current user: public




Query: TM0015 TM0015 281896 PDB-2007-09-14, from T.maritima

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# E-value Template Links and tools%idFirst MPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIGDEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKICVVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRALRRGYEEVKCSELast
1 1.000e-82gi|2052278|emb|CAA59455.1| gamma subunit of pyruvate ferredoxin oxidoreductase [Thermotoga maritima MSB8]  clstr ali  99  22MPVAKKYFEIRWHGRAGQGAKSVSQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIGDEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKICVVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRALRRGYEEVKCSE 213
2 2.000e-82gi|647308788|ref|WP_025748644.1| pyruvate synthase [Caldicoprobacter oshimai]  clstr ali  50  1...MGRMIEIRWHGRGGQGAKTASLLLAEAAFDTGKYVQGFPEYGPERMGAPITAYNRISDEPITIHSNIYEPDYVIVVDETLVSVDVTAGLKKDGAIVINSAKDPEEFRPLKGFEGKIYTIDARKISVEELGRYFPNVPMLGAIAKITKLMDEDAFIEAMERSFHHKFKPHVIEGNMRALKRAMREVK... 190
3 3.000e-82gi|501542475|ref|WP_012547593.1| pyruvate synthase [Dictyoglomus thermophilum]  clstr ali  56  1...MKDMLEIRWHARAGQGAKTASYLLAETAMEAGKYIQAFPEYGPERTGAPMKAYTRISDKPIRIHSQIYNPDVVVVLDKTLIGKNVLEGLPSDGIIIVNTTQPPEEIREQLGSDRKIYTVDATGIALETIGRPIPNTPMLGALIRVVPIISLDEVLNQFRKKFEGRFKPEVIEGNLQAIKRAYEEVK... 188
4 5.000e-81gi|692239399|gb|KGG80927.1| pyruvate synthase [Caloranaerobacter azorensis H53214]  clstr ali  48  1..MAKQMIEIRWHGRGGQGAKTASLLLAEAAFATGKFIQGFPEYGPERMGAPITAYNRISDSKIRIHSNIYEPDYVVVVDETLLDVDVTAGLKKEGAIVINSEKSPEELRPLKGYEGRVYTIDARKISIETLGKYFPNTPMLGAIVKVANIMEEEDFLKAMEESFAHKFKPEVIEGNMEAIKRALKEVK... 191
5 1.000e-80gi|496185119|ref|WP_008909626.1| pyruvate synthase [Caloramator australicus]  clstr ali  48  1...MGKLVEIRWHGRGGQGAKTASLLLAEVAFNTGKYIQGFPEYGPERMGAPITAYNRISDEPITIHSNIYEPDYVVVVDETLIKVPVTAGLKEGGAVIVNTAKSPEEIKKELNFNGKVYTIDARKISEETLGAYFPNTPMLAAVVKITGVIPVDVFLNDIEASFKHKFKPHVVPKNMEAVKRALEEVKGNE 192
6 2.000e-80gi|503196055|ref|WP_013430716.1| pyruvate synthase [Caldicellulosiruptor kronotskyensis]  clstr ali  50  1...MGKMIEIRWHGRGGQGAKTASLLLAEAAFNTGKYVQGFPEYGPERMGAPITAYNRISDEKITIHSNIYEPDYVVVVDETLISVDVTKGLKKDGAIIVNTSKSPEEVKKMLGNDGKVYTIDARKISMECLGKYFPNIPVLGAVIKVTGIIPEEEAIKDMEGSLKHKFKPDVIEGNLKAFVRGMQEVQ... 190
7 5.000e-80gi|599129199|gb|EYE88056.1| pyruvate synthase [Fervidicella metallireducens AeB]  clstr ali  47  1...MAKLVEIRWHGRGGQGAKTASLLLAEVAFKTGMYIQGFPEYGPERMGAPITAYNRISDEPLRVHSNIYEPDYVVVVDETLIKVPVTAGLKKDGAIIVNTSKTPEEIRKELKYDGRVYTIDARKISEETLGANFPNTPMLAAVVKVSGVISEEVLLNNMEDSFKHKFKPQVVPKNMEALKRSLQEVK... 189
8 6.000e-79gi|306490885|gb|ADM95003.1| hypothetical protein [uncultured candidate division JS1 bacterium]  clstr ali  53  1...MKKIIEVRWHGRGGQGAVTASKLLATSALAEDKYIQAFPEYGPERMGAPIQSFTRISDEPIKIHCHVTNPDMVVVLDPTLITVDITEGLSEDGIIVVNTSESPAQIRKKLNLKGKIFTVDASKIALEELGRSLPNTPMIGALIRATGLLKLENVINDIKDKFSGKFSQKIVDGNVNAIKRAYQEVK... 188
9 1.000e-78gi|499179806|ref|WP_010877346.1| pyruvate ferredoxin oxidoreductase subunit gamma/delta [Methanothermobacter thermautotrophicus]  clstr ali  47  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYSQAFPFFGVERRGAPVMAFTRIDDSPVRRRYQVYNPDYVVVLDEGLVDVDVFSGLKDDGVVVLNKSGDFQ------GGDVKVHTIDATGIALETLGRPIVNTVMLGAFAGVTGLVSIDSLIKIIKETFPGKIG----EKNAEAARMAYEEIEK.. 175
10 3.000e-78gi|503547538|ref|WP_013781614.1| pyruvate synthase [Mahella australiensis]  clstr ali  53  1...MGKMIEIRWHGRGGQGAKTASLLLAEALFNTGKYIQGFPEYGPERSGAPLTAYNRISDEPIRVHSNIYEPDYVVVVDETLLSVDVTAGLKETGGIVVNTPKSPEEIRHLKDYKGKVGTVDAKKISEEELGRYFPNVPMLGAIMAMTGLVEKEQFIKSMEESFHHKFKPEVIDGNVRALKRAMEEVR... 190
11 4.000e-78gi|652832935|ref|WP_027116761.1| pyruvate synthase [Lachnospiraceae bacterium P6B14]  clstr ali  48  1..MNDDMIEIRWHGRGGQGAKTASQLLADAAFSAGQYVQSFPEYGPERSGAPITAYNRISKERCNIHSNIYDPDYVVVVDETLLEVDVTAGLSPDGAIIVNTEKDPAEIRPLKGYTGRVCTIDARKISIDCLGKYFPNTPMLAAVVAVSGCVEKDSFLKDMEASYSHKFKPQVIEGNLKCLRRSMKEVKE.. 192
12 5.000e-78gi|503588911|ref|WP_013822987.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfotomaculum kuznetsovii]  clstr ali  28  1......MYEILIAGFGGQGVLSTGQLLAYAGMLEGKHVSWIPSYGPEMRGGTANCGVTISDSPISSP-VVTEPTSLIVMNRPSLEK-FEGSVVPGGLILINSSLVDI---KATRKDVRVYYIPANELAEELGNARVAGNVILGALLELTGVVSLDAVEKSLREVLPA-HRHKLIPLNRQALETGAALVR... 178
13 6.000e-78gi|493348553|ref|WP_006305281.1| 2-oxoglutarate oxidoreductase, gamma subunit [Clostridiaceae bacterium L21-TH-D2]  clstr ali  27  1......MQEIIMAGFGGQGVMSMGQLLTYAGMIENKNVSWLPSYGPEMRGGTANCNVMVSDTPVGSP-IVTEATAAIVMNRPSLDK-FEKDVVKDGNLLINSSLID---KKAERDDINVYYIPANEIAVELGNAKVANMVMLGAYLELTKVVKSESVLEALKKVFGE-SKKHLIPLNEKALQRGAEEVRK.. 179
14 2.000e-77gi|517171709|ref|WP_018360527.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas macacae]  clstr ali  30  2......TYEIVIAGFGGQGVLSMGKILAYSGLMEGKNVSWMPSYGPEQRGGTSNVTVIVSDEPVSSP-VVNEYDVVIVLNQPSLDK-FESKVKPGGLLLFDSN---GIHRLPKRKDIKVCQVDATEEALHMGNQKVFNMLVLGGMLKEAPVVKIEGIEKGLMKSLPERH-HKLIPMNIEAIQRGMEIVKE.. 179
15 2.000e-77JGI.Meta 7006258450 C3059854__gene_175854 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Tongue  ali  51  31...MKDIVEIRWHGRGGQGAKTASLLLADAAFNTGKYVQGFPEYGPERMGAPITAYNRISGERSTVHSNIYEPDFVVVVDETLLTVDVTAGLKEDGAIVINSSKDPQELRALKGYKGKVCTIDARKISEEELGKNFPNTPMLAAIVKVSGVVPQEEFIKDMQASFEHKFKPAVIEGNMKALKRSMEEVK... 220
16 2.000e-77JGI.Meta 7030175727 C7119965__gene_310485 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Supragi  ali  28  17.......TEIIIAGFGGQGVLSMGKILAYSGLLENKEVTWMPAYGPEQRGGTANVTVIVSDERISSPILSKY-DVAIVLNQPSLDK-FMPKLKPGGILIYD---GFGIVNPPQRDDIRIYRVDAMDKAAEMKNAKVFNMIVLGALLKVCPIVSTDGLQKALYKTLPERH-HGLIPLNMQAVEEGMKLVNE.. 193
17 3.000e-77gi|547295872|ref|WP_022028456.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:1219]  clstr ali  47  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDTPIRIHSNIYEPDYVVVVDDTLLHVDVTKGLKSDGAILINTQKSPDEIKKLSDYKGHIYTIDATKISEDCLKANFPNTAMLSAIVKITSIMTKEDLIKNMEESFKHKFKPEVIAPNIEVIKRAYDEI.... 186
18 4.000e-77gi|547943077|ref|WP_022344309.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:356]  clstr ali  43  1...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDKPITIHSNIYEPDYVVVVDDTLLTVPVTAGLKKEGAIVINTTKKPEELKELKGYDGSVYTIDARKVSEEALGRYFPNTPMLAAIVKVAGVMTDEELLEDMKTSFKHKFKPEVIDGNMKALEFALKEVTKIQ 193
19 4.000e-77gi|653188041|ref|WP_027424363.1| pyruvate synthase [Lachnospiraceae bacterium AC3007]  clstr ali  45  1......MIEIRWHGRGGQGAKTASQLLADAAFMSGKYVQSFPEYGPERSGAPITAYNRISDERCLIHSNIYEPDFVVVVDETLIEVDVTSGLKEEGAVIINSSRSPDELRSLKGYRGRVCAIDARKISMDCLGSYFPNTPMLAAVVAVSGCVDREQFLSDMETSYRHKFKPQVIEGNLKCLKAAMEEVR... 187
20 6.000e-77 GL0136813 [Complete] locus=scaffold56170_2:845:1423:+  ali  47  1...MENLIEIRWHGRGGQGTKTASLLLADAAFNTGKYIQGFPEYGQERRGAPITAYNRISDDPITVHSNIYEPDYVVVVDDTLLEVDVTAGLKTNGAIVINTTKSEDYLKSVKGYKGKVYTIDARKVSTQALGRYFPNTPMLAAIVKVTGIMNDEDFLKDMEGSFKHKFKPEVIDGNMKALEMALKEVKE.. 191
21 7.000e-77gi|516898213|ref|WP_018154510.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanothermococcus thermolithotrophicus]  clstr ali  44  1......MIEIRFHGRGGQGAVTAAQILAKAAFFDGKFCQAFPFFGVERRGAPVMAFTRIDDRKIRLRSQIYKPDYVVVQDPTLLDVDVTSGLKKGGKLIINT------LKDVKMDDYEVYPIDATGISLEVLGLPIVNTTMLGAFAGATNEVTLESLKKAILETFPGKLGQK----NAEAAEVAYNRIK... 174
22 7.000e-77 GL0054011 [Complete] locus=scaffold56418_1:3183:3764:+  ali  46  1...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSNIYEPDYVVVVDDTLLEVEVTDGLKEDGAIIINTTKNYDYLKNVLGYNGKVYTIDAREISMEALGKYFPNTPMLAAVVKVTGIMTDEEFLNDMQGSFKHKFKPEVIDGNMKALQLALNQV.... 189
23 7.000e-77gi|548146543|ref|WP_022384285.1| 2-oxoglutarate ferredoxin oxidoreductase gamma subunit [Bacteroides sp. CAG:462]  clstr ali  25  2.....KTEEIIISGFGGQGVLSMGKILAYSALMEGKEVTWMPAYGPEQRGGTANVTVIISDERISSPILSTY-DTAIILNQPSMAK-FESKVKPGGTIIYD---GYGISQPPTRKDIKVYRIDAMDAAAEMNNMKAFNMIVLGGLLKLRPMVSIESVLKGLRKTLPERH-HHLIPMNEEAIRKGMEIIREHE 182
24 1.000e-76JGI.Meta 7039710596 C5394291__gene_271595 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Supragi  ali  29  2......TYEIIIAGFGGQGVLSMGKILAYSGLMEEKEVSWMPSYGPEQRGGTSNVTVIVSDEQVSSP-VVNDYDIVVALNQPSLDK-FASRVKPGGVLLYDSNGVHYEN---PRTDIDIYEVDATNEATRMGNSKVFNMLILGALLKTRTILHLDSIKKGLEKSLPERH-HKLIPMNMEALQRGAELLKKH. 180
25 1.000e-76 GL0003926 [Complete] locus=scaffold66995_3:253:834:-  ali  48  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPMTAYNRISVNPIRVHSNVYEPDYVVVVDDTLLSVPVTDGLKEEGAIIINTTKGIDEIKPLLGYNGNVYTIDAKKISEEALGKYFPNTPMLAAIVKVTEIMEDEAFIKDMEGSFKHKFKPEVIDGNMQAIKEALKQVKKVQ 193
