current user: public

Query: TM0015 TM0015 281896 PDB-2007-09-14, from T.maritima

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
143 4.000e-77gi|15679732|ref|NP_276850.1| pyruvate ferredoxin oxidoreductase subunit gamma/delta [Methanothermobacter thermautotrophicus str. Delta H]  clstr ali  46  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYSQAFPFFGVERRGAPVMAFTRIDDSPVRRRYQVYNPDYVVVLDEGLVDVDVFSGLKDDGVVVLNKS------GDFQGGDVKVHTIDATGIALETLGRPIVNTVMLGAFAGVTGLVSIDSLIKIIKETFPGKIG----EKNAEAARMAYEEIEK.. 175
287 6.000e-74gi|389577458|ref|ZP_10167486.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Eubacterium cellulosolvens 6] :_  clstr ali  47  1...MDNTLEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAFNRISKDPIRVHSNIYYPDYVVVVDETLLHVHVTDGLKDEGAIIVNTSKTEEEIRPLLKYTGRVVVIDARDISEKALGKNFPNTPMLAAAVAVSGVMPKDDFIANMRESFGHKFKPEVIDGNMKALEDAFKAV.... 189
436 5.000e-71gi|375107815|ref|ZP_09754076.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Burkholderiales bacterium JOSHI_  clstr ali  39  1......MLQIRIHGRGGQGVVTAADMLAIAAFNQGRHAQSFPSFGSERTGAPVVAFCRIDDREIRLREPILSPDVLIVQDPTLLHVDVFQGLKPDGYVLINSRKSLDELGLSERDRSHLLTVPATDIAIAHVGRPLPNAVLLGGFAALAGLISLDAVEHAIRDRFTGK----VAEGNVAAARQAFEHVRQ.. 185
492 6.000e-70gi|51246738|ref|YP_066622.1| pyruvate-flavodoxin oxidoreductase [Desulfotalea psychrophila LSv54]  clstr ali  21  420....DDVYRAMFYGLGSDGTVGANKNIKIIGTETDNYAQGYFVYDSKKSGSITTSHLRFGKNPITAPYLIEKANFIACHNPTFLEYDMVGNLADGGIFLLTTGHSKDEIWNHLPKNAKFFIID