLKNCPATAT-AASITFGGTANSDNDKVLALTSGTGVASGVGIQLLDSSGSPLDLYTASADYTLKSGSTNDLAFGARYIQTAASVTAGKADSTSTFTVTY. 177
398 2.000e-42gi|496195664|ref|WP_008915501.1| frimbrial protein [Providencia sneebia]  clstr ali  25  1..MRTLKKSLIAVEVVLVLTTAPAAFA-SGTIKFTGEITDVACTVDSKSKNLNVELGKVSSKSLAAKGEVAGLKDFTIKLIDCPAT--SKVTVRFGGTRDLIDRDILAINQGTSAATNVGIALFEKDTTPIKLYEDTKE-VEFKGATVDLDYVARYKATG-TATAGPANSSAVYSIQY. 172
399 2.000e-42gi|639188537|ref|WP_024527774.1| fimbria A protein [Serratia fonticola]  clstr ali  22  1MKLNKIMMVAVVALGMSSVAHAAVKDQGHGKITFNGSIIDAPCSITQKSAEQTIELGQISKVALKDGGK-SSSHDFTIDLENCGPDAKNKVSVSFNGNVGSVKNRL-------GTGRGASIVIEDVNG-PIEL-TKATALQELQNGDNTLNFSAYLQGDGAAVTEGKFETVANFTLAY. 174
400 2.000e-42gi|649974865|gb|KDT00566.1| type-1 fimbrial protein, A chain [Escherichia coli 2-011-08_S1_C3]  clstr ali  26  1MKTKLIALSVLCAAMVPAFASAATVTTPGGEVHFVGEVVNGTCAVDADSVNQTVQMGQVRANTLAKQGDVGQNVGFNIVLKDCDNTLPATAAIIFSGVTNTTNAKVLALQSSAGGATNVGIQVLDRSGQPVAFGSTASASIKLNEGTNTIPFQARYMATGQA-TAGTANADATFTVQY. 188
401 2.000e-42gi|490380045|ref|WP_004259565.1| putative minor fimbrial subunit PmfF [Providencia rettgeri]  clstr ali  23  12.KRTKYLLSIGLYLLVSGPMSASVIPTNMGSYSFRGMVIATPCQIAPGSEKVPVDFQQISVKDLYKEGK-SKPLNFSIHLTNCNTTIFKSVTVTFNGIENKNLPDHLAISDQS-EASGIGIGLLNLNETPIELNTPSLAQ-NLATNNTEIQFKAYVEAEPQTITYGNFYSTAYYTLNY. 190
402 3.000e-42gi|446898133|ref|WP_000975389.1| fimbrial protein [Salmonella enterica]  clstr ali  27  1MMKGKFAVVAFAALLGVSSTAMADNKDGDGKIEFFGNIIDAGCQIDTGASNLSVKLGDVAKTTFTAAGDTAATTKFVLTLKDCPDTLNSKVTIKYSGTPDTTDNDYLQLTQETGVAKGVAIQLLNSDASPLPLGSASTQTVTVASNKAELDFFARYIATAAAIEAGKANGSVNFTMTY. 181
403 3.000e-42gi|583251626|ref|WP_024157766.1| long polar fimbrial protein LpfA [Salmonella enterica]  clstr ali  27  1....MKKVVFALSALAVVSTSAFAAESGDGTIKFTGEIVDAPCVVSTDSQNQEVVLGQVKKNIFKAIGDKSSSKPFQIKLEDCDITSNTKVNVSFNG---------------------VGIGIYDNANKLVEMNT-GKSTTTLAAGQTVLYYTANYVATKDTVTTGYGNAEVDFNLSY. 152
404 3.000e-42gi|446726729|ref|WP_000804042.1| fimbrial protein [Escherichia coli]  clstr ali  25  1MKPNMIVGALAFTSVFM----AGHLQAADGTVHFRGEIIDSTCEVTPETKDQVVDLGKVNRTAFSGVDDVAAPTAFSIDLTQCPET-FKSAAIRFDGNEDAHGNGNLAIGGAVSAAKGVAIRLYNADNTQVKLYENSAS-TPISNGNASMKFMARYIATETTIDPGTANADSQFTVEY. 198
405 3.000e-42gi|503130003|ref|WP_013364664.1| fimbrial protein BcfF [Enterobacter lignolyticus]  clstr ali  30  4..........FALAACVSLAMMAQPQAHQGTVYVTGTITDNTCAVSPDSKNLTVPMGDVSSKQFSRAGDGSRYEPFVINLEKCGGAASG-VTVHFAGTSDSRNPALLALTXXXXXXXXXXXXIYNPDKSLIPLGAESGNTPISPNATVALHFYARYIADGDSVAAGTANASATFVLTY. 171
406 3.000e-42gi|503771486|ref|WP_014005562.1| fimbrial protein [Collimonas fungivorans]  clstr ali  27  1MKQMTIAKLVAVAAAGLLS---QAAFADGGTVNFNGNIVDSPCTVDPSSQNITVPLGDVSRTVFGAAGKKSTPSKFTILLTDCGPTA-KGATVTFTGTTDAIVKDDLAIANGVTAATGVAIELGDSAGTKIPVGSASGTYV-LGLGNNPLKFQAAYISTSTAVTVGPANSTAQFVVAYL 179
407 3.000e-42gi|573499908|gb|ETT00390.1| type-1 fimbrial protein, A chain [Providencia alcalifaciens PAL-3]  clstr ali  26  1MKVKSLALVVIALSLGSVAAMAATTTVNGGQVHFKGELVNAACAVDAGSVEQTVRLGQVRTAKLAKLGDTSGSVGFNIQLNDCDTTVATSAKVAFTGAADATNPTVLVASSASGAATNVGIQILDGKSAPLGLGATFSNPITLNDGANVLPFQARYFALGAT-TAGVANADATFAVQY. 181
408 3.000e-42gi|516457055|ref|WP_017845895.1| hypothetical protein [Pseudomonas veronii]  clstr ali  24  1MNKKLI-----VCTLLACSAFSALSHAADGTINFTGTITDAACTVTPGTANQTVTMGTVSSTALANVGDTAAPTRFDIVLTNCPATATSAV-VKFDGPTDGNNSSLIALTSGAGTAEGVAIGVYEGDATLIPVGSPSVSKPLSPVADTTFNFFAKYVAT-APVVAGSGNAVSDFTVIY. 172
409 3.000e-42gi|30524677|emb|CAC85333.1| PixA protein [Escherichia coli]  clstr ali  21  1....MLKSTLGIAIAFSLCAVAHAANQGQGVVNFKGTVIDAPCGIDPDSADQTIDFGQISKSHLDADG-ISVKKDLNIKLVNCEPN--KSVKVTFSGATIASAANELGTVGDTGTA----VVISGQDGKLVSFGTEGSAQS-LQEGENTLHYSSWVKATGGTVKEGDFTAVANFNLSY. 167
410 3.000e-42gi|490839100|ref|WP_004701175.1| fimbria A protein [Yersinia aldovae]  clstr ali  25  1MKLNK--TILAAGLVLGFASVAHAADQGHGTVTFTGSIIDAPCSITPDTVDQTVNLGQISNVALTNGGK-STPRNFLIKLENCDVTTLDTVTTTFSGSESTAVAGLLGI---TGVAEGAGIAITDGSGSVVTLGQPTAGQTLVGP-NNTLTFSAYLQGSTAAVKPGNFYSVADFTLAY. 173
411 3.000e-42gi|639141580|ref|WP_024485066.1| ferrous iron transporter B [Serratia fonticola]  clstr ali  24  1MKKNIIAATLAAVALTSVS-----AFAADGQVKFTGEITDAACKVANTASPLDVQLGKVAKSSFTQAGDKSAATKFTLQLSDCPDTVS-TATVKFDGTSVNGDNSILALTQGAGVATGVGIQLSDDSNTVLPLFTESKSYSLQAGSTNNLDFVARYISTAAAVTPGPANATANFSINY. 174
