current user: public




Query: VFG000865(gi:387604907) (aap/aspU) Dispersin [Dispersin (VF0215)] [Escherichia coli O44:H18 042], from VFDB

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst MKKIKFVIFSGILGISLNAFAGGSGWNADNVDPSQCIKQSGVQYTYNSGVSVCMQGLNEGKVRGVSVSGVFYYNDGTTSNFKGVVTPSTPVNTNQDINKTNKVGVQKYRALTEWVKLast
1 -8.600PF12389.6; Q8ENF4_OCEIH/2-208; Camelysin metallo-endopeptidase  ali follow..  13  2LKK-KLGMGVATAVLGLGLIGGGT-------------------FAYFSDTAQATGEFTAGELS-------LSAEPSVVIDVNN-LKPGDTMIRSFELLNDGT.............. 75
2 -8.360PF06607.9; A0A024R0B1_HUMAN/1-97; Prokineticin  ali follow..  19  1MRGTRVSIMLLLVTVSDCAVITGACERDVQCGAGTCCAIS----LWLRGLRMCTPLGREG........................................................ 57
3 -7.530PF13786.4; C6D8F1_PAESJ/41-129; Domain of unknown function (DUF4179 topsan)  ali follow..  14  1.RNNKALMWSISAAAALLIIVST------YQYPAFAYIGGKLLNRMELTSLSFSEVAEQGYGQTVNKS--KTFKDGTVITINGVIADDNAFLM....................... 84
4 -6.730PF16649.3; F7HQI5_MACMU/28-184; Interleukin 23 subunit alpha  ali follow..  42............................PHIQCGDC-----DPQGLRDNSQFCLQRIRQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLQPEGHHWETQQIPSPSPSQPWQR 131
5 -6.600PF07127.9; A7KH99_MEDTR/1-52; Late nodulin protein  ali follow..  16  1MAKFSMFVYALINFLSLFLVE-------TAITNIRCVSDDDCPKVIKPLVMKCIGNY........................................................... 50
6 -6.500PF01481.14; O55480_PRRSV/7-122; Arterivirus nucleocapsid protein  ali follow..  13  65...............................................TERSLCLQSIQTAFNQG---AGTASLSSSGKVGFQVEFMLPVAHTVR...................... 108
7 -6.470PF05411.10; Q9DLN8_PRRSV/255-382; Equine arteritis virus putative proteinase  ali follow..  14  8...........................ADTVPEGNCWWSLFDLLPLEVQNKEIRHANQFGYQTKHGVSGKYLQRRLQVNGLRAVTDLNGPIVVQ...................... 74
8 -6.340PF07327.9; Q966Y0_SCHGR/1-102; Neuroparsin  ali follow..  12  1MKPAAALAAATLLIAVILFHRAEANPISRSCEGANCV----------VDLTRCEY----GEVTDFFGRKVCAKGPSEHCNDFIKCGDGLRCNCGR..................... 81
9 -6.150PF11837.6; J3LZX5_ORYBR/14-120; Domain of unknown function (DUF3357 topsan)  ali follow..  14  26ITAVLPAVASAVVLLGLAALFLVYGFRDEG---------RADVVAPGAVEVVVASSSSRGVVEGVSEKSNLRLGGGKVRDYD.................................. 101
10 -6.120PF16408.3; R6U353_9BACE/1-123; Domain of unknown function (DUF5016 topsan)  ali follow..  1MNKILKTMALLAVPATVAVSCKDDGMDVKFTDKGPEMTIESCATEAFMGDSVRFSIKLNDEFPLSTLKAKLLFDGTSVSDLTIRTKTYGTYDAAIFVPLLKDIPDGTAEIT..... 111

FFAS is supported by the NIH grant R01-GM087218-01
8 5 6 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.