26 1.000e-76gi|496289768|ref|WP_009001806.1| pyruvate synthase [Clostridium sp. D5]  clstr ali  43  1...MDNMIEIRWHGRGGQGAKTAAMLLAEAAFDTGKFIQGFPEYGPERMGAPVTAYNRISNERILVHSNIYEPDYVVVVDETLMDTDVTAGLKKEGALLINSPKSPAEIRKCGGYEGRIYTIDADRIAMETLGKNFPNTSMLSAVVKITKVEEEERFLESLQESFRHKHKPQMIEPNMQAAARAFREVKE.. 191
27 2.000e-76gi|647307497|ref|WP_025747581.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Caldicoprobacter oshimai]  clstr ali  29  2......THQIIIAGFGGQGIMLMGQLLAYAGMLEGKNVSWLPSYGPEMRGGTANCNVIISDEPVASP-IVTEATAVMVMNRPSLDR-FEGAVMKGGLLLVNSSLID---KKASRDDIEVCYIPANEIADQLGNSRVANMVVLGSYIAKTGVVSPASVIESLRKALGP-SKEHLIPLNEEALKRGAECVKEC. 180
28 2.000e-76JGI.Meta 7005598743 C2537626__gene_195209 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  47  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISETPIRVHSNIYEPDFVVVVDDSLLDVDVTKGLKPEGAILINTASIDSIRQKLNGFEGKIYTINASKISKECLKANFPNTAMLSAIIKITGIMTKEELLKDMEESFKHKFKPEVIEPNMEAIKRAYDEI.... 186
29 3.000e-76gi|492690206|ref|WP_005923688.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Bacteroides]  clstr ali  26  4........EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEKISSPILSKY-DTAIILNQPSLEK-FESRIKPGGILIYD---GYGIINPPTRKDIKVYRIDAMDAANEMKNAKAFNMIVLGGLLKLRPIVTLENVIKGLKKTLPERH-HHLIPMNEEAIKKGMELIKELK 181
30 3.000e-76 GL0069822 unmapped_[Complete]_[mRNA]_locus=scaffold134630_1:619:1197:-  ali  41  1..MMKDMTEIRWHGRGGQGAKTACLLLADAAFTAGKYVQGFPEYGPERMGAPITAYNRISEERCSIHSNIYEPDYVVVVDETLLEVDVTKGLNPEGAIVINSERSAAELRPMLRYEGRVYTIDARKVSEECLGKYFPNTPMLAAIVEVSRVLEPEQFIADMEASFRHKFKPQVVEGNMQCLKRAMKEVR... 191
31 3.000e-76 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and rela  ali  25  26...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPAYGPEQRGGTANVTVIVSDEKISSPILSKY-DAAIILNQPSLEK-FESKVKTGGILIYD---GYGIINPPTRKDIKVYRIDAMDAANEMNNAKAFNMIVLGGLLKLKPMVTLDSVLRGLKKTLPERH-HHLIPMNEEAIKKGMELIKEV. 205
32 3.000e-76gi|501539343|ref|WP_012544830.1| pyruvate synthase [Coprothermobacter proteolyticus]  clstr ali  56  1...MTVLLEIRWHGRAGQGVKTAAYLLAEAAMDTGKYIQAFPEYGAERSGAPIAAFTRIGDEPIRIHYGIRTPDVVVVVDESLIGMDVTSGLKENGILLVNSNQSPEIYRKLPSFHGKIATVDATQIALDCIGRPIPNIPIMGALIRASGIVSLEDLEPRLRHKFSAKFSEQVVEGNVKALKRGYEEVK... 188
33 3.000e-76 GL0033049 [Complete] locus=scaffold58000_2:258:803:+  ali  25  4........EIIIAGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDDPVSSPILSSY-DIAIVLNQPSLEK-FEPKVKPGGIIIYD---GYGINEPPTRKDIKVYRIDAMDAAAEMNLIKTFNMIVLGGLLKIRPVVKIESVLAALRKTLPERH-HHLIPKNEEAIRKGMEIIKEVQ 181
34 4.000e-76gi|547530666|ref|WP_022107576.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:138]  clstr ali  24  6..........IFAGFGGQGVLLIGQLLAYAGMYEGKNVSWLPSYGPEMRGGTANCSVVVSDEPVASP-VINKCDCVIAMNRPSLDK-FEQNVLPGGKLFINSSIID---KKATRTDIDVYYVPCNEIADKLNNPKVANMAMLGAYLEATKAVQTKSVLDALLYKLGEK-KAALIPLNEEAIEAGAASIRK.. 179
35 4.000e-76gi|546691781|ref|WP_021885309.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:590]  clstr ali  47  1...MKNTVEIRWHGRGGQGAKSAALMLADAAFMTGKHVQGFPEYGPERMGAPITAYNRISEDPIRVHSNIYDPDYVVVVDETLLEVDVTNGLNPEGAIVINTTKSVEEVKPLKGYPGKVYTLDAREISEKCLGRYFPNSPMLAAIVAISKVMTKEDFFREMEGSYKHKFKPEVIEGNLKALHMAYEEVE... 190
36 5.000e-76gi|503151903|ref|WP_013386564.1| pyruvate synthase [Ilyobacter polytropus]  clstr ali  47  1...MSNLVEIRWHGRGGQGAKTASLLLADAAFTIGKFVQGFPEYGPERMGAPITAYNRISGEKIRVHSNIYEPDYVVVVDDTLLSVDVTKGLKKEGAIIINTSIPKEILSKLKKYDGNVFLCDARKISEESLGKNFPNTPMLGAVVKVSGIMSEEEFLGSMEESFKHKFKPEVIKGNMKALKVSMGEVKICE 193
37 6.000e-76gi|504641101|ref|WP_014828203.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfosporosinus acidiphilus]  clstr ali  26  4........EIILAGFGGQGVMSMGQLLAYAGLEENKFVSWIPSYGPEMRGGTANCSVTISDAEVSSP-IITEPNTLIVLNRPSLEK-FEKDVRPGGWVLLNSSLIDIE---PSRQDLKVLKIPADEIANEFNNSRVANMIILGAYIHLTGAVSLESVVGALKKVLPE-YRYHLIPLNRQALELGIELAQNA. 181
38 7.000e-76gi|547941664|ref|WP_022342958.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Roseburia sp. CAG:309]  clstr ali  45  1...MSELTEFRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYDRISDTEIRVHSNIYDPDYVVVVDETLLHVHVTEGLKEDGAILVNTAKTSDEIRPLLGYKGRVYTIDAREVCMKTLGKYFPNTPMLAAIVKISKIMEEENFIKEMEASLSHKFKPEVLEGNMQALRLAMQEVR... 190
39 8.000e-76gi|547923086|ref|WP_022325305.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:798]  clstr ali  44  1...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDAPITIHSNIYEPDYVVVVDDTLLEVDVTAGLKEEGAIVINTTKNYDYLKNVLGYKGKVYTIDARAISMEALGKYFPNTPMLAAIVKVSGIMTDEEFLNDMQGSFKHKFKPEVIEGNMKALQLALNQV.... 189
40 8.000e-76 GL0001325 [Complete] locus=scaffold3459_9:9049:9612:+  ali  25  2LKTEKTMKEIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDDRISSPILSQY-DTAIILNQPSLEK-FENRIKPGGILIYD---GYGIINPPTRKDIKVYRIDAMDAANEMKNAKAFNMIVLGGLLKLRPIVTLENIIKGLKKTLPERH-HHLIPMNEEAIKKGMELIREA. 187
41 8.000e-76JGI.Meta 7029940069 SRS023595_Baylor_scaffold_74716__gene_74827 putative 2-oxoglutarate oxidoreductase gamma subunit [Human Supragingival pl  ali  28  4........ELVIAGFGGQGVLSMGKILAYSGLMEDKNVSWMPSYGPEQRGGTANVTVIISDESVSSPL-VNEYDVVIALNQPSVDK-FTPRVKPGGILIYDTNGVTHI---PERTDIQIYEVPATDEANHMGNAKVFNMLVLGATLSVHPMLPLDSIRKGLEKSLPERH-HKLIPMNMKALERGGEIIRRH. 180
42 8.000e-76gi|490508195|ref|WP_004374226.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella oris]  clstr ali  27  3.......TEIIIAGFGGQGVLSMGKILAYSGMLEGKEVTWMPAYGPEQRGGTANVTVIVSDERISSPILSKY-DVAIVLNQPSLDK-FMPKLKPGGMLIYD---GFGIINPPTRDDITVYRIDAMDKAAEMKNAKVFNMIILGALLKACPIVSTEGLQKALFKTLPERH-HHLIPLNMQAVEEGRKMVK... 178
43 8.000e-76gi|491611263|ref|WP_005468821.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit [Porphyromonas catoniae]  clstr ali  28  4........EIVIAGFGGQGVLSMGKILAYSGLMEDKNVSWMPSYGPEQRGGTANVTVIISDDAVSSPL-VQDYDVVIALNQPSVDK-FTPRVKPGGTLIYDTNGVSHI---PERSDIEIYEVPATDEATNMGNAKVFNMLILGAMLAVRPILPLDSIRKGLEKSLPERH-HKLIPMNMQALERGGQILHPHK 181
44 9.000e-76gi|548299033|ref|WP_022490340.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:567]  clstr ali  45  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRIGNTPIRIHSNIYEPDYVVVVDDSLLEVDVTAGLKPDGAIVINTTKSGNELKPLLGYTGDVYTIDARKISLETLGKYFPNTPMLAAIVKVSGVIEEKDFLADMEGSFKHKFKPEVIDGNMKALEMALKEVNKV. 192
45 1.000e-75gi|671518532|ref|WP_031503951.1| pyruvate synthase [Thermotoga hypogea]  clstr ali  71  1..MPTKYFEIRWHSRAGQGAKSAAQLVAETVLDEGKYAQAFPEYGAERSGAPMRAFNRISEGKIRVHYSVENPDVVVVIDDTLLSPTIVSGLKEDGVLIVNTKHSFDFVRKKTNFNGKVCIVNATDIALQEIKRGVPNTVMIGTLARVTGLVNLEVVEKKIREMFERKLPEEMIQANIRALRRGYEEVQ... 187
46 1.000e-75gi|501072378|ref|WP_012123396.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Ignicoccus hospitalis]  clstr ali  48  9.......VEIRWHGRGGQGAVTASEIVAKAAIAQGKYAQAFPSFGVERRGAPVEAFTRIDEKPIYIRSKIYEPDIIVVLDPSLLGPKLAEGLKEGGMAIVNTEKTPDEVRKLLREDVKVAVVNATKIALETLKRPIVNTAILGAFAKATGLVDLDALLEAVKEKVPPR----TVEANLEAVRRAYEEV.... 186
47 1.000e-75gi|502865756|ref|WP_013100732.1| pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Methanocaldococcus infernus]  clstr ali  48  1......MIEIRFHGRGGQGAVTAAQILAKAAFYDGKYCQAFPFFGVERRGAPVRAFTRIDDKEILIRSQIYEPDYVVVLDPTLLDVNVLEGLKKDGAVIVNTVKDLD-------LGYKVYTLDATKIALDVLGVPIVNTSMVGAFAGATKLVSLESVKKAILETFKGK----LGEKNALAAEKAYNEI.... 172
48 1.000e-75 GL0066660 [Complete] locus=scaffold14074_1:79:696:+  ali  46  13...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDCPITIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTTKDENYLKNLHGYNGNIYTIDARKVSMETLGKYFPNTPMLAAIVKVSHIMSDEELLNDMEGSFKHKFKPEVIDGNMKALKMALNEVKK.. 203
49 1.000e-75gi|503565409|ref|WP_013799485.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanotorris igneus]  clstr ali  44  1......MIEIRFHGRGGQGAVTAAQILAKAAFYDGKYCQAFPFFGVERRGAPVMAFTRIDDKKIRLRCQIYEPDYVVVQDATLLDVDVTSGLKNDGKVIINT------VKDIKLGDYDTYCIDATGIALDVLGVPIVNTTMLGAFAGVTGEVSIESLKKAIMETFPAK----LGEKNAKAAEVAYEMIEKYK 178
50 1.000e-75gi|496343635|ref|WP_009052813.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Thermoanaerobacter]  clstr ali  29  5.........IIFAGFGGQGVLSMGLIITYAGMFEGKNVSWTPSYGPEMRGGTAYCNVTVSDEEVGSP-VITEATSVIVMNRPSLDK-YESYVIPGGKLFINTLLVD---RKAERKDIEVYEIPANDIANELGNLKIANMVMLGAFIEATKVVKLETVLKALPEVFG-KGKEHLIPINEKALNKGAELVK... 178
51 2.000e-75gi|652499216|ref|WP_026893628.1| pyruvate synthase [Clostridiisalibacter paucivorans]  clstr ali  46  1..MSKEIVEIRWHGRGGQGAKTGSLLLAEAAFATGKYIQGFPEYGPERMGAPITAYNRISNEKIRLHSNIYEPDYVVVVDESLIDIDVTAGLKSEGAIVINSKKSPEEFRHLNGYKGKVYCIDAHQISMDTIGRYFPNTPMLGAIAKVINIMDGDTFLDAIEKAFQHKFKPNLIKGNMDAVKLAFEEV.... 190