412 4.000e-42T2D.3330176 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  23  1MNILQKFILLMFRSLFMMVISYNALANDTVVVTFTGQLLAKTCDITTGSKDQPVNMGTYDVNDFLNVGDVSGSHTFTINLEGCPTTTSTSANVQFTGDADAINTTLLRLTSSADSATGVGIEILDSNDKIIAINSESGFKELINNGDASLTFKLRYKSTQQNVHAGQANALLYFDIDY. 186
413 4.000e-42gi|515203645|ref|WP_016809922.1| fimbrial protein [Klebsiella oxytoca]  clstr ali  25  4...........LLIVTLIAGFSTGVFADDGKINFEGEVTDQACTVVNDLANLKVTLGTVSKASLDGKGKTAAATTFNIKLDNCPATV-NSASVKFDGQSANNDNTALKLTQETDVAKGVGIQLSDHTNAVVPLYTESAAYS-LTTGSNSIPFVARYIALQDTVDAGHANSTANFTVVY. 170
414 4.000e-42gi|502671738|ref|WP_012907556.1| minor fimbrial subunit PmfF [Citrobacter rodentium]  clstr ali  24  1..MHRIMIFLASLLTPLCTAPAWAGQLIGGDLSFKGVVVAYPCSIAPDSERIPVDFGKISTKSLSINGKTT-PVPFTIKLQDCNPSVFHSVTVTFSGTENPNLADRLAISATAGNAGGVGVGLLEADDTPVRLNVPTTP-TTVSDTVLRLNFQAFVEAEPDTLTTGPFTATANYTLNY. 181
415 4.000e-42gi|648450394|ref|WP_026142145.1| fimbrial protein [Serratia sp. S4]  clstr ali  19  1MNKARLSGLLLILLSGMSVSPQALADLGQINLIMRATLVSNACSVSAGSANQTVNLGTWAVKQFVETPQPLPLIRFTINLVDCGPAASG-IKVTFNGIPDTNNNQLFKLNAGS-TASRVGVAILDRNRSRIPPGGTSIPTQLTGNATNVLVFYAQYVATGGAVTAGSANADATFTMEYL 178
416 4.000e-42gi|573011653|dbj|BAO35005.1| putative fimbrial protein [Serratia marcescens SM39]  clstr ali  24  1MKLRTQRTMLLAGAYLVISSTSYAA---DGTINFTGTVTDQTCTVEAGSANQTIPMGNVSAKAFRSVGDTALPTKFNIALVSCPDTV-KKASIKFDGIYADGNTTLLSLNKETNAATGIGVALYEADGTQIPVASFSNAQSVQKDIRNVFTYVAKYMSTSGTVTVGPANATTQFSISY. 175
417 4.000e-42gi|575851964|emb|CDL85891.1| Major MR/P fimbria protein [Xenorhabdus cabanillasii JM26]  clstr ali  25  1MKMNKLAMILGFSVAL-TTGAANAANQGNGTVTFTGSIIDAPCSIK--NTNVEVDMGAVSSHILKKQG-RSESKFFKIELENCTTQTLKGVETTFTGSIASGESGYLGIE---GTAKGAAIAITDAGNNRLPLGTASKLFS-LHEGNNDLQFAAYLQGTSLSVVPGNFTAIANFTLNY. 177
418 5.000e-42gi|446696426|ref|WP_000773772.1| fimbrial protein [Salmonella enterica]  clstr ali  23  1MKLNLIASALVLSSTMLV----GNAMASDGTVHFLGEVVDSTCQVTPQTADQNVNLGKVNKTAFAGVGSTAAPTEFHIDLTGCPAT-YTKAAVRFDGTEASNSDGDLAIDGAAITASGVAIRIYNADNSQVKLYNDSASTIDTTAGTASMEFIARYIATDATVTAGTANADSQFTVEY. 189
419 5.000e-42gi|445934348|ref|WP_000012203.1| fimbrial protein ydeS [Escherichia coli]  clstr ali  23  10...........IFLGLCLGLTTYSALSADSVIKISGRVLDYGCTASSDSLNFTVDLQKNSARQFPTTGSTSPAVPFQITLSECSKGTTG-VRVAFNGIEDAENNTLLKLDEGSNTASGLGIEILDANMRPVKLNDAGMQWIPLVEQNNILPYSARLKSTQKSVNPGLVRASATFTLE.. 177
420 5.000e-42gi|505189260|ref|WP_015376362.1| fimbrial protein MrfG [Serratia marcescens]  clstr ali  23  1MKKTALAMALLCMSHTGWGAPPTVA------VNYRGELVAEPCVIPPGEENIELDFGTVIDKYLYLN-QRTAGKAFSLQLTECDLSLGETVSVSFSGTESAALPGLLAI--SSGGASGIAIGLENVSGELLPLNQPSGK-LRLQEGSNRITLKAYVRGEPEAIKRGEFVSTATFLLDY. 173
421 5.000e-42gi|491065587|ref|WP_004927218.1| fimbrial protein [Providencia stuartii]  clstr ali  25  1MKK----IILATLISGAMSASAFAVDAGKGTVTFTGSIIEAPCSIAPGDESQTIDLGQVSNVTLQKGG-MSAAQPFEIHLEGCTLNANNMVEVKFEGTEWVNNGSNTGLIQITGDASGAGIVLMNKSGAKININD-STVERAYTSGNNILSFQAALQGSDATVVPGSFQAVTNFTLAY. 185
422 6.000e-42gi|556426913|ref|WP_023311836.1| hypothetical protein [Enterobacter cloacae]  clstr ali  29  15MKAKKIALAIAMIAGAMIA-NANAKDQGHGTVTFTGSIIDAPCSITPDSADQTVDLGQISNLALEDGG-TSIPQAFAIKLQQCDXXXXXXXXXXFSGTASAANPDLLGIQ---GTAKGASVAITTDTGTPIKLGQASPAQALL-NGDNDLTFAAFLKGDGASAT............... 172
423 6.000e-42gi|491049047|ref|WP_004910698.1| frimbrial protein [Providencia rettgeri]  clstr ali  25  1..MSILKKSLAVIGVALAVTSAPTVFA-SGTINFTGEITDIACTVDSNSKNLNVDLGKVSAKSLASQGEVAGLKDFTIKLVDCP--ANSKVTVRFGGTRDTADRDILAINQGAGVANNVGIALFEKDTTQIKLFDDSK-QIEFDGATVDLDYVARYKATGVA-TAGPANSSAVYSIQY. 172
424 6.000e-42gi|635162078|dbj|GAJ66138.1| fimbrial protein [Edwardsiella piscicida]  clstr ali  24  18MKSIVLIVLLSIGQVVWAT--------GDNNLNFDGILVTEPCTLDPDTTDITLDFGTVVDKYLYTNMRTASKV-FNIRLLDCDVTLGQSVRVTFGGMPNKELPTLLAL--SSGPASGIAIGMEKSDGSALPLNKSTPSYT-LMSGDNILTFKGYVQGEPTAIILGNFTAVATFTLEYL 189
425 6.000e-42METAHIT MH0008 GL0036333 [Complete] locus=scaffold13109_10:17873:18421:+  ali  26  1MKIKTLAMIVVALSLSSTAALADTTTVNGGTVHFKGEVVNAACAVDAGSIDQTVQLGQVRSAKLATAGSTSSAVGFNIQLDDCDTTVATKASVAFAGTADSSNTTVLALNSAAGSATNVGVQILDNTGTPLALGATFSAATTLNDGPNIIPFQARYYATGAATAG-IANADATFKVQY. 181
426 6.000e-42T2D.2980948 [KEGG:K07345] major type 1 subunit fimbrin (pilin);|[COG3539] P pilus assembly protein, pilin FimA  ali  26  1MKIKTLAMIVVALSLSSTAALADTTTVNGGTVHFKGEVVNAACAVDAGSIDQTVQLGQVRSAKLATAGSTSSAVGFNIQLDDCDTTVATKASVAFAGTADSSNTTVLALNSAAGSATNVGVQILDNTGTPLALGATFSAATTLNDGPNIIPFQARYYATGAATAG-IANADATFKVQY. 181
