current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: VFG000865(gi:387604907) (aap/aspU) Dispersin [Dispersin (VF0215)] [Escherichia coli O44:H18 042], from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst MKKIKFVIFSGILGISLNAFAGGSGWNADNVDPSQCIKQSGVQYTYNSGVSVCMQGLNEGKVRGVSVSGVFYYNDGTTSNFKGVVTPSTPVNTNQDINKTNKVGVQKYRALTEWVKLast
1 -76.900 VFG000865(gi:387604907) (aap/aspU) Dispersin [Dispersin (VF0215)] [Escherichia coli O44:H18 042]  ali  100  1MKKIKFVIFSGILGISLNAFAGGSGWNADNVDPSQCIKQSGVQYTYNSGVSVCMQGLNEGKVRGVSVSGVFYYNDGTTSNFKGVVTPSTPVNTNQDINKTNKVGVQKYRALTEWVK 116
2 -8.350 VFG000435(gi:17233483) (pefA) plasmid-encoded fimbriae major subunit PefA [Pef (VF0104)] [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  18  1MKKSIIASIIALGVLGGTAHAANEVTFLGSVSATTCDLTTSV-----NGAAQPNQVVQLGTVQANQPGN............................................... 64
3 -6.970 VFG000103(gi:15640861) (acfA) accessory colonization factor AcfA [ACF (VF0127)] [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  1MQKTLSAIFLFTTLSANAAPYIGLELGIGTANHSFETNYQSDAVSLNPNMEDMFLGGLIGYKFNDNFSFEINYSSYKLEDQYSKFIGIESLNNQQ..................... 95
4 -6.930 VFG001928(gi:15792870) (pflA) paralysed flagellum protein [Flagella (VF0114)] [Campylobacter jejuni subsp. jejuni NCTC 11168]  ali follow..  1MRILFLILLSFLNAFAFELVLNTGRENNQAFAEFTCQKFITEAKVH-----ECD--IVGMVDNKLKDQSFSAFD--EAQKIKMIILPKIQFDTSQNIYIDKELSSSSSHKSKAFT. 123
5 -6.740 VFG042559(gi:17865163) (faeC) FaeC [K88 pili/F4 fimbriae (AI040)] [Escherichia coli]  ali follow..  18  1MKKAFLLACVFFLTGGGVSHAAQKTIFSADVVASVCHVVVD------ADSTGNSGRLTFGTYR..................................................... 58
6 -6.540 VFG002156(gi:1644265) (ystB) Yersinia heat-stable enterotoxin Type B [Yst (VF0135)] [Yersinia enterocolitica str. 84-50]  ali follow..  10  1MKKI--ILALVLMLFSFCTLGDDTLSAPIAAEINRKACDTQTPSPSEENDDWCCEVCCNPACAG.................................................... 70
7 -6.260 VFG012341(gi:91210143) (sfaS) S fimbriae minor subunit SfaS [S fimbriae (VF0222)] [Escherichia coli UTI89]  ali follow..  12  51...........LYVSDFPNAGSGSPWVNFDLSLTGCQNMNTVRATFSGTADGQTYYANTGNAGGIKIDGSNASYHNGMFKTLNVQNNNATFNLKARAVSKGQVTPGNISSVITV.. 158
8 -6.100 VFG042535(gi:1232058) (f17d-A) F17 fimbrial major subunit protein [F17 pili (AI037)] [Escherichia coli str. 111KH86]  ali follow..  18  1MRKIQFILGILAAASSSATLADGTITFNGKVVDQTCVTTESKNLTVTLPTVSSNSLTSNGEVAGISLEGCTSPASAGAENVKAYFEPNATTDYDS..................... 102
9 -6.000 VFG002155(gi:487395) (ystA) enterotoxin [Yst (VF0135)] [Yersinia enterocolitica W1024]  ali follow..  17  1MKKI--VFVLVLMLSSFGAFGSDALSTPITAEVYKQACDPPLPPAEVSSDWDCCDVCCNPACAG.................................................... 70
10 -5.850 VFG000914(gi:26247118) (focG) F1C minor fimbrial subunit protein G presursor [F1C fimbriae (VF0224)] [Escherichia coli CFT073]  ali follow..  17  55...........AYTSDLIAANSTSQWKNFSLTLTNCQNVNNVTATFGGTAENTNYYRNTGDATNIMVE................................................ 111

FFAS is supported by the NIH grant R01-GM087218-01
1 2 0 2 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;