52 2.000e-75 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2  ali  46  15...MKEIFEIRWHGRGGQGAKTASLLLADAAFSGGMYVQGFPEYGPERMGAPITAYNRISKERVTVHSNIYEPDFVVVVDETLIEVDVTKGLKEDGAIIINSSKPASEFKALKGYKGRVYTCDARTISEETLGKNFPNTPMLGAVVKVSGVMEEKAFLEAMENSFAHKFKPEVLKGNMAALVRSMNEVKE.. 205
53 2.000e-75gi|496182881|ref|WP_008907388.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Caloramator australicus]  clstr ali  30  5........EIIFAGFGGQGILSMGKFLAHAGLEENLNVSWFPSYGPEMRGGTSNCSVIVSDEPIGAPL-VTDATAVVVMNRPSLDK-FERYVVKGGLLIMDSDLVN---REPERTDIEVIKIPAQRIAEEVGSKKIANMVLLGALVEKTKIVSMESLLKALKE----HGKEQFYELNKKALERGAEFAK... 176
54 2.000e-75gi|547242503|ref|WP_021978341.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:793]  clstr ali  47  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTSPIRVHSNIYEPDYVVVVDDTLLKVDVASGLKEDGAIVINTTKIDEIAPLLKGYKGSVYTIDARKVSEEALGKYFPNTPMLAAIVKVAGIMPEADFIKDMQDSFKHKFKPEVIDGNMKALKLALEQVKKIQ 193
55 3.000e-75 GL0050276 [Complete] locus=scaffold925_3:2239:2811:-  ali  25  4........EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERISSP-ILSHYDVAIVLNQPSLDK-FEPKVKPGGILIYD---GFGIINPPTRKDINVYRIDAMDKAAELKNSKVFNMIVLGGLLKVCPIVSTDGLNKALFKTLPERH-HGLIPLNMQAVEEGMKIMTKMQ 181
56 3.000e-75gi|497932453|ref|WP_010246609.1| pyruvate synthase [Acetivibrio cellulolyticus]  clstr ali  46  1...MGKVVEIRWHGRGGQGAKTASLLLADAAFNTGKFIQGFPEYGPERMGAPITAYNRISDEKLTIHSNIYEPDYVVVVDDTLITVDVTAGLKEDGAIIVNTTKSPEELKPLKGYKGKVCTIDARTISIDTLGKYFPNTPMLGAVVKVSRVMNEQEFLKDMVDSFKHKFKPEVVEGNIKALERSMQEVK... 190
57 3.000e-75gi|503608932|ref|WP_013843008.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfotomaculum ruminis]  clstr ali  29  4........EILIAGFGGQGVLSTGQLLAYAGMLEGKQVAWIPSYGPEMRGGTANCGITISDEPISSPL-VTEPTTLIIMNRPSLDK-FENTVVPGGLILVNSSLVE---QKVKRTDVKVMEIPANRIAEELGNGKVANNVILGVLIELTKIVSIEAVVESLKKVLPSRH-HRLIPVNQLALEKGAQLAK... 178
58 3.000e-75gi|490470799|ref|WP_004341300.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella buccae]  clstr ali  25  24.......TEIIIAGFGGQGVLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTANVTVIVSDERISSPILSKY-DVAIVLNQPSLDK-FEPKLKPGGILIYD---GFGVFNPPTREDISVYRINAMDKATEMKNSKVFNMIVLGGLLKVCAVVSTDGLKKALKKSLPERH-HNLIPLNMQAVEEGMSIITK.. 200
59 4.000e-75gi|547892600|ref|WP_022297413.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:465]  clstr ali  48  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDTPIRIHSNIYEPDYVVVVDDSLIGVDVTSGLKDNGAIVINTNEDIDSLRKKLGFSGKIYTIDASKISLECLKANFPNTAMLAAVVNITKIMSKEELVDNMKDAFSHKFKPEVIEPNMEALLKGYDEIK... 187
60 4.000e-75JGI.Meta 7014779701 SRS050422_LANL_scaffold_30517__gene_44381 ketoisovalerate ferredoxin oxidoreductase [Human Stool microbiome from visit n  ali  27  4........EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEKISSPILSKY-DTAIILNQPSLEK-FESRIKPGGILIYD---GYGIINPPTRKDIKVYRIDAMDAANEMKNAKAFNMIVLGGLLKLRPIVTLENVIKGLKKTLPERH-HHLIPMNEEAIKKGMELI.... 177
61 5.000e-75gi|500836055|ref|WP_012003807.1| MULTISPECIES: pyruvate synthase [Thermotoga]  clstr ali  67  1..MPAKYYEIRWHSRAGQGAKSASQLLAEAVLDMGKYAQAFPEYGAERSGAPMRAFNRISDGKITIHSSVEKPNVVVVIDDTLLSPAVVEGITEDGVLIVNTTHPVDYIRKKTHFNGKICTLKATDIALEEIKRGIPNTVILGAVAKITNVVTLESLEQKIKNMFGKKLSEEMLEANLRALRRGYEEV.... 186
62 5.000e-75gi|491505842|ref|WP_005363495.1| pyruvate synthase [Eubacterium ventriosum]  clstr ali  48  20...MKDTLEIRWHGRGGQGAKTAALLLAEVAFKTGKNAQGFPEYGPERMGAPITAYDRISDQPIRVHSNIYDPQYVVVVDETLIEVDVTKGLREDGAILINTARPKEEIPHLKGYKGKVYTVDARKIAMETLGKNFPNTPMLAAIVKVTGVIDDETFLNEMEGSFKHKFKPEVIKGNMDALRIALREVK... 209
63 5.000e-75JGI.Meta 7075615254 C4871385__gene_143149 putative 2-oxoglutarate synthase subunit [Human Stool microbiome from visit number 1 of subject 15  ali  24  4........EIIIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPSYGPEQRGGTANVTVILSDNRISSP--ILNADAAIILNQPSLDK-FESKIKPGGVLIYDS---YGIHHAPTRTDINIYCIDAMDAAVEMNNTKAFNMIILGGLLKIKPMVTLENVLKGLKKSLPERH-HKLIPMNEQAILKGMELIRKV. 180
64 5.000e-75gi|517275715|ref|WP_018464533.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella paludivivens]  clstr ali  25  1...MKK--EIIISGFGGQGVLSMGKILAYSGLLEDKEVTWMPAYGPEQRGGTANVTVIISDERISSPILSKF-DIAIVLNQPSMDK-FLSKVKPGGILIYD---GFGIINPPARKDITVYRIDAMDKAAEMKNAKVFNMIVLGGLLKVCKIVSTDGLNKALYKTLPERH-HKLIPLNMQAVEEGMNLIEEVK 181
65 5.000e-75gi|495688070|ref|WP_008412649.1| Pyruvate/ketoisovalerate oxidoreductase [Desulfotomaculum hydrothermale]  clstr ali  27  4........EILIAGFGGQGVLSTGQLLAYAGMLENKQVAWIPSYGPEMRGGTANCGVTISDEPISSPL-VTEPTTLIVMNRPSLEK-FEPAVVPGGLILINASLVD---RQVKRNDVQVMEIHANQIAEELGNVKVANNVILGALIELTGIVSVESVVESLKKVLPAR-RHNMIPVNRQALEKGAQLAREMK 181
66 5.000e-75gi|653148965|ref|WP_027398137.1| pyruvate synthase [Anaerovorax odorimutans]  clstr ali  49  1.MRKNNIVEIRWHGRGGQGAKTACLLLADVAFQSGKYVQGFPEYGPERMGAPITAYNRISEERCNIHSNIYGPDYVVVVDETLLSVDVTSGLKEDGAVIINSEKEPGELRHLLGYNGKIYTVDARKISEETLGRNFPNTPMLAAMVRVSNIIESEKFLEDMEKSFHHKFKPQVIEGNMKALRKSMEEV.... 191
67 5.000e-75 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-  ali  45  1...MSELTEFRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYDRISDTEIRVHSNIYDPDYVVVVDETLLHVHVTEGLKEDGAILVNTAKTSDEIRPLLGYKGRVYTIDAREVCMKTLGKYFPNTPMLAAIVKISKIMEEEKFIQEMEASLSHKFKPEVLEGNMQALRLAMQEVR... 190
68 5.000e-75 GL0129383 [Lack 5`-end] locus=scaffold223479_1:38:667:-  ali  43  18...MNDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTKPITIHSNIYEPDYVVVVDDTLIEVDVTAGLKKTGAVVINTTKDGEYLKKLKGYEGEIYKIDARKISMETLGKYFPNTPMLAAIVKVSKVMTDEEFLNDMQGSFKHKFKPEVIEGNMKALEMALKEVERV. 209
69 5.000e-75gi|548259839|ref|WP_022477133.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:273]  clstr ali  46  1...MNDMIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNTPIRIHSNIYEPDYVVVVDDTLLGVDVTAGLKPNGAIVINTTKDIDYLRKVKGYSGAIYTIDARKVSMETLGKYFPNTPMLAAIVKVANIMEENDFLKDMEGSFKHKFKPEVIDGNMKALEVALKEVKK.. 191
70 6.000e-75gi|492554014|ref|WP_005884346.1| pyruvate synthase [Fusobacterium mortiferum]  clstr ali  48  1...MREIFEIRWHGRGGQGAKTASLLLADAAFSGGMYVQGFPEYGPERMGAPITAYNRISKNPVRVHSNIYEPDFVVVVDETLIEVDVTKGLKEDGAIIINSSKPSEFVPFLKGYKGKVFTCDARTISEETLGKNFPNTPMLGAVVKVSGVMEEKAFLEAMEESFKHKFKPEVLKGNMDALIRSMNEVKE.. 191
71 6.000e-75 GL0095983 [Complete] locus=scaffold5611_1:8785:9366:+  ali  47  1...MSNLIEIRWHGRGGQGAKTASLLLADAAFNTGKFIQGFPEYGPERMGAPITAYNRISDEPITVHSNIYNPDYVVVVDDTLLEVDVTAGLKETGAIVINTTKDINYLSSVLGYKGKIYTIDARKVSMETLGRYFPNTPMLAAIVKVSNVMPEDAFIQDMEGSFKHKFKPEVIEGNMNALKLALKEIKV.. 191
72 6.000e-75 GL0032157 [Complete] locus=scaffold52916_1:152:694:+  ali  25  4........EIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPSYGPEQRGGTANVTVILSDERISSP--VLNADVAVILNQPSLEK-FESKVKPGGILIYD---GYGIHHPPTRTDINVYCINAMEAAIEMNNTKAFNMIVLGGLLKLRPMVSMENVLKGLKKSLPERH-HHLIPMNEQAILKGMEIIRKV. 180
73 6.000e-75gi|546845206|ref|WP_021897504.1| 2-oxoglutarate oxidoreductase gamma subunit [Prevotella sp. CAG:924]  clstr ali  24  3.......TELIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDQRISSPILSRY-DVAIVLNQPSLDK-FESKVKPGGTLIYD---GYGVLNPPTRKDINVYRIDAMDKAAEMKNSKVFNMIVLGGLLKVYPVVSTEGLQKALYKSLPERY-HHLIPLNMQALEEGMKIISKVE 181
74 7.000e-75gi|493931494|ref|WP_006876067.1| pyruvate synthase [Anaerotruncus colihominis]  clstr ali  48  1...MKDIVEIRWHGRGGQGAKTASLLLADAAFNTGKYVQGFPEYGPERMGAPITAYNRISSERSTVHSNIYEPDYVVVVDETLISVDVTAGLKKEGAIVINSGKSPAQLRPLKGYAGRVFTIDAGRISEEELGKNFPNTPMLAAIVKVSGVVEPDAFVKDMEASFHHKFKPQVIEGNMRALKRSMEEVQ... 190
75 7.000e-75gi|671531333|ref|WP_031515145.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Desulfotomaculum alkaliphilum]  clstr ali  27  4........EVLIAGFGGQGVLSTGQLLAYAGMVEGKHVAWIPSYGPEMRGGTANCGITLSDEPISSPL-VTEPTTLIVMNRPSLDK-FENAVVPGGRILINSSIVKQDV---SRDDVLVMKIPANEIAEEIGNARIANNVILGALIKLTGVVTIDSVVESLKVVLPPR-RHNLIPANQQALERGAQLAEEY. 180
76 7.000e-75JGI.Meta 7052105202 C3508723__gene_217263 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  43  1LHTMKNGIEIRWHGRGGQGAKTAALLLADVAFKTGKNVQGFPEYGPERMGAPITAYNRISSDEIRVHSNIYHPDYVVVVDETLLHVDVTAGLKEQGAIVVNTPKSPQEIAPLNGYKGKVYTVDARKISVETLGKNFPNSPMLAAIVAVSKVMDKDTFIREMKNSYQHKFKPEVIDGNMKALEVAYDAVIAHE 196
77 8.000e-75gi|671613434|ref|WP_031582930.1| pyruvate synthase [Lachnospiraceae bacterium AC2028]  clstr ali  46  1...MEDMIEIRWHGRGGQGAKTASQLLADAAFMSGKYVQSFPEYGPERSGAPITAYNRISDERCPIHSNIYDPDYVAVVDETLLEVDVTAGLSEKGAIIINSSKDPEEFRPLKGYAGRVCTIDARAISIAYLGKYFPNTPMLAAVVEVSGCVDKEQFLKDMESSYRHKFKPQLVEGNLQCLRAAMKEVR... 190