427 6.000e-42gi|496189127|ref|WP_008913634.1| fimbrial protein [Providencia burhodogranariea]  clstr ali  27  20........................ADQGHGKVTFKGEIIDAPCSISSDSIDQTVWLGQIANSVLANGG-TSTAKQFNIELEDCDKVYNDKVSITFSGSSAGFNPKLLGVTGLDATAGNVGIQLTDTNGKALDMGVATSQEHQLQAGDNTLRYSAYVQGASVDVDKGKFEGVTNFTLAY. 186
428 6.000e-42gi|327412748|emb|CAX67751.1| fimbria A protein [Yersinia enterocolitica]  clstr ali  25  1MKFNKIMLSAILVFGASSMAQANPVMGATGKVTFSGKIVDAPCSIAPESVDQTVKMGSIANGALKAGGK-STPQPFMLKLTDCDVATKKSVVTTFTGGASESKDGHLGVI---GSAKGISVGIGDTAGNLIVLGKPVPS--ELIVGSNELNFTTFVKGDAAAITPGDFQAVAGFTLAY. 178
429 6.000e-42gi|497321245|ref|WP_009635458.1| type-1 fimbrial protein subunit A [Serratia sp. M24T3]  clstr ali  25  1MKYKTIALSVVASLSLVAXXXXXXXXXXXXXXHFTGQFVNAACAVSTDTADQTINLGQYRTASITAAGQTTTNIPFNIKLVNCDTTVATAASIAFTGTPDEDNSTLFAVNAGSTAASGVGIQLLDSASNDLPPGTTYSVAKTLTDGDNTIPFTARYKSTAATVTAGQADADATFVIQY. 188
430 6.000e-42gi|490366214|ref|WP_004245878.1| fimbrial protein [Proteus mirabilis]  clstr ali  24  1.MKKLLLSAIITSAMAIIATPALAVTVNGGTINFEGSVVNAACGVDSSSSNQTVRLGQFRVAEFTKKGDETGRIPFSIKLNNCDITVSSLAAITFNGTASDGDATAFALQ-GSGAATNVALKITDSSSKNVVPGQPSSTQ-KLIEGENQLNYNASLISTDDTVKAGSANVTTNFMVTY. 185
431 6.000e-42gi|578204933|gb|EUL65166.1| hypothetical protein P842_00991 [Enterobacter cloacae UCI 39]  clstr ali  30  1MKKXXXXXXXXXXXXLTMS----NAFASAGTVNFTGEIIDAACTVDAGSVNQTVDLGRYSKSEFTAAGDKTAATKFSIVLTNCPATVTG-ATIKFDGSADPANSNLLAV---TGGATGVAINLMTADSQDLPLGVNSHVYSLAETVPNTLDFFAQYEATSATVGVGPANGVANFSVSY. 171
432 7.000e-42gi|525768400|ref|WP_020825903.1| hypothetical protein [Serratia liquefaciens]  clstr ali  22  1MKLNKI-MLAAVMAMGVSSFAANAVDAGHGKVTFKGSIIDAPCSIDPDSIDQTVQLGQISNVALKDGGS-SSPKNFEIRLENCTLSTAKTVTTTFTGAKGVNG------LGITGTAKGASIVITDGKGAAIELGKATDAQG-IQDGKNTLSFSAYLKGDGKTVVPGDFTGIADFTLAYL 177
433 7.000e-42gi|506434072|ref|WP_015953789.1| fimbrial minor structural subunit [Escherichia fergusonii]  clstr ali  23  4MNILQKFILLIFTSLSMMVISCDALANDTVVVTFTGQLLAKTCDITAGSKDQPVNMGTYDANDFLNVGDVSDSHTFTINLEGCPTTTSTSANVQFTGDADAINTTLLRLTSSADSATGVGIEILDSNDKIIAINSESGFKELINNGDASLTFKLRYKSTQQNVHAGQANALLYFDIDY. 189
434 7.000e-42gi|639141323|ref|WP_024484816.1| fimbrial protein [Serratia fonticola]  clstr ali  29  6.KNIFIIAMSALVSSSAFADAPVGADQGSGRIHFTGTVINAPCSVAPGDADINVDMGQVANKVLETGNKYSQNVSYTIHLQDCDLSAMSKVGVSFGGTADSSVAELVAN---TGSAKGAAIRLIDANGDLLKVGDTSKD-INLVTGNNELVFAARVEANNQPVSTGTIVSQATYALNY. 188
435 7.000e-42gi|570288620|gb|AHE70805.1| ferrous iron transporter B [Enterobacter cloacae P101]  clstr ali  23  1MMKKTLLLATIAAGSVLTMANAFAAA---GTVNFNGNILDSACDVDVASLNQVVVLGDYYKTEFTATGARTAATKFDIILKNCPVSVTN-AKVRFDGTPDASNSNLLAIDTSAGAATGVAINLMTADKADLPLGSNGYTYMLSSSADNTLNFYAQYISTTASVTAGPANSVANFSVVY. 176
436 8.000e-42gi|501411001|ref|WP_012442567.1| fimbrial protein FimF [Erwinia tasmaniensis]  clstr ali  25  5...........VSILCLLSVFAGNTHAADSTITITGYLKDNACSVAVDSQNFTVDLMSNAGRQLYRPGAVTPAVPFTIVFDKCGSSA-TAVRVGYTGISDGDNATLLKLDAVSNAASGMGIQILDKDKDPVSLNSATLNWTTLTAGANTLGFYARLMATRSPVTAGIVNATANFTLE.. 172
437 8.000e-42gi|503580857|ref|WP_013814933.1| MULTISPECIES: exotoxin [Serratia]  clstr ali  24  3.MNNAMRTVLIGLSVGSLLNTALAATTPDVSVMYRGNLVAEPCTLLPEDESILLDFGTVIDKYLYLN-TRTHSKPFQLHLIDCDTRLGKTVKMTFSGTESVALPGLLALDAAS-EAKGVAIGLETQDGQALALNQQSRGQ-EITDGNNTLTLQAYVKGEPEAIKRGMFTAVATFALEY. 181
438 8.000e-42gi|502671232|ref|WP_012907058.1| fimbrial protein FimF [Citrobacter rodentium]  clstr ali  26  16.....................AADAFAADSTITISGYVRDNACAVAGESKDFSVDLLNNAAKQFSTVGATSPTVPFRIVLSPCGSAV-TAVKVSFVGTADNDNSHLLKLDGGALAASGMGVQILNDRQTALPLNAAASPWTTLTPGKNTLNFYARLMATRVPVTPGHVNATATFTLE.. 173
439 8.000e-42gi|578247222|gb|EUM07320.1| hypothetical protein L465_04517 [Enterobacter sp. BIDMC 29]  clstr ali  29  1MNKSVITMGFLLAAIASPSSHAAPGKGA-GTIEFTGMITASTCDVDINGQNPTIDMGTISSSAFKEKGDVAGIHRIQIELSNCDTAVLKSAGARFGGAYDANDNNLLALKTDGDAATGLGIEFLNEDGTSLKLGDNPNKFVPITTGAATLLYSARYKASLDAVTAGKADAVADYTIIY. 183
440 9.000e-42gi|491484498|ref|WP_005342239.1| hypothetical protein [Aeromonas veronii]  clstr ali  28  1MKKAIVASVLLAVFSGASSATPAATDQGHGVIKFIGAIVDAPCSIAPESVDQTINMGQISNSVLEHQGE-GPLRPFDIHLEGCSLDTAKTAAITFNGIPDDTEKKHLAIN---GFAKGAAIAISQLDGSEVVLGTPTKAAT-LVEGDNHLKFGAKLVSDGGKAIPGEFSATTDFIMTY. 183
441 9.000e-42gi|493711471|ref|WP_006661102.1| hypothetical protein [Providencia alcalifaciens]  clstr ali  23  23.........VFFSSILTSLLLCTSAFAADSTIIIKGNVKDNTCAVAPGSQNQVVDLLLNAVKQLHSVGEVTPTVPFRIELTPCGSAV-TAVKVGFVGIADLNNKSLLAIEPGSSNATGAGIQILDSAKNPLVLNADSNNWTPLVAGANTLNFNARLMASKLPVTAGHIRATATFTLE.. 192
