current user: public




Query: VFG000105(gi:15640858) (acfC) accessory colonization factor AcfC [ACF (VF0127)] [Vibrio cholerae O1 biovar El Tor str. N16961], from VFDB

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MYFMKSKNRFLLISLLSFSTSVFADVNLYGPGGPHVPLIKVAESFEKSQSKRVNITFGPQATWNDKAKKNADILFGASEHSALAIAEGHSERFSKFNIHPVFMREAIILVKKGNPKNIKGMADLLKPGIGIVVNDGAGVSNTSGTAVWEDSVGRMKNVEKLQAFRSNIHVFAPNSGSARKAFVDGEDIDAWITWVDWAIANPTIGDMVRMEDEYRIYRDFNVVLAKNPSSEAIDFFDYLTKSKDAEAIFQHYGWFKLast
1 -40.800PF01547.23; CYSP_ECOLI/33-278; Bacterial extracellular solute-binding protein  ali follow..  16  13......................................PPFEQQWAKDNGLTIKQSHAGSSKQALAILQGADVVTYNQVTDVQILHDDWQSRLPNNSS--PFYSTMGFLVRKGNPKNIHDWNDLVRSDVKLIFPNPSGNARYTYLAAWGAADKADGGDKFMTQFLKNVEVFDTGGRGATTTFAERGLGDVLISFESEVNNIAQGFEVVIPKTNILAEFPVAWVQANGTEKAAKAYLNWLY-SPQAQT......... 246
2 -32.200PF13531.4; A9BZ83_DELAS/51-277; Bacterial extracellular solute-binding protein  ali follow..  13  1.........................IRVVTSGGFSAAYDQLIPLYEQATGHKVVTSRGASDSIPSRLARGEDIVILADGALDNLAAQG---KVEAGSRVDLARSMIGMSVRKGTPKDISTVDALKQ-----TLLDAKTIAYSASASGTYLANELFPRLGVAEQMKGKATRILSE----VGAVVLRGDADIGFQQVSELLPFKELEFVGPLPDEVQVFFSAGVATGAKSPETARHLIRFL-AAPAAAPIVRSTGM.. 227
3 -16.300PF13343.4; B3E2B9_GEOLS/96-336; Bacterial extracellular solute-binding protein  ali follow..  10  25....................................................................IQTNRFVSVNDYAGDRHLSALGVCDPTGHYTMLAMNLLVPVVDHRRLGGRRCWADLLKREYELAIRGHKDGTFCETLLL---AIYKDTGVEGLRTMGRNVRYGWHPSQMVKAALGSSADAPAISVMPLFFAQTLVGKEQYSIPDDGALISPVTMLVKTEKRAELDDLLAFWA-GPQVASIFSGAFF.. 213
4 -13.500PF12727.5; A0LFW2_SYNFM/425-616; PBP superfamily domain  ali follow..  13  6.............................................RRDGRMQLSSGNVGSLGGLMAVRRASHLLDPATGGYNHSYVERYLQGVPIRLVT-LAVRQQGLLVRRGNPAGVRGVRDLARPDVAFINRQGGSGT--------RILFDYCLRKEELAPEEIRGYDQEEFTHMAIAVTVLSGRADAGMAIFAAARALG--LDFIPVAEER----DLVIPESFWEDPKMGLLMEII................. 191
5 -12.700PF14503.4; F4GIV3_SPHCD/83-314; YhfZ C-terminal domain  ali follow..  10  30......................................TGISTSMNKG-KMRTSLVFGADNRLEGILEQRYDFAVVSRLAAEHYVEKQYPIVIAHNFGPHTYVDQHALVTCRNG--VNLKAQDF--SNCRIGVDEASTDQRILSHRFFR---------------DTQVTYVPIVYNQVIPA-LKGNDIDATI-WNADALDARKNGIFSFPLEQISQDDTEAAIIHLAGKPFISRILAELLNPDEVLEYQKK..... 222
6 -12.500PF00497.18; A6X2Q5_OCHA4/44-271; Bacterial extracellular solute-binding proteins, family 3  ali follow..  13  26.......................................ELMEGVAKQLGLAAEFKDTRFTSLITGARAN-DVIASALYVT--------PERQKILNFIPYIKAGSSLLVLKDAKFRPANEKELCGKIIGSMQG-----------ASWLPKLKALSEDYCAKNNLGAIETREFDTDAQVTQALRSGSVDVEFM-VAAELLKKFPDDYAVTSSALIYPIMVGVATTPQNKELFNAMFAQMRKDGSYDALVKTYG... 226
7 -12.400PF02030.13; Y045_MYCGE/1-482; Hypothetical lipoprotein (MG045 family)  ali follow..  11  1...MKKQLKYCFFSLFVSSSCGSTTFVLANFESYISP--LLLERVQEKHPLTFLT-YPSNEKLINGFANNTSVAVASTYAVSELIERDLLSPIDWSQFNPYFLQNLVFVYRSELEQENVSWTDVIKA--RLVFIDDARTIFSLANIVNGYFTNVYESFQRLGLTKSNLSIFVNSDSNIVINELASGRRQGGIVYNGDAVYAALGGDIVQPKISPVALDLLVINKQQSNFQKEAHEIIFDLALDGADQTKEQLIK.. 345
8 -10.600PF13416.4; R5SZY1_9CLOT/78-401; Bacterial extracellular solute-binding protein  ali follow..  10  1.......................................ELAEKYTAETGVPMKVQTAAAGTYEQTLKEPPTLFQINGPIGYKSWAKYCRDLKDTDIYSHLVDKSMAVTDG-GIPYVVEGYGIIYNDAIKYFALDGAKAASMDDIKNFDTLKAVAEDMQLNNSCTDPKMVGAKTVEDSMAEFALGKVA-SQVAGVEGNTVKEEDVKFLPIYTGVAGEEKQGLCIKEEDQQASLDFLTWLFSSDTGKDVTNKLGFI. 312
9 -10.200PF12849.5; B6YQR6_AZOPC/32-299; PBP superfamily domain  ali follow..  11  5..................GDTLSGKVRISGSFALYPMMVKWAETFKILHDVSFDISGGGAGKGMTDVLNEVDVGMVSREIYSQEVENGAFC-------ILVAKDAVVPIVNVANPEKIKTWGAVSKTCVHVFTRSDACGAAETWASW-LKATSIFGDPGIADAIQKD--RKTKKLNEGLAIIPLDVNGNGKIDPEESFYETMESLITAINDGRYPSPPARYLYLVTKGKPALISFLKYILSE.............. 268
10 -8.840PF03180.12; M9X5A7_MANHA/27-263; NLPA lipoprotein  ali follow..  15  1.........................LKVGVISGPEHKVMEVAAIAKEKYNRDVELVVFTDYATPNAALDKGDLDLNAFQH------KPYLDNQIQEKGYKLVPVGNTFVYPIA-SKKIKSLAEL-KDGDTIAVPNDPTNLARALILLEKQDLIKLRADAGLKATSVDIIENPRKLVEAPLLPRTLDDVAFSIINTTYAGQNTPTKDGIFVEDKDSPYVNLIVARENNQHSEAVKDLVKAYQTEEVYNKANE..... 227

FFAS is supported by the NIH grant R01-GM087218-01
8 5 9 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.