78 8.000e-75gi|516754396|ref|WP_018085110.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfurispora thermophila]  clstr ali  28  1......MFEILIAGFGGQGVLSMGQLLAYAGMTDGRHVAWIPSYGPEMRGGTANCGVTISDKPISSP-VVSEPTVLIAMNRPSLEK-FEKAVVPGGLILVNSSLIDIQVQ---RRDVKAFYIPANELAEEIGNSKVANNTILGALLKLTGAVSIPAVEESLKKVLPAR-RHNLIPVNLQALQVGMDFI.... 177
79 1.000e-74gi|496676860|ref|WP_009319350.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonadaceae]  clstr ali  26  4........EIIIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPSYGPEQRGGTANVTVILSDERISSPVLNTF-DVAIILNQPSLEK-FENKVKPGGILIYD---GYGIHHAPTRKDIDIYRIDAMDTAIEMENSKAFNMIVLGGLLKVKPMVSLENVLKGLKKSLPERH-HKLIPMNEQAILKGMEIIRKV. 180
80 1.000e-74gi|501003491|ref|WP_012056571.1| pyruvate synthase [Thermosipho melanesiensis]  clstr ali  66  1..MPAKYFEIRWHARAGQGAKSASQMLAEAALEMGKYVQSFPEYGAERTGAPMKAFNRVSDEPILIHSSVDYPDVVVIIDDTMLGQPLTDGTDENTVFIVNTVKDVEYVREKLGVKGKICTIAATDIALEELKRGIPNTVMLGAIAKVTGVITLESAEQRIRKAFSKKFPEELVEANVRALRRGFEEVK... 188
81 1.000e-74gi|700221647|gb|KGN71516.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas sp. COT-239_OH1446]  clstr ali  26  2......TYEIVIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPSYGPEQRGGTSNVTVIVSDDAVSSP-VVNDYDIVVALNQPSLDK-FAPRVKPGGVLIYDTN---GIHHVPGRTDIEIYEVDATEEANRMGNQKVFNMLILGALLSARPMLSINSVQKGLMKSLPERH-HKLIPMNMEALAKGAELLKRHE 181
82 1.000e-74 GL0030712 [Complete] locus=scaffold40327_1:6741:7379:+  ali  47  20...MDNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGAERMGAPITAYNRISTAPIRIHCNIYNPDYVVVVDDTLLNVDVTSGLKESGAIIINTTKDGETLKRLKGYKGHIYTIDARTVSVEALGKYFPNTPMLAAVVKVTGIIPEEDFLKDMEGSFKHKFKPEVIEGNMKALEIALQKVIKVQ 212
83 1.000e-74gi|654856369|ref|WP_028308711.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Desulfitibacter alkalitolerans]  clstr ali  28  4........EIIIAGFGGQGVMSMGQLLAYAGMLEGKNVSWIPSYGPEMRGGTANCSVIISDTEIGSP-IVSEPNTIIVLNLPSLKK-FEPVLIPGGLLLLSTLKADQTY---TRKDINGYEIPAVEIADGIGNTKVANMVMLGAYLEATEAVSVDAVIESLKKVLPQRH-HGLIPLNRKALELGASEIQKAK 181
84 1.000e-74JGI.Meta 7026104706 SRS063999_LANL_scaffold_41716__gene_47251 ketoisovalerate oxidoreductase subunit vorA [Human Supragingival plaque microb  ali  25  16.......HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPSYGPEQRGGTANVTVILNDERISSPILNSY-DIAIVLNQPSLDK-FEPKVKPGGVLIYD---GYGIQRPATRTDINVYRIDAMDAATELNMQKTFNMIVLGGLLKVVPMVQLESVLRGLKKTLPERH-HKLIPVNEEAIRKGMELIRKV. 193
85 1.000e-74JGI.Meta 7058221908 SRS049959_WUGC_scaffold_38415__gene_72859 ketoisovalerate ferredoxin oxidoreductase [Human Stool microbiome from visit n  ali  24  4........EIIIAGFGGQGVLSMGKILAYAGLMENKEVTWMPAYGPEQRGGTANVTVIVSDDPVSSPILSSF-DIAIVLNQPSLEK-FEPKVKPGGIIIYD---GYGISEPPTRKDIKVYRIDAMDAAAEMNLIKTFNMIVLGGLLKIRPVVKIESVLAALRKTLPARH-HNLIPQNEEAIRKGMEIIKEVQ 181
86 1.000e-74JGI.Meta 7011748143 C1977199__gene_184467 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  49  8...MKDIVEIRWHGRGGQGAKTASLLLADAAFNTGKYVQGFPEYGPERMGAPITAYNRISSERSTVHSNIYFPDYVVVVDETLLSVDVTAGLKKEGAIVINSSKSPAELRPLKGYEGRVCTIDAGKISEEELGKNFPNTPMLAAIVRVSGVIGEEEFIKDMEGSFKHKFKPQVIEGNMRALKRSLEEVQV.. 198
87 1.000e-74JGI.Meta 7021039456 C785596__gene_59310 hypothetical protein [Human Posterior fornix microbiome from visit number 2 of subject 159005010] :_  ali  27  1MMEDKAMKELIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPSYGPEQRGGTANVTVILSDERISSP--VLNADTVIVLNQQSLDR-FESKVKPGGILIYDS---YGIHTPPKRTDIKIYKIDATEASIEMQNAKSFNMIVLGAYLKVKPTVSMESVIKGLKKSLPERH-WNLIPMNEEALKKGASLV.... 183
88 1.000e-74gi|490741693|ref|WP_004604001.1| pyruvate synthase [[Eubacterium] cellulosolvens]  clstr ali  47  1...MDNTLEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAFNRISKDPIRVHSNIYYPDYVVVVDETLLHVHVTDGLKDEGAIIVNTSKTEEEIRPLKGYTGRVVVIDARDISEKALGKNFPNTPMLAAAVAVSGVMPKDDFIANMRESFGHKFKPEVIDGNMKALEDAFKAV.... 189
89 2.000e-74gi|671463414|ref|WP_031473320.1| pyruvate synthase [Eubacterium desmolans]  clstr ali  44  1...MNNMVEIRWHGRGGQGAKTACLLLADAAFASGKYVQGFPEYGPERMGAPITAYNRISDERCTIHSNIYEPDYVVVVDETLLSVDVTHGLSPKGAIVINTHKTPDEVRPLLRYEGRVYTIDARAISERTLGKYFPNTPMLAAIVKVSGVLDPWRFISDMEASFRHKFKPQVIEGNMECLTQSLKEVR... 190
90 2.000e-74JGI.Meta 7004221420 C4227057__gene_292349 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  47  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPLTAYNRISETPIRIHSNIYEPDYVVVVDDTLISVNVTQGLKENGAILINTNKSIDEIKYFKDYKGKIYTIDASKISRECLKANYPNTAMLSAIVKITGIMTKDELLKDMEESFKHKFKPEVIAPNMEAVKRAFDEV.... 186
91 2.000e-74gi|517059510|ref|WP_018248328.1| pyruvate synthase [Orenia marismortui]  clstr ali  46  1...MSDLIEIRWHGRGGQGSKTASILLGKVAAKTGKNIQAFPEYGPERMGAPVLAYNRISDKEITVHCQVTEPDIVSVLDPTLLDVDVTEGVPDNGVIIVNTEISASKLRDKIGFNGELYTVDAYGISTEEIGAPFPNTPMLGALIKATDLLDFEGFLSEMKNEFEKKHKPEVIEGNINSMKRAYQEVK... 189
92 3.000e-74gi|599128633|gb|EYE87512.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Fervidicella metallireducens AeB]  clstr ali  29  5........EIIFAGFGGQGILSMGKFLAYAGLDEGLNVSWFPSYGPEMRGGTSNCSVIIDEDPIGSPLVV-DASTVVVMNRPSLDK-FESHVVPGGLLIIDSDLVN---REPERTDIDIIKIPAQTAAEEVGSKKIANMVLLGALVERTKIVPMEALLHALK----AHGKEQFYELNKKALEKGAEYARK.. 177
93 3.000e-74gi|672404668|dbj|GAK55346.1| pyruvate ferredoxin oxidoreductase, gamma subunit [bacterium UASB270]  clstr ali  50  1......MIEIRWHGRGGQGTVTAAKMLADASLQGGKYVQASPEYGAERMGAPLRAFNRISDEEIFLHCSITNPDIVVVVDPSLVTQAVTEGVKDSTTFVVNSPLSAQEVRKLLKFNGKVFTVDATKIALETFGRNIPNTPMLGALIQVTQILEKDTLVTQLKKSLQKKFGDKVVQQNVNAVERAFQEV.... 184
94 3.000e-74gi|665941951|ref|WP_031307997.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Bacillus sp. 17376]  clstr ali  26  2......MEEILIAGFGGQGVMSMGQLIAYAGMTEGRYVSWLPSYGPEQRGGTANCAVVVSEEQVGSP-IVSRPTTVIVLNNPSYEK-FEPMVRAGGLLVVNSSLIS---KVSARTDIRVLTIDATDKANELGNPKVANMVLLGAFLEETGILSDESILEALKKVLSP-EKHSLLEINRRALELGRSLTKE.. 179
95 3.000e-74gi|494500979|ref|WP_007290442.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Thermosinus carboxydivorans]  clstr ali  31  2......THEIIMAGFGGQGVMLMGQLVTYAGMIEGKQVSWIPSYGPEMRGGTANCSVIVSDEAIGAP-IVTEPTAVVAMNLPSLDK-FESALLPGGVLIINSSLIE---RSSKRDDITVYRVPANDIAAELGNSKVANMVVLGALIAATGAVATTSVLKAFQKMFAKK--PELLAINEQAIHRGAECIKK.. 178
96 3.000e-74 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2  ali  47  1...MSNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDTPITIHSNIYEPDYVVVVDDTLLEVNVTAGLKKEGAIVINTTKSPDEVRLLKGYEGKVCTIDAKTISIDTLGKYFPNTPMLAAIVKVSGIMSDEEFLNDMIGSFKHKFKPEVIDGNMAALKRSLNEI.... 189
97 3.000e-74JGI.Meta 7051348970 SRS020328_Baylor_scaffold_37703__gene_96245 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate  ali  50  1...MKEIVEIRWHGRGGQGAKTASLLLADAAFNTGRYVQGFPEYGPERMGAPITAYNRISRERCTVHSNIYEPDYVVVVDETLLAVDVTKGLSEEGAVIVNSDKKPEELRGSLGYQGKICTVDAGRISEETLGKNFPNTPMLGAVVKVSGVIPEENFVKDMRQSFAHKFKPQMIEGNMRALVKAMQEV.... 189
98 4.000e-74gi|503042057|ref|WP_013277033.1| pyruvate synthase [Acetohalobium arabaticum]  clstr ali  48  1...MANLTEIRWHGRGGQGAKTASILLGKVASKTGKNIQAFPEYGPERMGAPVLAFNRISDEELTVHCQVTEPSIVTVLDPTLLEVDVTEGIPADGKIIINTTKSPTDVKKELDFEGEVYTVDADGISTDEIGAAFPNTPMLGALVKVTDLLEFDNFKEQVEKEFKKKFKPEVIDGNMKSIERAYQEVK... 189
99 4.000e-74gi|548380033|ref|WP_022519295.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Roseburia sp. CAG:100]  clstr ali  45  1...MNKTVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEPITVHSNIYEPDYVVVVDESLLETDVTKGLKKDGAVIINSERSKEELREHLGYEGAVYTVNAKQISLRTLGRNYPNSPMLAAAVAVSNVMERKEFLQEMRASFQHKFKPEVIDGNMQALELAFEEA.... 189
100 4.000e-74gi|490720913|ref|WP_004583473.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas gingivalis]  clstr ali  27  2......TYEIVIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPSYGPEQRGGTSNVTVIVSDEQVSSPVL-NEYDIVIVLNQPSLDK-FEARVKKGGILVYD---PDSIVLKNKRDDIQIYEVDATQESLRMGNQKAFNMIVLGGVLKVAPMVKIESVIKGLKKTLPERH-HKLIPMNEQAIQRGMEIIKQ.. 179
101 4.000e-74 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and rela  ali  26  56........EIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERISSPILSQY-DTAIILNQPSLEK-FEGKIKPGGILIYD---GYGIIEPPTRRDIQIYRIDAMDAANEKGMAKTFNMIVLGGLLKLRPVVSIESVIKALRKTLPERH-HHLIPMNEEAIRIGMEIIK... 230
102 4.000e-74gi|499507719|ref|WP_011194359.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Symbiobacterium thermophilum]  clstr ali  30  3......THEILIAGFGGQGVLTAGQLLAYAGNLEGQHVSWVPAYGPEQRGGTANCSVVISDQPVACP-MVSEPTACIVLNQPSLEK-FTPAVQPGGTLVVNTSLCTG---RATRTDITVVPVPATDLAVELGNVRFANMIALGALLAVVPVVKVESILEVLPKVMGE-DKARYIPINREALSRGMEEARRV. 181