442 9.000e-42gi|502753818|ref|WP_012988802.1| fimbrial protein [Xenorhabdus bovienii]  clstr ali  27  1MKTNLIISSLFLSSALVS-----AAYAADGQIKFTGDITATACKIDPSSANQTVNMGTISSSSFNGVNSTSAATRFSIILTDCPTEA-NYAQVKFDGNPDSRNNNLLALSNDNSAAGGVALGLYEADSTLISLAQSSITQKLTNKSKQELNFIAKYIATNSTVNPGSGDAVANFTIVY. 176
443 9.000e-42gi|559235503|ref|WP_023583053.1| fimbrial subunit [Proteus hauseri]  clstr ali  26  20..........................AYDTLVQIHARVTGNTCTVETNSENITVKLGDIATKDFTSTAQRTPIIPFSIKLVDCQPEAS-AVKVSFNGAGDLSDNTLLAINN--NGAKGVAISIMDKSGISIPINDKSQSYPLLPNQDNTLQFYARYVATQVPVSAGQANATTTFLLEY. 171
444 9.000e-42gi|501082907|ref|WP_012133454.1| fimbrial protein FimI [Citrobacter koseri]  clstr ali  28  1...MISKGVALVGLICAMPAFAHTVILESGNLHLRGQLVNGACAVNSESQDLRVQMGQYRTNVFSGTGSFAPSIPFALRLTDCSSEVYSHVGIAFSGVTPAEDPQVFLARSDTAATSGIGLALFDEEQRQIIPNSLPLHYAPILTQEMTFHFTARYRAISENMTPGSIHSDVWFTLVY. 176
445 1.000e-41gi|490355134|ref|WP_004234907.1| exotoxin [Morganella morganii]  clstr ali  19  1MNETIRRFFISTCGVFLLSLPGADAGAVPDNLYFHGTLVDEPCTIHPGDETVELPFGNIPDKNLYAY-QRTPSKDFRIRLSECDTSIGRRVTVMFAGDENPFISGALAISPGSQ-AEGIAVGLENADGTALAVNEVS-PQITLNDGLTLLNFRAYVQGEPDTIKRGPFSAIATFHLNY. 180
446 1.000e-41gi|639138676|ref|WP_024484129.1| exotoxin [Serratia fonticola]  clstr ali  24  1MRQILRSLCATVALLALSQGVQAA------KMRLHGTLVAEPCIIPPGEETIQLDFGTVIDKHLYHN-QRTSSREFKLHLSNCDQTLGKSVQVTFTGVENPALPGLLALDASSQ-ASGIGIGVETENGNSVPLNQLGTHRYPLATGDNYLRMMAYVQGEPDAITRGPFSASMTFALTY. 175
447 1.000e-41gi|639216724|ref|WP_024554437.1| ferrous iron transporter B [Cronobacter helveticus]  clstr ali  25  1....MKKIVIXXXXXXXXXXXXXXXXXHDGTVKFTGEILDQACTVNIGTDNLTVDLGKVAKTAFTGVGTEASTTKFTIKLKDCPASAT-SAKVKFDGANDPSDSSLLALDNVTDVAKGVAIKLMTADKAALGLNENSYSYALSSTVENNLDFYAAYRSTAATVEAGKANAVANFTVNY. 175
448 1.000e-41gi|490386717|ref|WP_004266214.1| exported pilin protein [Providencia rettgeri]  clstr ali  25  37.............................GEIKIRGQLVAEACTVRPGDENIIVDFGTIVNKYLY-INQKTPLENFNIHLDDCDNSIFRTVTVKFTGSENTHLPGLLALDSGS-MASGIGIEILEFSGKKIPINSTTPAY-NLENGTNILSFNANVQGEPDAIKNGHFTATAIFSLIY. 187
449 1.000e-41gi|500910564|ref|WP_012015821.1| fimbrial protein [Enterobacter sp. 638]  clstr ali  23  1MKRSTRVSFCALSVALLAAINVNEAQALDNNLHFSGTLVSEPCNLDPQTSDITVDFSSVVAKYLYQN-SRTLGVPFVVNLTDCDISLGSKVTMTFKGSENSTLPGLLAV---TGTAKGIAIGMETPEGTKLPFNQPTPEYA-IANGSNQFTLQAYVQGEPQTITPGDFSATATFELAY. 180
450 1.000e-41T2D.3432140 [KEGG:K07351] fimbrial protein;|[COG3539] P pilus assembly protein, pilin FimA  ali  30  1...MTRTGILLCALAIASAVNAHTVVIDGGKVHLRGELVNGGCAVAPDSQNMRVDMGQYRTNAFSGVGSFSTNVPFTVRLLDCSVDVSRTVGIQFQGVTPAEDPQVFLATSRPGVSSGVGLALFDEQQRQIIPNATAVSWLPINTRELVFHFSARYRAISEHLVPGTIQSNVWFTLIY. 179
451 1.000e-41gi|575544076|gb|ETX44495.1| hypothetical protein P805_01832 [Serratia marcescens BIDMC 44]  clstr ali  20  28...............VATPLSAMAAGENENNVHLYGALVAEPCVVPPGDEEIHLDFGTIIDKYLYLN-TRTLGQQFEIRLAECDLTLGNTVKVTFMGTENRALPGLLAID-GSSEATGIAVGLETTEAQPLPINKESGEYV-LQEGSNNIVLKAYVQGESKAIEAGPFNAVATFNLEY. 192
452 1.000e-41gi|493180209|ref|WP_006178641.1| fimbrial protein BcfA [Enterobacter cancerogenus]  clstr ali  25  1MKKHILALVTAAALTGGICANAQAVTVSGGSVDFVGQVVNAACSVAADSVDQTVILSQVRTVKLTQAGMMANQKDFQIKLEDCDTSVSQNAAVIFNAQQDEAQPGTLANTAGAGSAQNVALQLFGPDGKALHLGTSSST-VKLINGENIIPLSVDYIATGAA-TPGNVAATATFQMVY. 179
453 2.000e-41gi|639222885|ref|WP_024560226.1| hypothetical protein [Cronobacter pulveris]  clstr ali  26  1....MKKISIVSLALLAFMANSAVCNASDGKITFTGKVIAEGCDVDTADQNKSVALGTVAATQFAAAGDKSPLIPFTLKLSECPEAVTK-VAIRFDGTPNSTNAKLLALDAD-QTATGLGIEISDDAGTAIDLATNSKTYTV--DTTAELKFGARYVSTG-TVGAGTANGTSQFTVIY. 169
454 2.000e-41gi|648450746|ref|WP_026142497.1| fimbrial protein [Serratia sp. S4]  clstr ali  26  1....MKKSLLVLMMTGSVMAGANMAHAADGTVKFTGNIIADACTVDTASKDQTVVLGDVSTKAFAAAGDKASPTKFKIRLTTCPTSL-TSVTVKFDGVSDSANTNLLKLD-SAQTATAVGIEIADNNGVPIPLHTASPTYPIAADHTADLTFVGRYXXXXXXXXXXXXNGTSQFTINY. 172
455 2.000e-41gi|503130002|ref|WP_013364663.1| fimbrial protein BcfE [Enterobacter lignolyticus]  clstr ali  25  5..........VLSGLWLCGAFAAHADDGSYNLKLTGTIVAETCNVDASSETQTVRLGQFSTADFPTVGSTSRSAPLPITLTGCTQNITGG-QVWFTGTADSDDPSLLALSDTAQMATGVAVQILDGSQSPVSINNTHSAVYPLHAGDNVLTFNLRYMSTKSQVTAGNATAVMYFDLQY. 176
