current user: public

Query: VFG0777 (gi:11527914) orf6.2 - unknown [Escherichia coli E2348/69], from VFDB

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50
1 -11.300PF13610.1; B5WJN4_9BURK/77-216; DDE domain  ali follow..  17  6VDETYLGRWVYLYRAVDRAGQTVDFMLRAKGDVKAAKGFFRKALKH..... 54
2 -8.290PF00665.21; O89811_FLV/1485-1601; Integrase core domain  ali follow..  12  11VDFTGMYGYKYLLVFIDTFSGWAEAYPAKHETAKVVAKKLEEIFPRYGIP. 65
3 -5.980PF03400.8; INBD_SHIDY/1-131; IS1 transposase  ali follow..  13  7MDVGAKSRQRWLFYAYDRLRKTVVAHVFGERTMATLGRLMSLL........ 54
4 -5.370PF02914.10; TRA_HAEIN/267-485; Bacteriophage Mu transposase  ali follow..  16  30........RPKTWLWQDVRTRKVLARTDKSENTDTIRLSLLDVISRYGLP. 72
5 -4.660PF08164.7; A3GIA8_PICST/412-493; Apoptosis-antagonizing transcription factor, C-terminal  ali follow..  39IDTKASKGRKLKFQVQEQIANFETPRESWRWDDNQIDEFFASLL....... 82
6 -4.400PF06021.6; GLYAT_BOVIN/1-205; Aralkyl acyl-CoA:amino acid N-acyltransferase  ali follow..  28  167..........FKLSSVDPSHAAVVNRFWLFGGNERSLRFIERCIQSFP... 204
7 -4.330PF05184.10; Q9FRW6_NEPAL/376-414; Saposin-like type B, region 1  ali follow..  17  5.............TACEMAVVWIQNQLRREVTKEKVLNYINELCDSLP... 39
8 -3.910PF09344.5; Q8Z464_SALTI/7-353; CT1975-like protein  ali follow..  214.EQGFASALFYTYVCISRDLLVENLGGNEELAKRTIAALTETALTVSP... 260
9 -3.850PF06072.6; US9_EHV1V/160-218; Alphaherpesvirus tegument protein US9  ali follow..  31  3...........................YSESDNETASMFIRRV........ 18
10 -3.850PF01610.12; Q0W142_UNCMA/157-393; Transposase  ali follow..  17  3VDIAYEKGHKYLTVVRDVEKG-CVLWTGIGRKEVTLDLFFAILGYEKSMNV 53

FFAS is supported by the NIH grant R01-GM087218-01
5 7 1 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.