103 5.000e-74gi|567410065|gb|ETK01353.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Tannerella sp. oral taxon BU063 isolate Cell 2]  clstr ali  25  3.......HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPSYGPEQRGGTANVTVILNDERISSPILNSY-DIAIVLNQPSLDK-FEPKVKPGGVLIYD---GYGIQRPATRTDINVYRIDAMDAATELNMQKTFNMIVLGGLLKVVPMVQMESVLRGLKKTLPERH-HKLIPVNEEAIRKGMELIRKV. 180
104 5.000e-74gi|493568431|ref|WP_006521719.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfotomaculum gibsoniae]  clstr ali  28  1......MFEILIAGFGGQGVLSTGQLLAYAGMMEDKHVAWIPSYGPEMRGGTANCGVTISSEPISSP-VVSEPTVLIAMNRPSLEK-FEPAVAPGGLILVNSSLINI---KTKRTDVRTVYVPANDMAEELGNGKVANNIILGALLELTGVVSNDAVLESLKKVLPPK-RHNLIPINGEALEKGRQLAR... 178
105 5.000e-74gi|567928041|ref|WP_024030634.1| pyruvate/ketoisovalerate oxidoreductase [Bacillus vireti]  clstr ali  26  1...MNMLEEIIIAGFGGQGVMSMGQLIAYAGMLEGKGVSWLPSYGPEQRGGTANCAVVVSDEPVGSPL-VTRPSTAIVLNNPSFDK-FEPRVRHEGLLIINSSLV---VGTSERKDIKVLEIPATDIANDLGNSRVANMILLGAFLELTKLVSTDSIIESLKKVLSS-EKHHLIEVNKQALIKGAALV.... 179
106 6.000e-74gi|565856343|ref|WP_023938641.1| MULTISPECIES: 2-oxoglutarate oxidoreductase, gamma subunit [Porphyromonas]  clstr ali  25  2......TYEIVIAGFGGQGVLSMGKILAYSGLMENKEVSWMPSYGPEQRGGTSNVTVIVSDDAVSSP-VVNEYDIVIVLNQPSMDK-FEPKVKKGGILIYD---PNGIHRKPSRTDVSIYEVDATDESMAMGNQKAFNMIVLGGMLKVAPMVTIESVVAGLRKSLPERH-HKLIPMNEDAIKRGMDIIRK.. 179
107 6.000e-74gi|503126051|ref|WP_013360712.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [[Clostridium] sticklandii]  clstr ali  22  2.....QTQKIICAGFGGQGVMSMGQLITYAGMLESKEVSWLPSYGPEMRGGTANCSVIVSETPIGSPVITNDATSAIIMNLPSLTK-FEKDVAPGGSIFINRSLIE---KKVERTDVDVYYIDANEIALELGNPRVANMVMLGALIEINKTVSIDSVLEAFKKVFGP-SKEKFVPLNKEAIEKGMQAVRE.. 181
108 7.000e-74gi|651641605|ref|WP_026627417.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Dysgonomonas capnocytophagoides]  clstr ali  25  4........EIIIAGFGGQGVLSMGKILAYSGLMEGKEVSWFPSYGPEQRGGTSNVTVILSDDVISSP-IVSEYDIAIILNQPSLEK-FESQVKPGGIILYD---PDGIHRPPTRTDISVYKVDAMGKASEMQNQKAFNMIVLGGLLKINPVVDLEHVMMGLKKTLPARH-HGLLPMNEKAILQGMEIVEKV. 180
109 7.000e-74gi|493297876|ref|WP_006255506.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Alloprevotella tannerae]  clstr ali  26  2......TQEIIISGFGGQGVLSMGKILAYAGLMEGKEVSWMPAYGPEQRGGTANVTVIVSDNPISSPILSEY-DTAILLNQPSLEK-FESKIKPGGTIIYDS---FGIIKKPTRTDINIYCIDAMNTAAELKMMKTFNMIVLGGLLKIHPIVQLEGVMKALKKTLPERHWH-LLPTNEQAILKGMEIIK... 178
110 7.000e-74gi|655064733|ref|WP_028513024.1| hypothetical protein [Ruminococcaceae bacterium AE2021]  clstr ali  29  4.......FSIILAGFGGQGILSAGKMAAEAALYEGKEVSWFPSYGPEMRGGTANCSVVISDEPIGSP-VVNDADVVICLNQPSMEK-FEPCIKPGGILIIDSSLI---HIKPTRTDIKFIPMNASEIASELGNMAFATISMLGCLSAATGCFKRESFESALYEVLPER-RHKLIPGNVAAFDKGAKFAE... 179
111 7.000e-74JGI.Meta 7058552834 SRS011529_WUGC_scaffold_22421__gene_43009 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate f  ali  44  7...MDNMIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTAPIRIHSNIYEPDYVVVVDDSLLEVPVTAGLKETGAIIINTTKDVNALKTLLGYKGNVYTIDARKVSIEALGKYFPNTPMLAAIVKVSNIMSEEEFLNDMEGSFKHKFKPEVIEGNMKALTLALKEVKLV. 198
112 7.000e-74gi|553311831|ref|WP_023056794.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit [Prevotella sp. BV3P1]  clstr ali  25  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDERISSPILSKY-DVAIVLNQPSLDK-FQPKIKPGGILIYDGN---GIVSPPSRTDIQVYRIDAVEQAAEMKNAKVFNMIVLGGLLKVCPVVSTDGLQKALYKSLPERH-HHMIPLNMQAVDIGMKLITK.. 179
113 9.000e-74gi|490462644|ref|WP_004333203.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas endodontalis]  clstr ali  26  2......THEIVIAGFGGQGVLSLGKILAYSGLMENKEVSWMPSYGPEQRGGTSNVTVIVSDEKVSSP-VVNQYDIVIALNQPSLDK-FAPRVKKGGILIY---EPNGIHTKTTRDDIRIYSVDATEEALKLGNDKAFNMIILGGLLKIVPVVKLDSVVAGLKKSLPERH-HKLIPMNEEAIKIGMTAIKQ.. 179
114 9.000e-74 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and rela  ali  26  4........EIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIISDDPISSPILNQY-DVAVVLNQQSLDK-FESKVKPGGILIYD---NYGIHRAPERTDIRVYNVEAMEASFDMQNAKTYNMIVLGALLKVCPMVKMESVLAGLRKSLPERH-HKLIPMNEEAIRKGMALIKE.. 179
115 9.000e-74JGI.Meta 7019594635 C3022825__gene_183178 hypothetical protein [Human Stool microbiome from visit number 2 of subject 158337416]  ali  25  1...MKE--EIVIAGFGGQGVLSMGKILAYAGLMDNLEVTWMPSYGPEQRGGTANVTVIVSDKPISSPVLDKY-DTAVVLNQQSLDK-FESRVKSGGTLIYD---PSGIHHLPSRTDIRVVPVDAMEAAIELQNSKTYNMILLGALLKCRPIVEIDAVLRGLKKTLPERH-HHLIPLNEKALRKGMTLV.... 177
116 1.000e-73gi|518369348|ref|WP_019539555.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Proteiniphilum acetatigenes]  clstr ali  24  4........EIVISGFGGQGVLSMGKILAYSGIMEDKEVSWFPAYGPEQRGGTANVTVIISDEPISSP-VVNKYDIAIVLNQPSLEK-FEDKVKPGGALIYD---GYGIHKKVERNDINVFRINAMDESMKMNNTKVFNMIVLGGLLKISPMVDVENVMEGLKKSLPERH-HKLLPMNEEAILRGMEIIQ... 178
117 1.000e-73gi|503698998|ref|WP_013933074.1| pyruvate synthase [Thermotoga thermarum]  clstr ali  70  1..MPAKYFEVRWHSRAGQGAKSAAQLLAEAVLDMGKYAQAFPEYGAERSGAPMRAFNRISDEKITVHSAVENPDVVVVIDDTLLSPAVVVGLKKEGVLIVNTAHPIEFVRKKTGFEGKICIVRATDIALEELKRGIPNTVMLGTIARVTGLITLETAAQRIREMFERKLPEEMIQANLRALKRGYEEV.... 186
118 1.000e-73JGI.Meta 7004858999 C3838891__gene_227259 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Tongue  ali  25  6.........VICAGFGGQGVMSMGQLMTYAGMLENKEVSWLPSYGPEMRGGTANCAVTISDQPVGSPIITDDATAAVIMNSPSLTK-FEGDVVPGGVILINSSLVHE---KCSRDDIEAYYIDANELSNELGGPKFANMVMLGAFLAVDDSVNIESVLEAFKKVFGKR-KEKFIPVNRQALEAGYNAV.... 179
119 1.000e-73gi|648287783|ref|WP_026068932.1| pyruvate synthase [Methanomassiliicoccus luminyensis]  clstr ali  46  2.....RTLEIRWHGRGGQGVVTANEILAGAALQEGKYMKAFPEFGPERMGAPIRAFARVSDEPIKVHSQVYFPDYVIVLDPTLINVNVLEGMKADGGLIVNYPDGKDHLRKALATDLEVHVVDGTKIALETVGRPLANTAMLGALVKVSGIVELDSVKDELRAKLGGKLPQKVVEKNVLSVERAYQEV.... 185
120 1.000e-73JGI.Meta 7025450186 SRS045004_LANL_scaffold_30381__gene_46936 hypothetical protein [Human Stool microbiome from visit number 1 of subject 60  ali  23  1...MKQ--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVSWMPSYGPEQRGGTANVTVILSDDRISSPVL-NEYDIAIILNQPSMEK-FENKVKKGGIIIYD---GYGIHTPVKRTDVSVYRVDAMDAATEMKNEKAFNMLILGGLLKIVPMVKLENVLLGLKKSLPERH-HKLIPMNEAAIKKGMEIITNVQ 181
121 1.000e-73gi|512184003|ref|WP_016410719.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Prevotella sp. CAG:1031]  clstr ali  27  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMDDLEVTWMPSYGPEQRGGTANVTVILSDKPISSPVLDEY-DCVVALNQQSLDK-FEPKVKKGGTLLYD---PYGIHRAPTRPDINAVAVPAMEATFEMGNSKTFNMIVLGGLLGVRPMVPVESVLKGLKKVLPERH-HHLIPLNEEALRKGISLTKK.. 179
122 1.000e-73 GL0277644 unmapped_[Complete]_[mRNA]_locus=scaffold708510_1:723:1265:-  ali  30  1......MIEVICSGFGGQGVLVAGMILADAGMEDNKQVSWYPSYGFEMRGGAANCDVKISDEEIPSP-FCLEPDIVYTLNETAIDT-YESRLKPGGVLLVNSSLVPDE--RTYRDDIQVIKVPATTIADELGNPKGTNIVMLGALACASDLYDEAAMRHAVEHYFGKKGK--VNPKNAQCFDRGADEARK.. 178
123 1.000e-73gi|544696280|ref|WP_021127424.1| pyruvate ferredoxin/flavodoxin oxidoreductase family protein [[Clostridium] sordellii]  clstr ali  26  6.........VICAGFGGQGVMSMGQLLTYAGMLEEKEVSWLPSYGPEMRGGTANCSVTISDIPVGSPVITDDATCAIVMNLPSLDK-FEKDVVPGGKILVNNSLID---KKVERTDVKSYYIPANELALELGNPRVANMIMLGAYLELNKCVEVESVLEAFKKVFGP-SKEKFVPLNKEALMKGAEAVKSQE 183
124 1.000e-73gi|692121846|ref|WP_032078088.1| pyruvate synthase [Clostridium drakei]  clstr ali  48  1...MSKLIEIRWHGRGGQGAKTASLLMADAAFNTGCYVQGFPEYGPERMGAPITAYNRISTEKITVHSNIYEPDYVVVVDESLLEIDVTAGLKEEGAIVINTEKSPEEIKNHLRYKGKVCTIAAGKISEEALGKNFPNTPMLGAIVKVSGIMDEEAFVKDMEASFVHKFKPEVLKGNMEALKRSMEEVK... 190
125 2.000e-73gi|501423447|ref|WP_012448117.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Natranaerobius thermophilus]  clstr ali  29  1......MQEVIMAGFGGQGVMSMGQLLTYAGMLESKGVAWMPSYGPEMRGGTANCTVVITDEEVGSP-IVSNPDTLIAMNYPSL-VKFKDSIKAGGVLLYNSSLIEEEVESI--DDVDIYPIPANEIANELGESRIANMVMLGAFIEKTHAVSIDSVLESLKKVLPEK-RHNLIPVNEKALRKGAEMVK... 179
126 2.000e-73gi|502885563|ref|WP_013120539.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Thermincola potens]  clstr ali  25  4........ELIIAGFGGQGVMSMGQLLTYAGMIEDKHVAYIPSYGPEMRGGTANCSVTISDREISSP-VFTEPSSVIIMNQPSLAK-FEPMLKPGGLMLINSSLVS---QKATRQDIRVLEIPGNEMAEKLGNGKVANIVLLGAYIEMTKVVTIDSIIESLKKVLPER-RHNLIPLNRQALELGAEIVQK.. 179
127 2.000e-73gi|504619564|ref|WP_014806666.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Anaerobaculum mobile]  clstr ali  29  1...MSFYREMIAAGFGGQGIMLMGQIIAHAAMYDGKNVIWIPSYGPEMRGGTANCSVVVSDGEIASPL-ISSPDILVVMNQPSLAK-FVNRLKKGGILVYNTDLVTYDN---PRDDINIVGVNANSIALELGNERVANIVVLGALAEVTDMASVESLKEALKELLGAK-KASLLEINLKAFEKGQEIGKQY. 182