456 2.000e-41gi|486195841|ref|WP_001546606.1| fimbrial-like adhesin protein [Escherichia coli]  clstr ali  24  85......................HGAGQSSRTWEISGRVLDYGCTVSSDSLNFTVDLQKNSARQFPTTGSTSPVVPFQITLSECSKGTTG-VRVAFNGIEDAENNTLLKLDEGSNTASGLGIEILDGNMRPVKLNDAGMQWIPLVEQNNILPYSARLKSTQKSVNPGLVSASATFTLE.. 241
457 2.000e-41gi|566074435|ref|WP_023993960.1| fimbrial protein StdA [Salmonella enterica]  clstr ali  21  1MRNKIILAMAAAGMMYGASVYATAGPFGSGKILFTGTITNSPCDIAPGDDAITVPFGQISYRKLNTTDATTESKPFTIHLQNCPVGKMSKVTVSFSGGANVAKKAY----TTSGSAQHVGVQLLKSDNTAIEPNTPEGDAQQLQAGNNELNFYARLIALDNGVTPGDFTASVTYTLKYL 194
458 2.000e-41gi|559224960|ref|WP_023581052.1| fimbrial subunit [Proteus hauseri]  clstr ali  23  1MKLKTLPLPVICGLTLLIGIFS-AANAAPNNMRLYGTLVDEPCVIKPGDETISLEFGNVPDKTFYIGAGRTNSQNFQIHLSECDLSINKRVRVTFSGTENQAGQGFLALSTGSQ-AEGIAIGLENSDGSPLRINQETSN-IALNSGDSILRFRAFIQAEPNAIKRGRFSAIATFHLNY. 182
459 2.000e-41gi|640856843|gb|AIA45941.1| fimbrial protein MrfG [Serratia sp. FS14]  clstr ali  23  1MKKTLLPLALFYISHACWSAAPTVA------VNYSGVLVAEPCVIAPGEENIELDFGTVIDKYLYLN-QRTPGKEFFLQLMECDLSLGETVSVSFSGTESAVLPGLLAIN--SGGANGIAIGLENTVGELLPLNQSSSKY-RLQAGSNIIMFRAYVRGEPDAIKRGVFSSSATFLLDY. 173
460 2.000e-41gi|485679635|ref|WP_001316249.1| fimbrial protein [Escherichia coli]  clstr ali  31  17.MLKRIIWILCLLGLTGSCEL----FAHDGTVNISGSFRRNTCVLAQDSKQINVQLGDVSLTRF-SHGNYGPEKSFIINLLDCGTDVS-TVDVTFSGTPDGMQSEMLSIESGTDAASGLAIAILDDAKILIPLNQASKDYS-LHSGKVPLTFYAQLRPVNSDVQSGKVNASATFVLHY. 186
461 2.000e-41gi|635765249|gb|KDF46778.1| hypothetical protein AE07_02633 [Enterobacter cloacae BWH 43]  clstr ali  26  1MKPIIFWIVATVYTGFAFCL---PVQAHDGTVYINGKINQRTCTVATDSQALLVKMGNVQRNQFTQVGDSSYYESFTINLENCQGS-KQNMSISFEGAPDKSNPSLLALTPDAASATGIGIGIYNQDKTLIPMGKPSSTLTPAQASDTAFIFFARYVSTVTDVTTGTANASTTFIVNY. 175
462 2.000e-41gi|491425810|ref|WP_005283605.1| type-1 fimbrial protein subunit [Edwardsiella tarda]  clstr ali  23  1MKKILLPVMALSASVM-----SGQVSAANGTVNFTGEIINSTCQVSGDSKNIDVYLGKYPTSAFKAIGDKSASKAFQINLEQCEPGTY---TVRFDGNTVAGHPDLLAVDGSTAAAQGLGIEITDINGKHFAINKATPTVKVVGDKKAVFNLQARYRSYADTVTAGLANATSPFTIEY. 176
463 2.000e-41gi|503577744|ref|WP_013811820.1| MULTISPECIES: type-1 fimbrial protein subunit A [Serratia]  clstr ali  26  1MNFKLIPLALISALTLGAAMNASAATVNGGTVHFKGDVVNAACAVNTNSFDQTVHLGQVRTAKLAKDGDKSTPVGFNIELNDCDTTVSSTASILFDGVSVSGKPTVLALQSSAGSATNVGVQILDSTGTPVMVGSAASTAYTLSDGTNKIPFQAAYY...................... 160
464 2.000e-41gi|491046275|ref|WP_004907930.1| fimbrial protein domain-containing protein [Providencia rettgeri]  clstr ali  27  1MKLTKIALATIIASSFGIA-NAAPVDQGSGIINFTGKVINAPCSI-PGDGTINVDLGQVANKVLETGNKYSQSVQYNIQLENCDLGAVSKVKVTFTGTPDTTAKELLANTGTS---KGVGVRLINADGATMKVGDTS-VELPLADGPNKLAFSARVEANGSKVETGSIISQATYALNYL 185
465 2.000e-41gi|491063641|ref|WP_004925273.1| fimbrial protein [Providencia stuartii]  clstr ali  24  1....MKKIILATLISGAMSASALAGDAGSGTVTFNGSIIEAPCSIAPGNENQTVELGQVSNVTLAAGGE-SSAQPFSIKLEGCNLENNNQVTVIFSGAAVDGEAANTGLLQISGDAAGAAVKIMNSSNTQIKINDNDGYTRNYVQGNNELKFQAALKGAGATVVPGNFSAVTNFTLAY. 177
466 2.000e-41gi|506490297|ref|WP_015965675.1| P pilus assembly protein, pilin FimA [Enterobacteriaceae bacterium strain FGI 57]  clstr ali  23  1MNKKLLPIAALII-----SASAMNAYAVNGKVNFTGEIIESTCTVTSGDQNKDVFIGKYPTSAFATKGDVTASKAFTINLEKCEAGDY---SLRFDGPSVAGNPNLLSVDQ----AGGVGIEILTNDEKVIPINQASSPWVNVATGTATFNLKARYKSFLDKVTAGSANASATFTIEY. 174
467 2.000e-41T2D.3940100 [KEGG:K07351] fimbrial protein;|[COG3539] P pilus assembly protein, pilin FimA  ali  25  1...MRFTLLIATSALLLGGLAQADTKLVGGDMYFHGTIRALACSLAPGGDKIEVDFGQIATQDLYLSG-RSKPKKFSIELRDCNPEVFRGISVTFSGSEDAELADHLALDSSEQGASGIGIGMSEEDGTAIRLD-ESTSVKEITEGSMTLNFLAWVAAEPSALKNGPFSASGTWTLNY. 178
468 2.000e-41gi|555283061|ref|WP_023258741.1| fimbrial protein StdA, partial [Salmonella enterica]  clstr ali  24  45MRNKIILAMAAAGMMYGASVFAADTTPGSGKILFTGTITNSPCNIAPGDDAITVPFGQISYRKLNTADATTESKPFTIHLQNCSAGKMSKVTVSFSGTADTSGKAYV----STGRAQHVGVQLLKSDNTIIEPNTPMTDAQQLQAGNNELNFFARLIALDNGVTSGDVNASVTYTLKYL 239
469 2.000e-41gi|518240380|ref|WP_019410588.1| hypothetical protein [Pseudomonas psychrophila]  clstr ali  22  1MNRKLKTRAILLALMLMPFMMSKQVQAAD-NLNFIGNLVAVPCTLRPGDDAVTLDMSEISTHYLYAN-SRTIGKQFNIHLEGCDTSIADSVTTTFSGTPSPALPGLLALD-GSSVAEGIALGIETSANLPLPLNTPSEAHTLI-DGNNIIAFKAYVRGEPQAIVAGVFTAVSTFKLDY. 182
470 2.000e-41gi|644519192|ref|WP_025327339.1| hypothetical protein [Aeromonas hydrophila]  clstr ali  23  1MKKSLLAMAVVLSSGMSLNAFAPPTTVTGGTVYFNGEVVNAACAVSSDSLDQTVYLDQVRTAAFNGAADAPANQPFEIKLVDCDTTVQTTAAVSFTGTTVAGKTSVLANSAGSGAAQGVGLVLMGPDSAVLEINTVPSSKVTIVDGTTVIPLSVDYISTSTVVTPGPVSSVANFNVHY. 183
471 3.000e-41gi|546165539|ref|WP_021807390.1| type 1 fimbriae major subunit FimA [Serratia fonticola]  clstr ali  26  1MKINKL-GAIALSILALNSTSVLAAEAGGGKVYFKGEVINAACAVDAGSIDQTVQLGQVRSAKLAKAGDTSPAVGFNIQLNDCDTAVSTKASIAFSGTADSTNTTVLATQSTSGGAKNIGVQILDKTGSPLVLGSTFSTAMALNDGSTAVPLQARFYATGAA-TAGTVSADASFKVQY. 186
472 3.000e-41gi|485822597|ref|WP_001439003.1| fimbrial protein [Escherichia coli]  clstr ali  22  338.RRMRRALFSCFCGLLWISSGWAADPLGTININLHGNVVDFSCTVNTADIDKTVDLGRWPTTQLLNAGDTTALVPFSLRLEGCPP---GSVAILFTGTP-ASDTNLLALDDPA-MAQTIAIELRNSDRSRLALGAASPTEEVDANGNVTLNFFANYRALASGVRPGVAKADAIFMINY. 509
473 3.000e-41gi|503125198|ref|WP_013359859.1| fimbrial protein [Pantoea vagans]  clstr ali  25  1MKLNKKDLLVLGASALFPMGSALAATASGGSVNFNGSVVTSACAISANSANIDVDMGEVRTATLAAAGSEASAKTFSIALEDCAIAAATTVSVTFSGTPDANDANSLAVNGGTASAQNVAIRLYDEQGNVVKLGEAATA-TPLRKGSNTLNFSAKYYSPTGGATAGDASAVATYTVTY. 191
474 3.000e-41gi|505156968|ref|WP_015344070.1| P pilus assembly protein, pilin FimA [Serratia marcescens]  clstr ali  24  7....KRRGALLAAGVLMLGGLTAPPAAADENMRFEGALVAEPCVIPPGEALIWLDFGTIADKYLYLNG-RTLSQTFSLHLAECDLSLGNTVAVTFSGAENARLPGLLALDGGS-SASGIAIGLENLDGTALPLNNASKKY-RLAAGSNLIALQAYVRGEPQTIGRGEFSATATFSLEY. 182
475 3.000e-41gi|496090591|ref|WP_008815098.1| minor fimbrial subunit PmfF [Enterobacteriaceae bacterium 9_2_54FAA]  clstr ali  25  10..........AAIFLLLSGPIYAQTELIGGDMRFHGTVEALPCSVKPGGDKIGVNFKQISTKDLYSN-KTSPPVPFTIPLENCSDAVFKTVSVTFSGIESTELPNHLIINPVSSSASGVAIGLKESNGSAIELNKPTTAE-NIANGSMDLTFQAWVAGEPTAITLGPFTATANYTLTY. 181
476 3.000e-41gi|649974869|gb|KDT00570.1| protein fimF [Escherichia coli 2-011-08_S1_C3]  clstr ali  25  1MKFTPQIILASALCFTPLSVL---ADGEQTTITINGYIVDNTCVVSEESLKIPVDLQTNNAKDFFRVGTTGPAQPFSIILAPCGQQVGD-VKVQFSGVADDTNTDLLKINSGNGTASGVGIELLDNQQQQIALNSSSLTAVSLVPGTNTLTYYARLMSTHYPVGAGAVSATATFTLEY. 177
477 3.000e-41gi|488365312|ref|WP_002434697.1| fimbrial protein [Escherichia hermannii]  clstr ali  23  4.........VVALFISLTSLFIMPCFASDGVINFSGKITDQSCEIDTQASTLNVNLGSYSISQFGSVGVTSLPIPFTIKLKNCPNTEEIRFNVALSGVSEPTNPDYLKIND--GGAQGVAIVIKDKDGAVVPINKTSPTVYDIPDVEMELKFTAYYISTSSLVKPGDANSTTDITLVY. 172
478 3.000e-41T2D.3937629 [KEGG:K07348] minor fimbrial subunit;|[COG3539] P pilus assembly protein, pilin FimA  ali  25  1MMMKKPLNLFGAVLTLVCA----NAFAADSTITISGYVRDNACAVATESKEFTVDLMDNAAKQFNAVGATTPLVPFRIVLSPCGSSV-TAVKVGFNGTPDSDNNDLLKIDGGASAAAGMAVQILNGQQTMLPVNAPSSAWTTLTPGTNTLGFYARLMATRVPVTAGHVYATATFTLE.. 175
479 3.000e-41gi|495382867|ref|WP_008107577.1| fimbria A protein [Pantoea sp. YR343]  clstr ali  25  1MKLN--ALAIATLIALGTTSASHAADQGSGTITFTGSIIEAPCSVSHENSDQTVDLGQVSNVSLANGGK-SQPRQFNIMLENCALXXXXXXXXXXXGPAGNSD-----RVGIAGTAKGASIAIVDGTYNLIKLGTPSVAQA-LQDGNNNLSFAAYLQGDKDPIVPGEFQAVVNFGLNYL 176
480 3.000e-41gi|575537774|gb|ETX38219.1| type-1 fimbrial protein subunit [Serratia marcescens BIDMC 44]  clstr ali  25  62MKKVLLPL-----AALVLSATASNAMAANGNVKFTGEIVQSTCKVVDKDQNKEVYLGKYPTTAFPTAGSTSGAKAFDISLEKCE---AGNYTLRFDGNTPAGHPELLAV---TGGATGVGVEILDNNGSTLPISQTPATVTVAADGDNTFNLRARYKSFQDLVTAGQANSNATFTIEY. 235
481 4.000e-41gi|493180219|ref|WP_006178647.1| fimbrial protein BcfE [Enterobacter cancerogenus]  clstr ali  24  1..MKTVLLKALTLFALIHSLAVYADDGAVYNLRVTGTIISESCEVDTSSQEQSVSLGEFDSSDFPSVGATSAWVPVNITLKNCSKAINGT-KIWFSGLADTDNPNLLALSDTSTLAAGLGVEIMDASQVIVPINNSESSTYPLQTGNNELTFNLRYKSTRQDVTPGDATAVMYFDLLY. 180
482 4.000e-41gi|491106629|ref|WP_004966454.1| S-fimbrial adhesin protein SfaG, partial [Serratia odorifera]  clstr ali  25  7........................ADLGVINISITANLVANTCSVSLASQNQTVQMGDWADKQF-AVNPETLAKPFILTLEDCDAGARG-VKMTFNGTANGADSSLLALT-GAGSAQNVGLAILDKDKNRIPLGKPSGIYPLAGPGKQNLQFYGQYVATAQPVKAGLANADATFSLEY. 158
483 4.000e-41gi|640699627|ref|WP_025123593.1| MULTISPECIES: ferrous iron transporter B [Serratia]  clstr ali  25  1MKKNLIAVAV-----LXXXXXXXXXXXXDGQVNFTGEIIDSACVVNTPSNPLNVVLGKVAKTAFTGTGSTAAATKFTLQLTNCPATV-NTASVKFDGTSVNGDTTLLALTQESGVATGVGIQLADASNTVLPLYAASMAYPLVSTATNNLDFVARYIATAATVTAGPANSMASFTVNY. 174
484 4.000e-41gi|491171517|ref|WP_005029884.1| type-1 fimbrial protein subunit A [Acinetobacter bereziniae]  clstr ali  27  1MKKISL-----IAFALVASSTSFAATVTGGQVHFTGDLVNAACAVDVNSDGQTVDLGQHRVSKFKKAGDMSGPVPFQINLVDCEAAVTKGVSIAFKGSTTATNPKLLVVGAGASAAQGVGIQISDSSSTALALGTGFTKEIALNDGTNSFGFTARYVSTGPTLTAGKANADATFVVNY. 181