128 2.000e-73gi|551036943|ref|WP_022780690.1| pyruvate synthase [Lachnospiraceae bacterium NK4A136]  clstr ali  45  1...MSKLTEIRWHGRGGQGAKTAALLLADVCFKIGKNVQGFPEYGPERMGAPITAFDRISDNPIRVHSNIYEPDFVVVVDETLLHTDVTKGLKKDGAILINTDRKAEDLIPLNGYKGKVFTIDAREVCMKTLGKYFPNTPMLAAVVKITGLMEPERFLTEMEESLKHKFKPEVLEGNMKALKLALEEVH... 190
129 2.000e-73gi|493484106|ref|WP_006438929.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [[Clostridium] hiranonis]  clstr ali  23  6.........VICAGFGGQGVMSMGQLLTYAGMLENKEVAWLPSYGPEMRGGTANCAVTVSDHEVGSPLITDDATAAVLMNLPAFHK-FQNDVIPGGKILVNSSLIKE---KVARDDVDVYYIPANELAVELGNPKVANMIMLGAYLGVSGTVSVDSVLEAFKKVFGER-KAKFIPLNRAALEKGIEATQK.. 181
130 2.000e-73gi|548235179|ref|WP_022453645.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase gamma subunit [Prevotella sp. CAG:873]  clstr ali  28  1...MKE--EIIIAGFGGQGVLSMGKILAYAALMDNLETTWMPAYGPEQRGGTANVTVIISDSAISSP-IVDSYDTAVILNQQSLDK-FESKVKPGGTLIYD---PYGIHRAPTRTDIRVIPVDATDAAIEMGNSKTYNMILLGALLKARPLVPDDAVVRGLRKTLPERH-HHLIPLNEEAIARGKALVK... 178
131 2.000e-73gi|553306669|ref|WP_023052085.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Cetobacterium somerae]  clstr ali  45  1...MSKMVEIRWHGRGGQGAKTASLLLADVAFSSGMYVQGFPEYGPERMGAPITAYNRIGNEPIRVHSNIYEPNFVVVVDETLIKIEVEKGLKEGGAIIVNSERSPEELRAELRYTGRLYTCNARKISEECLGKYFPNTPMLGAVVKVSELIPEAEFIKNMEESFKHKFKPQVLEGNMCALKRSMDEVE... 190
132 2.000e-73gi|557699355|ref|WP_023439536.1| pyruvate synthase subunit porC [Clostridium tetani]  clstr ali  48  1..MDKKLMEIRWHGRGGQGAKTASLLLAEAAFNAGMYIQGFPEYGPERMGAPITAYNRISNFPLRVHSNIYEPDYVVVVDETLLKTGVTKGLKKEGGIIVNTKKTPDEIRKELGYEGKVYTVNARKISEEALGAYFPNTPMLGSIVRVTNIIDIDKFIGDMEGSFKHKFKPHFIPKNMEALKRGIQEV.... 190
133 2.000e-73gi|652500340|ref|WP_026894740.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Clostridiisalibacter paucivorans]  clstr ali  26  5.........IIIAGFGGQGVMAMGQLLTYSGMIEDKNVAWLPSYGPEMRGGTANCNVLISDEPIGAP-VVTEATAAVVMNLPSLDK-FEKDVVPGGKLFINSSLID---KKCSRDDIDVYYVPVNDLANDLGNAKVANMVMLGAFLELTNAVKVDSILEAFKKVFGE-NKSHLLPINEKALEKGASVVK... 178
134 2.000e-73gi|503545168|ref|WP_013779244.1| pyruvate synthase [Tepidanaerobacter acetatoxydans]  clstr ali  52  1..MSEKVLEIRWHGRGGQGAKTAALMLAETVAQMGKYVQGFPEYGPERMGAPILAFNRISDEPIHIHSNVINPDIVIVLDATLLGEKVTAGVPEDGIYIVNTTKTPQEVRKKLNKGGKIFTVDANQISLDTIGRVIPNTPLMGAFVKATGLMSYDEFIENVKGELEKKFKPEVIAGNIKAIERAYQEVK... 190
135 2.000e-73 GL0091539 [Complete] locus=scaffold21813_2:343:915:-  ali  44  1...MNKTVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEPITVHSNIYEPDYVVVVDESLLETDVTKGLKREGAVIINSERSKEELRKHLGYEGSVYTVNAKQISMRTLGKNYPNSPMLAAAVAVSNVMERKAFLQEMRASFQHKFKPEVIDGNMQALELAFEEA.... 189
136 2.000e-73gi|494607266|ref|WP_007365513.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas uenonis]  clstr ali  24  3.......YEIVISGFGGQGVLSMGKIIAYSGIMENKEVSWMPSYGPEQRGGTSNVTVIVSDEPVSSP-VVNEYDVVIVLNQPSLDK-FGPRVKKGGILIYDPALIQ---HKSDRKDINIYEVPATEQSMEMGNDKIFNMIILGGMLKAAPMLKLESIIAGLKKSLPERH-HKLIPLNEEAIKRGMNSLSKV. 180
137 2.000e-73gi|504063031|ref|WP_014297025.1| pyruvate synthase [Marinitoga piezophila]  clstr ali  67  1..MPEKYFEIRWHGRAGQGAKSASQFLTEAAVEAGKYSTAFPEYGAERSGAPMKAFNRIADVPIRIRSGIENPDVVVVFDDTMLGPDITAGLGEDKIMLVNTVMSPEEVREKTGFKGKIYTIPATDIALEEIKRGIPNTVMIGALVKLTNVVPMEVVKEKVRKTFEKKFSEEVVQANLRAVDRGYQEVK... 188
138 2.000e-73gi|503949559|ref|WP_014183553.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfosporosinus orientis]  clstr ali  26  4........KIILAGFGGQGVMSMGQLLAYAGLVEKKHVSWIPSYGPEMRGGTANCSVTISDEEVSSP-IITEPDTLIVLNRPSLEK-FEKDVKRGGRLLINSSLIQIESQ---RQDLQVLKIDASEMAREIGNNRVSNMIILGAFIELTRSVTLESVIGALKQVLPE-YRYNLIPLNRQALEKGIQLAK... 178
139 2.000e-73gi|488933092|ref|WP_002844167.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Peptostreptococcus]  clstr ali  24  6.........VICAGFGGQGVMSMGQLMTYAGMLENKEVSWLPSYGPEMRGGTANCAVTISDEPVGSPIITDDATAAVIMNSPSLTK-FEGDVVPGGTILINSSLVHE---KCERDDIEAYYINANELSNELGGSKFANMVMLGAFLAVDSSVDIESVLEAFKKVFGKR-KEKFIPVNRQALQAGYDAVMDQK 183
140 3.000e-73gi|653227415|ref|WP_027439914.1| pyruvate synthase [Lachnospiraceae bacterium AC2031]  clstr ali  46  1...MSKAVEIRWHGRGGQGAKTAALLLADVAFNTGMYVQGFPEYGPERMGAPITAYNRISEKEIRNHSNIYNPDYVVVVDETLLHVDVTSGLNKDGGIVINTARPKEEIIPLKGYEGAVYTVDARTISLETLGKYFPNSPMLAAIVKVSGIMSKQDFLEQMRGSYQHKFKPEVIDGNMAALERAFEEVQ... 190
141 3.000e-73JGI.Meta 7068140767 SRS015782_WUGC_scaffold_34082__gene_76237 2-oxoglutarate oxidoreductase, gamma subunit [Human Stool microbiome from visi  ali  26  3.......TEIIISGFGGQGCLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTASVTVIVSDERISSPILSKY-DVAIVLNQPSLDK-FESKVKPGGILIYDGN---GIINPPTRKDITVYQIDATDKAAEMKNSKVFNMIVLGGLLKVCPVVSTEGLNKALFKSLPERH-HKLIPLNMEAVSEGMKIIEKKE 181
142 3.000e-73gi|547733071|ref|WP_022147011.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Bacteroides sp. CAG:709]  clstr ali  24  4........EIIIAGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDAPVSSPILSSF-DIAIVLNQPSLEK-FEPKVKPGGIIIYD---GYGISEPPTRKDIKVYRIDAMDAAAEMNLIKTFNMIVLGGLLAIRPVVKIDSVIAALRKTLPERH-HNLIPKNEESIRKGMELIKEVK 181
143 3.000e-73gi|618852160|gb|KAJ51395.1| pyruvate synthase subunit porC [Clostridium tetanomorphum DSM 665]  clstr ali  49  1..MKKKLIEIRWHGRGGQGAKTASLLLAEVAFNTGMYIQGFPEYGPERMGAPITAYNRIANYPLRVHSNIYEPDYVVVVDETLLKVDCTAGLKGDGAIVINTKKSPEGIRKELRYEGKVYTIDARTISEQTLGANFPNTPMLAAIVKILGIMDKEEFIKDMEKSFKHKFKPNVIAKNIEALKRGLQEVKGLE 194
144 4.000e-73gi|505138643|ref|WP_015325745.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Methanomethylovorans hollandica  clstr ali  41  1......MKEIRIHGRGGQGSVTAAELLAVAAFADGKFSQAFPAFGVERRGAPVQAFTRMDDTPIRLRSQVYEPDYVIVQDPTLIEVDVASGLKEDGIIIINSEFDPSTFK--LNTKAKVVTVNATKIALEIIGRPIVNTVLLGAFAGATGNIRPESIKEAVKERFPGKVG----ERNAEAIQQAYDMMKEA. 180
145 4.000e-73 GL0048677 unmapped_[Complete]_[mRNA]_locus=scaffold18464_1:2342:2920:+  ali  41  1...MKDLIEIRWHGRGGQGAKTAALLLADVAFNNGLYVQGFPEYGPERMGAPITAYNRLSRNPIRVHSNIYEPDYVVVVDESLIEVDVTAGIKEGGAIIINSHKSSNELKPLKGYHGHIYTIDARKISIETLGKYFPNSPMLAAVVKITGVMEEKAFLEDMRKSYAHKFKPSVIDGNMKALEIALKEVH... 192
146 4.000e-73gi|610423482|gb|AHW60686.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Draconibacterium orientale]  clstr ali  24  4........EMIIAGFGGQGVLSMGKILAYSGIMEDKEVTWFPSYGPEMRGGTANVTVIVSDTRISSP-ILQQFDTAIILNQQSMDK-FEKAVKPGGTLLYD---PNGVIHPPTRTDINIFKVEATKTAVEMGNPKVFNMIVFGSYLKVRPILSLDNVEKGLEKSLPERY-HKLIPLNLEAIKKGQEIVEDVQ 181
147 4.000e-73gi|548187700|ref|WP_022408615.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:354]  clstr ali  46  1...MNDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGAERMGAPITAYNRISTTPIRIHCNIYNPDYVVVVDDTLLHVDVTAGLKESGAIIINTTKDGETLKRLKGYKGHIYTIDARTVSIEALGKYFPNTPMLAAVVKVTGIIPEKDFLQDMEGSFKHKFKPEVIGGNMKALEIALQKVVKVQ 193
148 5.000e-73gi|531656239|gb|EQJ34011.1| pyruvate ferredoxin/flavodoxin oxidoreductase family protein [Clostridium difficile P19]  clstr ali  22  6.........VICAGFGGQGVMSMGQLLTYAGMLEGKEVSWLPSYGPEMRGGTANCAVTVSNEPVGSPLITDDATAAILLNIPAFEK-FKDDVIPGGKIIVNSSLIKE---KVDRTDVDVYYIPANELAAELGNDKVANMIMLGAYLKVSDTVDIESVLEAFKKVFGPR-KEKFVPLNREALQKGMDA..... 178
149 5.000e-73gi|548216883|ref|WP_022436183.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Prevotella sp. CAG:279]  clstr ali  28  3.......HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVILSDEKISSP--ILNADIAVVLNQQSLDK-FESKVKPGGILIYD---NYGIHRAPTRKDIKVYNVAAMDATLEMKNSKTYNMIVLGALLKVCPMVTLESVIKGLKKSLPERH-HKLIPLNEEAIRKGMSLINE.. 179
150 5.000e-73gi|595614242|gb|AHM57886.1| pyruvate synthase subunit PorC [Eubacterium acidaminophilum DSM 3953]  clstr ali  48  1......MLEIRWHGRGGQGAKTASLLLADVAFNTGKYVQGFPEYGPERMGAPITAYNRISDEKITIHSNIYEPDFVVVVDESLLEVDVTKGIKEGGAILINTDKNAEEIKNLKGFNGTIYTIDARAISEKCLGRYFPNTPMLAAAVKICGIMEDEAFLREMQGSFEHKFKPEVIEGNMNALKMAIAEV.... 186
151 6.000e-73gi|495797406|ref|WP_008521985.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Jonquetella]  clstr ali  29  1..MAGFYKELLAAGFGGQGVMMLGQLVAFSGIEDGRNVTWIPSYGPEMRGGTANCSCVVSDEPVGSP-MVTSGDVVVVMNQPSLTK-FESAVKPGGLLIYNSDLVNYE---KPRTDIRVLPVPANSIATELGSDKVANIVILGTLVEASGMVSLDSAMKIIREKLGKK-KPKFLPMNLEAFARGRALVKK.. 182
152 6.000e-73gi|9651770|gb|AAF91262.1|AF230199_4 pyruvate oxidoreductase delta subunit [Methanococcus maripaludis]  clstr ali  41  1......MKEVRFHGRGGQGAVTAAQILAKAAFYDGKFCQAFPFFGVERRGAPVMAFTRIDDEKIRLRSQIYEPDYVIVQDPTLMDVDVTSGIKDGGIILINT------LKDIKLNGYDVKTIDATGIALDVLGVPIVNTTLCGAFAGLTGEVTIESLKKSILETFPGK----LGPKNADAAEKAYNLTK... 174