485 4.000e-41gi|503132596|ref|WP_013367257.1| fimbrial protein FimI [Enterobacter lignolyticus]  clstr ali  30  1..MLRMLALLMVLCATAPPAFAHRVVVDGGRVQMRGELVNGACAVAPESQSLRIDMGQYRTNTFAGVGSFSTTVPFTLKMVDCRTDISRLVGVTFQGLSPAEDPQVLAATQVSGAGSGLGLALFDNKQQMIIPNAPPVTYFPVTTGEMTLYFSARYRVISLPLTPGAITSDVWFTLIY. 180
486 4.000e-41gi|501408597|ref|WP_012440163.1| fimbria A protein [Erwinia tasmaniensis]  clstr ali  25  1MKLNKLSAVLGLGFVLA-SGAAFAADQGHGTVTFKGSIIDSPCSITPETANQTVDMGQISNKALQNTGK-STARPFYIKLENCDVSTNKTVTTTFTGTASKAQPKNLAL---VGQASGAALVITNGDGAAIDLGSASLP-TSVQTGNNTLSYAAYLQGDSAAVVPGDFSSVANFTLAY. 176
487 4.000e-41gi|573012726|dbj|BAO36078.1| fimbrial protein [Serratia marcescens SM39]  clstr ali  24  4MMKNYRTITALCGIGFLFS---SAVAAENKEIDFFGSVVSRPCNIDPQSLHQTVEMDTVLIKTLYRYG-HTNPVSFSIRLTDCKTAVFKSVTATFTGTEDAELPGKLAINNG---ANGAAIALFDGAGKAIDLGTPT-DAVTLQDGPNALRFSAYVQARPSALTEGEFSSVANFVLAY. 178
488 5.000e-41gi|578181287|gb|EUL41615.1| hypothetical protein P852_01000 [Enterobacter cloacae UCI 49]  clstr ali  25  1MKNTRRFFIMCLLLNVFI----FDVEAHDGTVTISGTIQDNTCELATDSQNKTVEMGVLAVNQFTRKGNQTPEKAFSINLINCGPAASE-ASVTFSGTPDPQVNTLYSLDHSSDAATGIALGIYDSNAQPIAPGAQSLGVALEPGQTVELAFTARYVSVDDNVEMGSANVYVTFIVNY. 174
489 5.000e-41gi|639138670|ref|WP_024484123.1| fimbria A protein [Serratia fonticola]  clstr ali  24  1MKLNK-FMVAAIALGFVSAANAAPKDAGHGTIEFYGSIIDAPCSIAPGDDNQRIPMGQIANVALKDGGK-STPENFYIHLENCDASTLKTVTTTFTGPTSAGNADLLGI---TGTARGASLAITDGSGTLIKLGQATAPQG-IQDQTNILNFSAYLQGTASEIVPGDFSTTTTFTLAY. 179
490 5.000e-41gi|639216396|ref|WP_024554137.1| fimbrial protein [Cronobacter helveticus]  clstr ali  25  6..........MTLFCLAGLLAASQAVNAEDNLKFTGTILPPTCNVDAASAEQTVNLGEFTPRDFSTVGATTAATKFQIKLKDCGNGATGS-KVWFSGTGDSDDPTLLALSDTGTGATGIGVQILNKDQQPVSINNTDATVNPVQAGDNTLDFYLRYKSTKSAVTAGNATAVMYFDLTY. 175
491 5.000e-41gi|612268800|gb|EZQ62330.1| hypothetical protein AF54_02178 [Serratia marcescens BIDMC 81]  clstr ali  25  20......................SGAAQAD-NVRLHGALVAEPCVIAPGDESVRLDFGTVIDKYLYAN-ERTHGQAFDIHLTECDLSLGKTVKVTFSGTENPNLKGVLAIDGGS-RASGIAIGMETQGGQPLPLNKAGEGY-RLVNGNNTLTVLAYVQGEPEAIVRGPFSAIATFSLEY. 176
492 5.000e-41gi|505805647|ref|WP_015703412.1| fimbrial subunit [Enterobacter aerogenes]  clstr ali  28  1MSNIYKTMIICFLCFQALLG-----HAADTRIYVNGNLIGNTCTVSSQSKNMTIKMGNIGSKDFSSDGLWAAELPFSIDLTDCQTESIG-VKVHFLGTPDTNNKELLRTLD--NGAKGLAIRLMDENKNPIAINQSSKVYVINPELDNKLNFYARYVLTQDNLTPGPANAVSTFMLEYL 175
493 6.000e-41gi|550552306|ref|WP_022631403.1| fimbrial protein FimF [Klebsiella pneumoniae]  clstr ali  25  9............LLRAALILICANAFAADSTISISGYVRDNACAVAIESKEFTVDLMNNAVKQFSAVGSVTPALPFRIVLSPCGSSA-TAVKVGFTGTPDSNNDKLLKIDSDAFAASGMAVQILDNQQTMLPINAAASAWTNLTPGTNILGFYARLMATRVPVTAGHVYATATFTLE.. 175
494 6.000e-41gi|500210921|ref|WP_011881114.1| fimbrial protein [Burkholderia vietnamiensis]  clstr ali  27  19........................AAATPGTIRFQGEIVAGACGISQETLDQTVSLGQVPSHVFKKVGDRSEAKNFNIVLTDCDTSTQTNAFFTFTGASDATNADLIA---TTGSASNVGIRLQAGANDYLKNGTEQSSPVVLSKSGNTVTFGAMYEATAAAVTPGIANAVANFTVRY. 169
495 6.000e-41gi|487657696|ref|WP_001750023.1| fimbrial protein StdA [Salmonella enterica]  clstr ali  24  1MRTKSLLTIALAAAGMMYGTSVYAVDPGSGKITFTGTITNSPCNIAPGDDAITVPFGQISYRKLNAADATTKSEPFTIHLQNCSAGKMSKVTVSFSGTGDTTHHAYV----STGSAQHVGVQLLKSDNTIIEPNTPMADAQQLQAGNNELNFFARLIALTDAATPGDVNASVTYTLKYL 194
496 6.000e-41gi|491329003|ref|WP_005186964.1| fimbrial subunit type 1 [Yersinia intermedia]  clstr ali  27  1MKSKLIALSIMIVSGSTLSV----ANAADGTINFTGNIIDPACTVNPASASQTIALGTVSSNALATSGATAAPTAFSIALTDC--AVAGNVSVKFDGTHNTSNPDLLAITSGAGVATNVGIALYEQDGTQIPLNTASAAKPIVGTGTATLNYIAKYMATGQS-TAGIADGVTQFSVIY. 175
497 6.000e-41gi|639138615|ref|WP_024484069.1| exotoxin [Serratia fonticola]  clstr ali  24  1MKRNRRAVTMSVAVPLFVALTTAPAEAAGNNVHLYGALVAEPCVIRPGDEEIALDFGSVIDKDLYLN-TRTVGQAFEIHLEECDLTVGKTVNVTFTGTENGTLPGLLAIKGGSQ-ATGIAIGFETPSAKPLQLNQAGSK-LLLQEGHNIIALKAYVQGEPDAIERGAFSAAATFSLEY. 186
498 7.000e-41gi|492246394|ref|WP_005788203.1| exotoxin [Pseudomonas synxantha]  clstr ali  22  1MGYKRIHPVWACAALVLSLGLIAEGNAAD-NLSFRGNLVEEACTIRPGDEAITLELWDLTSKYLYLN-TRSLGKVFKLHLEDCDTTVGNTVTITFGGRENPELPGLLALDGGSG-ASGIAVGLETPANNPLPLNTVSDRQV-LSDGNNVIELKAYVQGEPRAIQEGAYTVTSTFTLDY. 179
499 7.000e-41gi|491323825|ref|WP_005181791.1| exotoxin [Yersinia intermedia]  clstr ali  25  8MRRWRYILAILILNITWV-LPTWAVD----NMRFHGALVAEPCTIRPGDETITLGFGTVVDKYLYSN-QRTLGKQFQIHLVDCDITLGTTAKIMFTGNDSVNLPGLLAVNGSSNNM-GVAIGLETPTGKPLPLNQ-SSDEILLSAGGNVITLKAYVQGEPDTIQRGEFNAVATFSLEY. 182
500 7.000e-41gi|48256973|gb|AAT41671.1| putative major fimbrial subunit protein [Edwardsiella ictaluri]  clstr ali  22  3MKKFLLPVMV-----LXXXXXXXXXXXXNGKVEFTGEIVNSTCQVSSDSQNINVYLGKYPTSAFKTVGDKSASKAFQINLEQCEPGTY---TVRFDGNTVAGHPDLLAVSGATAAAKGVGIEITDVNGKAFPIADQSPTVTVVSDKKAIFNLQARYRSYVNTVTAGLANATSPFTIEY. 178
501 7.000e-41gi|501411005|ref|WP_012442571.1| type-1 fimbrial protein, FimA [Erwinia tasmaniensis]  clstr ali  24  22.KIRFINSLIAASLLTAGMAHAATTTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVKTATLSEAGKTSSAVGFNIQLNDCDTSVATKAAIAFSGTAGGDNTTALALESSSGGATNVGVQVLDSAGKALAFGATFSTAATLSDGTNTLPFQARYIATG................... 183
502 8.000e-41gi|493713911|ref|WP_006663493.1| fimbrial protein BcfA [Providencia alcalifaciens]  clstr ali  24  1MNINKKIAMLSVVISSIICSAAFAENVNGGNITFNGEVTSGPCAVSSADTDKIVTLDTVKSTVFTAADQLAASKPFNINLLECDTDVRKSVQVTFNGQTVEGKPGLLANTAGVGSAKNVALQLFNPDGSALDIGALSSKVNLAE--TTTIPLSVDYKSTAAAVTAGKVQSVANFTLTY. 184
503 8.000e-41gi|578220860|gb|EUL81037.1| hypothetical protein P830_03272 [Enterobacter aerogenes UCI 27]  clstr ali  25  1MMKKPLNLFGAILTLVC-----ANAFAADSTITISGYVRDNACAVATESKEFTVDLMDNAAKQFNAVGATTPLVPFRIVLSPCGSSV-TAVKVGFNGTPDSDNNDLLKIDGGASAAAGMAVQILNGQQTMLPVNAPSSAWTTLTPGTNTLGFYARLMATRVPVTAGHVYATATFTLE.. 174
504 9.000e-41JGI.Meta JGI_HUM.1433313 7053837775 SRS017521_Baylor_scaffold_5851__gene_9025 predicted fimbrial-like adhesin protein [Human Stool microbiome from visit num  ali  32  1.MLKRIIWILCLLGLTGSSEL----FAHDGTVNISGSFRRNTCVLAQDSKQINVQLGDVSLTRF-SHGNYGPEKSFIINLQDCGTDVS-TVDVTFSGTPDGVQSEMLSIESGMDAASGLAIAILDDAKILIPLNQASKDYS-LHSGKVPLTFYAQLRPVNSDVQSGKVNASATFVLHY. 170
505 9.000e-41gi|577068246|gb|EUD04927.1| putative fimbria A protein [Providencia alcalifaciens RIMD 1656011]  clstr ali  25  1....MKRIILTTLISGAIGTPAFATDAGKGIVTFTGSIIEAPCSIAPGDESQTIDLGQVSNVTLQE-GKMSSAQPFEIHLQGCTLNATYTVEVKFEGTEWLENGTNTGLIQITGEASGAGVALMNKSGTKININSSTTERAY-ASGDNTLSFQAALQGSGATVVPGSFRATTNFTLAY. 185
506 1.000e-40gi|446843233|ref|WP_000920489.1| F7-2 fimbrial protein [Escherichia coli]  clstr ali  20  1....MLKSTLGIAIAFSLCAVAHAANQGQSVVNFKGTVIDAPCGIDPDSADQTIDFGQISKSHLKNDG-ISVKKDLDIKLVNCDPTAKKTVSVTFSGTPVNGHTDELGTAGDTGTA----VVVSASDGSMVKFGTTSSNATQLQDGDNTLKYTTWVKAAGTEVKEGDFTAVANFNLSY. 176
507 1.000e-40gi|506490097|ref|WP_015965475.1| P pilus assembly protein, pilin FimA [Enterobacteriaceae bacterium strain FGI 57]  clstr ali  29  4......IVFLLATLMLSLPALAHRVIIEGGKVQMRGELVNSACAVATESQNMRIEMGQYRTNAFTGPGSATTQVPFTLRLVDCRKDVSQTVGIAFQGLTPTEDPLVFMTTSRVDGNSGVGLALFDNSQRHIIPNAQPVSYFPINDDELIFHFSARYRAISGQVMPGAIQSDVWFTLLY. 179
508 1.000e-40gi|446707427|ref|WP_000784773.1| fimbrial protein [Escherichia sp. TW09308]  clstr ali  24  1MKMVKTIMAGAVAMALVSFG--ANANQGQGQVNFKGTVIDAPCGIAPESADQTIDFGQISKSHLADGG-TSQHKNVDIKLVNCDLASQKKVTITFSGSSVASDKEELGTSGGTGTA----IKMSTAAGDFVKFGSTPAGVYNLKDGDNTMRYSAWVQADSATVTEGDFAAVANFNLTY. 177
509 1.000e-40gi|496188591|ref|WP_008913098.1| fimbrial protein BcfA [Providencia burhodogranariea]  clstr ali  26  1MKINNKLAVLSLVASSIICGSAFAADVNGGKITFNGEVTTGACAVSGADTDKLVTLDTVQTSVFKAADQLANAKPFDISLLNCDTDTRKSVQISFSGQTVEGKPGLLANTAGAGSAGNVALQLFNPDGTELEVGALSSKVNLTT--TTTIPLSVDYKSTATNVTAGKVQSVANFMLTY. 184
510 1.000e-40gi|493865780|ref|WP_006812456.1| oxidoreductase [Enterobacter hormaechei]  clstr ali  23  1.....MSVTIRFLPLILLMFITVPVRGYDVLVSVTGNVIGNTCIVSEDSKEQNVPLGTLGIKQFSEAGAVSNKTPFTITLEACGPTFAG-VKIRFSGTPDDENPQLLKV--ADGGATGVAVQILDKDSVLIPLDTQTAAYGAAGDESVKMTFYARLAATGAPVTAGDVSAVATWTTEY. 171
511 1.000e-40gi|490383221|ref|WP_004262732.1| ferrous iron transporter B [Providencia rettgeri]  clstr ali  22  1MKKNVFAYLIAASSVFAI----NNALAADGTIDFTGEITDQACQFATGSDAFTVNLGKISKTALPSTGSTAAATKFTIKLENCPQTV-TSATVKFDATSYAGDNSVLQLTDAATTAQNVGIQIQDVTGTTVPLFTESSAYALKEKTVNNLDFTARYIAMSNSVGVGQANSTATFTINY. 175
512 1.000e-40gi|544754730|ref|WP_021181627.1| putative fimbrial-like protein [Serratia fonticola]  clstr ali  21  1..MGFIRPLILLAGLSALPLSAW-ADLGAVNLTMRATLISNSCSVSTDSINKTVNLGVWATKQFVETPSPASMVRFTINLEDCGPGASG-VKVSWSGTPQAGNNELFALTPGS-TATNVGVELLDWNRNRIAPNATTPAYGLMANSSVSIPFYARYVRAGGVVTAGTANSMATFTLDYL 175
513 1.000e-40gi|516289328|ref|WP_017692635.1| hypothetical protein [Enterobacter cloacae]  clstr ali  23  7............LFICCALLLSGKTLAHDGTVYITGVVKGKTCIVSPGSEQLVVEMHDVAARQLAGQKNETPYEPFTINLEACGAGLS-AVSTHFEGTPDGNNSDLLALTGGPDYATGV