153 7.000e-73gi|547728309|ref|WP_022142453.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:230]  clstr ali  43  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDKIRVHSNIYHPDYVVVVDETLLDVDVTAGLKVNGAIIINTAKSREEIKHLKGYTGRVYTIDARKISMETLGKNFPNSPMLAATVAVSEVMPREDFFREMRASYQHKFKPEVIDGNMQALEMAFEELEE.. 191
154 7.000e-73gi|547515172|ref|WP_022102733.1| putative uncharacterized protein [Prevotella sp. CAG:5226]  clstr ali  25  4........EIIISGFGGQGVLSMGKILAYAALMEGKEVTWMPAYGPEQRGGTANVTVIISDEPISSPILSTY-DTAILLNQPSLDK-FQPKVKKGGTLIYDS---FGIIEKPSRTDITSWHIPAMESAAEMSMMKCFNMFILGGFLKVHPIVSIESVMKALRKTLPERH-HNLLPMNEQAILKGRDIISK.. 179
155 7.000e-73 GL0029609 [Complete] locus=C4559709_1:1404:1946:-  ali  25  4........EIIAAGFGGQGVLSMGKILAYAGLIDDLEVTWMPSYGPEQRGGTANVTVVLSDSPISSPVLDSY-DTAVILNQQSLDK-FESKVKPGGTLIYD---PYGIHHAPTRTDINIYPVNAMDVALELKNAKSYNMIILGALLKINPIVSVDSVMTGLKKTLPERH-HHLLPANREAIMRGMDLVEV.. 179
156 7.000e-73 GL0524513 unmapped_[Complete]_[mRNA]_locus=scaffold331974_1:35:625:-  ali  46  6....NEAVEIRWHGRGGQGAKTACLLLADVAFSSGKHVQGFPEYGPERMGAPITAYNRITDEHCKVHSNIYKPDYVVVVDETLLKVDVTKGLKEKGALIINSKKSPEEIRPLKGYKGKVCTIDAEKISMDALGKNFPNTPMLGAVVKVSHVIDQERFIQDMKESFQHKFKENLIEGNMSALKKSMEEVKV.. 195
157 9.000e-73JGI.Meta 7019946776 SRS048870_WUGC_scaffold_19168__gene_31810 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate f  ali  45  1...MNDLVEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPIVIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTVRDADYLKSVKGYNGGIYCIDARKISEEALGKYFPNTPMLAAIVKVAGIMNDEDFLADMQGSFKHKFKPEVIEGNVKALEMALQEVKK.. 191
158 9.000e-73gi|504366405|ref|WP_014553507.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Halanaerobium praevalens]  clstr ali  24  1..MMKE--EVIMAGFGGQGVMSIGKLLSYAGMKESKEVSWMPSYGPEMRGGTANCTVIVSDKKIPSPLS-SKPDSIIVMNLPSLDK-FAPKVKSGGTIFVNSSLISKEV---ERDDVEVVKIPANKIANELGNNKAANMAMLGAYIAKKEIVSLDTVKNSLENVLPER-RHGLIPINEKALAKGNEI..... 177
159 1.000e-72 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and relat  ali  26  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTCNVTVIVSDERVSSP-IVSEYDVAIVLNQPSLDK-FEPKVKKGGFLIYDTS---GIINPPKRTDITVCPIAALDKAVEMKNSKVFNMIVLGGLLKVCPVVSDKGVEKALYKTLPERH-HGLIPLNMEAIKAGREIIK... 178
160 1.000e-72gi|671518494|ref|WP_031503916.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Thermotoga hypogea]  clstr ali  31  6..........VLAGFGGQGVMLMGQILAQAGMQEGKNVTWFPSYGPEMRGGTANCTVVISDEPVASP-IVDNPDVVVAMNIPSLLK-FEPRLKKSGFLFLNSSVID---RRPNRNDIKIVEVPANEIADKIGNLRVANMVMLGAIIAVTNCVRKDSIVSALQYKLGEKGSS-LLKLNIEAIEAGIKHV.... 177
161 1.000e-72gi|547821792|ref|WP_022230245.1| pyruvate/ketoisovalerate oxidoreductase catalytic domain [Firmicutes bacterium CAG:41]  clstr ali  27  5........EMILAGFGGQGILFTGKILAFAAMLKDKKLSWLPSYGPEMRGGTANCHVIIDDEPIGSP-IVTRPNILVAMNKPSLDK-FENTVSDGGYVFINTSLID---RKSEREDVNEICVNATETAHNMGNKSLANMVMLGAVLKKTELFTIDEIEYTMKKSLPE-NKHKLIEMNIKAVKEGYNLV.... 178
162 1.000e-72gi|652505602|ref|WP_026899911.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Peptostreptococcaceae bacterium VA2]  clstr ali  24  6.........VICAGFGGQGVMSMGQLLTYAGMLEGKEVSWLPSYGPEMRGGTANCAVTVSDSPVGSPLITGDATCAIVMNLPSLEK-FESEVKPGGKIIVNSSLIE---QKVQRDDIEVYYIPANDIASDLGNPKVANMIMLGAYLETEPAVEVDSVLEAFKKVFGP-SKEKFVPLNKDALLKGGAAIK... 180
163 1.000e-72gi|503324221|ref|WP_013558882.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Anaerolinea thermophila]  clstr ali  31  3.......TEIIVSGFGGQGVLFAGQLLSYAAMDAGKEVTWIPSYGPEMRGGTANCTVVISDEEIGSPL-VKHPQAVIAMNLPSLDK-YEPLVKSGGVLIVNASMVN---RQPARTDIHWVMVPGNEIAEELGDRRMTNMVMLGALLANLPILSLEALVRTLEAHMPARH-QRLLPLNIEAIKRGAEY..... 176
164 1.000e-72gi|547261972|ref|WP_021996672.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:780]  clstr ali  45  1...MNDLVEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPIVIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTVRDADYLKSVKGYNGGIYCIDARKISEEALGKYFPNTPMLAAIVKVAGIMNDEDFLADMQGSFKHKFKPEVIEGNMKALEMALQEIKK.. 191
165 1.000e-72JGI.Meta 7033889227 C5459614__gene_233812 putative 2-oxoglutarate synthase subunit [Human Supragingival plaque microbiome from visit number  ali  26  4........EIIIAGFGGQGVLSMGKILAYSGIMQGQEVAWMPSYGPEMRGGTANVTVILSDSRISSP-VIQEFDTVIVLNQQSLDK-FESRVKPGGTLIFD---PNGISNPPKRKDIAIYSVKATDEATAMNNSKTFNMIVLGAFLKVKPIVDMDNVVKGLQKSLPERH-HNLIPMNEQAIRRGMEIVEK.. 179
166 2.000e-72gi|499960049|ref|WP_011640783.1| pyruvate synthase [Syntrophomonas wolfei]  clstr ali  43  1.MASNNMVEIRWHGRGGQGAKMACLLLADVAGLEGKFVQGFPEYGPERMGAPITAYNRISEKRCTIHSNIYYPDYVVVVDETLLDVDVTGGLKDGGAIIINTPSSPQEIRPLQGWTGKVCTVDARRISEDVLGTNFPNTPMLAAAVKVSGVLETERFLANIEESFKHKFKPQLIEGNMATLKKSMEEVQ... 192
167 2.000e-72gi|514416197|ref|WP_016564031.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Bacteroides sp. CAG:927]  clstr ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMDNLEITWMPSYGPEQRGGTANVTVILSDAKISSPVLDTY-DTAVILNQQSLDK-FESKVKPRGTLIYDS---YGIHRMPQRTDINVYRVDAMDATFEMKNAKTYNMIVLGALLKIRPIVSVDSVMAGLKKALPERH-HHLLPLNREAINRGMDLVK... 178
168 2.000e-72gi|647556686|ref|WP_025837762.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas cangingivalis]  clstr ali  25  1...MKK-YEIVIAGFGGQGVLSMGKILAYSGLMGNKEVSWMPSYGPEQRGGTANVTVIISDEKISSPILNSY-DIAIVLNQPSLDK-FISKVKPGGMLIYD---GYGIHTEPKRDDIKLYKIDAMDASLEMNNTQVFNMIVLGGLLKLAPMVDIEHVLLGLKKSLPERH-HKLIPLNEAAILKGMEIIREKE 182
169 2.000e-72JGI.Meta 7022066744 C3690145__gene_144657 ketoisovalerate ferredoxin oxidoreductase [Human Stool microbiome from visit number 1 of subject 1  ali  25  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMDDKEVTWMPSYGPEQRGGTANVTVILSDDKISSPILDTY-DTAVILNQQSLDK-FESKVKPGGVLIYDS---YGIHKAPTREDITIYKVDAMEATFDMKNSKSYNMIVLGALLKVRPIVTLESVMNGLKKTIPERH-HHLMPLNEEALQKGMSLI.... 177
170 2.000e-72gi|503699018|ref|WP_013933094.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Thermotoga thermarum]  clstr ali  30  2......THSFIIAGFGGQGVMLMGQILAQAAMIEGKNVTWFPSYGPEMRGGTANCTVVISDEPVASP-VVENPLELVVMNIPSLLK-FEPKVKPSGYLFVNSSVVD---RKPTRNDIQVFEIPVNDLAEKLGNARVANMVMLGAVVQVTKCVKLDAVVEAIKYKLSSR-GEQIVDLNIKAIYEGVRHV.... 177
171 2.000e-72gi|502960259|ref|WP_013195235.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanohalobium evestigatum]  clstr ali  41  1......MKEIRVHGRGGQGSVTAAELLAIAAFSDGKFSQAFPSFGVERRGAPVQAFTRIGDKPIRLRSQIYEPDYVIVQDPTLIDVDVAHGMDENGIVIINSDFNPEDFN--IDTDAKIMTVDATKIALDIIGRPIVNTILLGAFAGATDEINPESIKEAVKERFPGKIG----DKNAEAVQKAYDMIRE.. 179
172 2.000e-72 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2  ali  43  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDKIRVHSNIYHPDYVVVVDETLLDVDVTAGLKANGAIIINTAKSAEIEKHLKGYTGRVYTIDARKISMDTLGKNFPNSPMLAATVAVSEVMPREDFFREMRASYQHKFKPEVIDGNMQALEMAFEELEE.. 191
173 2.000e-72gi|506213460|ref|WP_015733235.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanocaldococcus vulcanius]  clstr ali  42  1......MIEVRFHGRGGQGAVTAAQILAKASFYDGKFCQAFPFFGVERRGAPVMAFTRIDDKKITLRCQIYEPDYVIVQDPTLLEVNVVDGLKENGAVIINT------VKEDLDLGYKTYTIDATGIALDVLGVPIVNTAMVGAFAGVTKLVSIESVKKAILDTFKGK----LGEKNAKAAELAYEMIKKY. 177
174 2.000e-72gi|493851596|ref|WP_006798524.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Dysgonomonas gadei]  clstr ali  23  2......TQEVIIAGFGGQGVLSMGKILAYSGLMEDKEVSWFPSYGPEQRGGTANVTVILSDNAISSP-IVNEYDIAIILNQPSLDK-FEPHVKPGGILIYD---PSGFQHPPTRKDIYIYKIEAIDTATLMQNTKAFNMIVLGGLLKVSPMVQLDNVMLGLKKSLPERH-HKLLPMNEQAILKGMEIIQEVQ 181
175 2.000e-72gi|490491298|ref|WP_004357520.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella disiens]  clstr ali  26  3.......TEIIISGFGGQGVLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTANVTVIISDERISSPILSKY-DVAIVLNQPSLEK-FEPKVKTGGILIYD---GFGIINPPTRSDIKTYRIDAMNKAAEMKNSKVFNMIVLGGLLKVCPIVSLDGLQKALYKTLPERH-HGMIPLNIEAVEIGKNIITETK 181
176 3.000e-72gi|550908677|ref|WP_022661777.1| pyruvate ferredoxin oxidoreductase subunit gamma [Desulfovibrio longus]  clstr ali  46  1......MIEIRLHGRGGQGGVTSAELLARAAIAEGKFAQAFPSFGPERRGAPVMAFVRVDDKKIRIREKVYNPDVVLVLDPTLLDVDVSEGLKEGGTVVVNTGQSPDELKKKYGFP-KVACVDANKVALEELGVPITNTTMLGALLRATGIVEVDHMEAVIADRFG----PKLGPKNYNALKRAHGETRAA. 181
177 3.000e-72 GL0122822 [Complete] locus=scaffold2599_6:19897:20448:-  ali  28  1...MKK--EIIAAGFGGQGVLSMGKILAYAGLMDDLEVTWMPSYGPEQRGGTANVTVVLSDTPISSPVLDAF-DTAVILNQQSLDK-FESKVKPGGVLIYD---PYGIHRKPTREDITIVPVEAMEAAIEMKNAKTYNMIILGALLKVNPVVDIESVMKGLKKALPERH-HHLLPLNREAILRGMELVK... 178
178 3.000e-72 GL0289442 [Complete] locus=scaffold151113_1:654:1235:-  ali  46  1...MNDLIEIRWHGRGGQGAKTACLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSAIYEPNYVVVVDDTLLDVDVTAGLKEDGAIVINTTNDAETLKKKLGYKGGIYTIDARSISIDALGKYFPNTPMLAAIVKVSGVIPEDQFLADMEGSFKHKFKPEVIDGNMKALKNTLEKVNKIQ 193
179 3.000e-72gi|491855034|ref|WP_005635292.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Parabacteroides]  clstr ali  23  4........EIIIAGFGGQGVLSMGKILAYSGLMEGKEVSWMPSYGPEQRGGTANVTVILSDDRISSPVL-NEYDIAIILNQPSMEK-FENKVKKGGIIIYD---GYGIHTPVKRTDVSVYRVDAMDAATEMKNEKAFNMLILGGLLKIVPMVKLENVLLGLKKSLPERH-HKLIPMNEAAIKKGMEIITNVQ 181
180 3.000e-72JGI.Meta 7027075670 SRS016335_WUGC_scaffold_45747__gene_97624 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate f  ali  46  1...MNDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGAERMGAPITAYNRISTTPIRIHCNIYNPDYVVVVDDTLLNVDVTAGLKESGAIIINTTKDGETLKRLKGYKGHIYTIDARTVSIEALGKYFPNTPMLAAVVKVTGIIPEKEFLQDMEGSFKHKFKPEVIGGNMKALEIALQRVVEIQ 193
181 3.000e-72gi|503146430|ref|WP_013381091.1| pyruvate synthase [Eubacterium limosum]  clstr ali  44  1...MKDNLEIRWHGRGGQGAKTAALLLADVAFSTGMYVQGFPEYGPERMGAPITAYNRLSQSKIRVHSNIYEPDYVVVVDETLLEVDVTKGVSPEGAVIINTSKDKEIIKHLKGYTGRVFTIDARKVSIEALGKYFPNTPMLASIVKVSGVMENEAFLSEMRHSFEHKFKPEVIEGNMKALSLALQEVK... 190
182 4.000e-72gi|491750135|ref|WP_005583268.1| hypothetical protein [Clostridium ultunense]  clstr ali  28  5.........ITIAGFGGQGVMAIGQLLTYAGMIEGKHVSWLPSYGPEMRGGTANCSVIVSSEPVGSPVVVNS-TTAIVMNKPSLDK-FESTVNPEGRLFINSSLIE---QKSGREDIEVYYIPANEIADELGNMRVANMVMLGAYLEVTKIVDLESILEGFTKVFGE-NRAHLIPINKDALERGAETAR... 178
183 4.000e-72gi|517000890|ref|WP_018206677.1| MULTISPECIES: hypothetical protein [unclassified Atribacteria]  clstr ali  30  1......MLEIIISGFGGQGVMLMGRLLAYAGMIEGKKVAWMPSYGPEMRGGTANCTVLISSNEIGSP-IVSHPKILIAMNQPSLDK-FEPNVSENGLIVLNDSLIEREVK---RNDVKVIRIPADDIANKLGNSRVANMVVLGAYVKKSGVVKLETIFKVLEKTLTG-PKQKLIDINKEALKQGAELGKE.. 179
184 4.000e-72gi|545428058|ref|WP_021666420.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit [Porphyromonas sp. oral taxon 278]  clstr ali  26  2......TYELVIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPSYGPEQRGGTSNVTVIISDTAVSSPL-VQNYDVVIALNQPSLDK-FCPRVKPGGILLFDTNGIHSIPR---RDDIEYYEIPAMDEAMAMGNAKVFNMLILGALLKLRPMISVDSIRRGLEKSLPPRH-HGMIPMNIEAVERGGAIVRPH. 180
185 4.000e-72 GL0101855 [Complete] locus=scaffold5334_2:7723:8262:+  ali  25  4........EIIISGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEKISSPILSKY-DTAIVLNQPSLDK-FQPKVKVGGDIIYDS---FGILDKPTREDIEAYHIPAMETAAEMKMMKCFNMFVLGGLLKIHPIVSLESVMKALKKTLPERH-HDLLPLNEQAILKGMEIISK.. 179
186 4.000e-72gi|501770080|ref|WP_012635625.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Halothermothrix orenii]  clstr ali  22  4........EMIIAGFGGQGVMLMGKLLAYAGMKEGIEVSWMPSYGPEMRGGTANCTVIMSSNKIPSPLS-SKPDTIIVMNLPSLEK-FAPRVKPGGTIFVNSSLIEKEVD---RDDVEVIKVPANELANELGNSKVANMVMLGAYLSKKDVVDLNTVKDSLKSVLSRRH-HKLIPINEKALDTG........ 173
187 4.000e-72gi|570736328|gb|AHF07359.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfitobacterium metallireducens DSM 15288]  clstr ali  27  4........EIILAGFGGQGVMSMGQLLAYAGMFEGEHVSWIPSYGPEMRGGTANCSVTLSDLPISSP-VISEPNTLIVLNRPSLEK-FEKGLKTGGLLLMNSSLIDI---SPQRDDIQVVKIPSDDLANKFGNSRVANMILLGAFLELTHAVSLESVEKALKKVLPE-YRYNLISMNRDALELGVSIVK... 179
188 5.000e-72gi|553028203|gb|AGY53620.1| 2-oxoglutarate oxidoreductase, gamma subunit [Bacteroidales bacterium CF]  clstr ali  25  4........EIIIAGFGGQGVLSMGKILAYSGIMQGQQVTWMPSYGPEMRGGTANVTVILSDSKISSPLLSKF-DTAIILNQQSMDK-FENSVKPGGILIYD---PNGITRQPVRKDIKIYSIDAVDISNELGNSKAYNMVVLGAFLSKKSIVSMENVIKGLKKSIPERH-HHLIPMNEQAIRVGMEKIQE.. 179
189 5.000e-72JGI.Meta 7039910113 SRS016989_Baylor_scaffold_912__gene_1810 ketoisovalerate oxidoreductase subunit vorA [Human Stool microbiome from visit  ali  25  4........EIIIAGFGGQGVLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTANVTVIVSDERISSPILSQY-DTAIILNQPSLAK-FENKVKPGGILIYD---GYGIIEPPTRKDIQIYRIDAMDAANERGIAKTFNMIVLGGLLKLRPVVAIESVLKALRKTLPERH-HHLIPVNEEAIHIGMEIIK... 178
190 5.000e-72 GL0029471 [Complete] locus=scaffold29499_17:520:1092:-  ali  46  1...MQNCVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISPAPIRVHSNIYHPDYVVVVDEGLLDVHVTEGLSEDGAILINTSRDKSELTEKLGYKGAVYTIDAKKVSKACLGKYFPNTPMLAGIVKVSGVMDWDEFYNEMRASFLHKFKPEVIDGNMNALKMAFDEVK... 190
191 5.000e-72gi|503521538|ref|WP_013755860.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Thermodesulfobium narugense]  clstr ali  51  1...MKSYWEIRWHARGGQGAWTASQFLASAALSVNKYFQSFPEFGAEREGAPIVAYTKISDMPIKNYSQIEEPDAVVVLDPTLFSVNFLNGLKSDGYLIVNYPGDPKQLREELKPGIKVFTVDATKIALETLKRPITNTTMAGALVKATGILNFEDVVNEMIRSFSGKFKQEIIDANVNAIRRAYEEVKQ.. 190
192 6.000e-72JGI.Meta 7068880265 C2396690__gene_231762 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  27  5........EMILAGFGGQGILFTGKILAFAAMLKDKKLSWLPSYGPEMRGGTANCHVIIDDEPIGSP-IVTRPNILVAMNKPSLDK-FENTVSDGGYVFIDTSLID---RRTEREDVNEICVNATETAHNIGNKGLANMVMLGAVLKKTELFTIDEIEYTMKKSLPE-NKHKLIEMNIKAVKEGYNLV.... 178
193 6.000e-72gi|653038368|ref|WP_027290054.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Rikenella microfusus]  clstr ali  25  1...MKE--EIIIAGFGGQGVLSMGKILAYSGVMQGQEVSWIPSYGPEMRGGTANVTVILSDRKISSP-VVQEFDTGIVLNQQSLDK-FEDSIKPGGTLLYD---PNGITHPPHRTDLDVYTIDAAVEAARSGNAKVFNMFVLGAFLKIKPLVTVENVIEGLRHSLPER-AHKMIPANEEALRKGMELVKKAE 181
194 6.000e-72gi|547372807|ref|WP_022063532.1| 2-oxoglutarate ferredoxin oxidoreductase gamma subunit [Alistipes sp. CAG:157]  clstr ali  25  1...MKE--ELIIAGFGGQGVLSTGKILAYSGVMQDYEVSWLPSYGPEMRGGTANVTVIISDKPISSPTLQTF-DTAIILNQQSMDK-FESQVKPGGVLIYDTN---GITRHPQRKDIKIYVIDATEEAAKRGNSRIFNTLILGGYLKVRPIVTLENVYKGLKKSLPERAWKSL-PMNEEAIRIGMDIIKEIQ 181
195 6.000e-72 GL0012835 [Complete] locus=scaffold64011_2:991:1545:-  ali  29  1..MKTER--IIFAGFGGQGVMSMGQMLAYAGMIENKHVTWCPSYGPEMRGGTANCSVVVSDELVGSPLISHDATAAVIMNLPSLTK-FEKDILPGGVLLINSSLIE---KKSERDDIKVAYVEANKIAGDLGNSRAANMVMLGALLSLDNIVSFESIQQAFIKVFGER-KKEFLPGNEKALNAGAESVK... 180
196 6.000e-72 GL0087878 [Complete] locus=scaffold89761_1:690:1271:-  ali  47  1...MNNGLEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEVIRVHSNIYTPGLVVVVDETLLHVDVTAGLKEDGAIIVNTPKSADEIKPLNGYQGKVYTVDARKISIQALGKYFPNSPMLAAAVAVSGVMKKDAFISEMRASYQHKFKPEVIDGNMQALELTYEELKDV. 192
197 6.000e-72 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2  ali  48  1...MNNGLEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEVIRVHSNIYTPGLVVVVDETLLHVDVTAGLKEDGAIIVNTPKSADEIKPLNGYQGKVYTVDARKISVQALGKYFPNSPMLAAAVAVSGIMKKDAFISEMRASYQHKFKPEVIDGNMQALELTYEELKDV. 192
198 7.000e-72gi|500684840|ref|WP_011973989.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanococcus aeolicus]  clstr ali  45  1......MIEVRFHGRGGQGAVTAAQLLAKATFIDGNFAQAFPFFGVERRGAPVIAFTRIDDKKIRIRSQIYEPDYVVVQDPSLLDIDVKSGLKEGGKIIINTTKDIKF------EGYDVFCVDATGIALDVLGLPIVNTSILGAFAGVTGEVSIEALKEAIMDSFPKK----LAEKNAKAAEVAYNAVKK.. 175
199 7.000e-72gi|545418115|ref|WP_021657033.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Clostridiales bacterium oral ta  clstr ali  28  5........EILFAGFGGQGILSMGKFLAYAGMDAGLNVSWLPSYGPEMRGGTANCSVILAEDPVGSP-IVNEATTLVVMNRPSLDK-FEDAIKPNGLLIVDSDLVN---RLPERNDVEVISIPAQSIAEEIGSKTIANMVLLGALVAKTGIVSMEDLLKALKE----HGKEKFYEANKKALEKGAEYA.... 175
200 8.000e-72gi|547218159|ref|WP_021958325.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Brachyspira sp. CAG:700]  clstr ali  28  1..MKTER--IIFAGFGGQGVMSMGQMLAYAGMIENKHVTWCPSYGPEMRGGTANCSVVVSDELVGSPLISHDATAAVIMNLPSFTK-FEKDILPGGVLLINSSLIE---KKSERDDIKVAYVEANKIAGDLGNSRAANMVMLGALLSLDNIVSFESIQQAFIKVFGER-KKEFLPGNEKALNAGAESVK... 180
201 8.000e-72gi|547471567|ref|WP_022090269.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:492]  clstr ali  46  1...MNDLIEIRWHGRGGQGAKTACLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSAIYEPNYVVVVDDTLLDVDVTAGLKEDGAIVINTTNDAKTLKKKLGYKGGIYTIDARSISIDALGKYFPNTPMLAAIVKVSGVIPEEQFLADMEGSFKHKFKPEVIDGNMKALKNTLEKVNKIQ 193
202 8.000e-72gi|547712965|ref|WP_022129508.1| putative uncharacterized protein [Bacteroides sp. CAG:530]  clstr ali  24  4........EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDTRISSPILSKY-DTAIILNQPSLAK-FEDKVKPGGVLIYD---GYGIIEPPTRKDIHVYRIDAMDEANERKMAKTFNMIVLGGLLKIRPIVSIESVVKALRKTLPERH-HNLIPMNEEAIRIGMDIIKKM. 180
203 9.000e-72 GL0093698 [Complete] locus=scaffold8233_8:8447:9076:-  ali  45  9...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDTIRVHSNIYHPDYVVVVDETLLSVDVTAGLKKTGAIIINTPKSKEEVMDELGYEGRVYTVDARKISVETLGKNFPNSPMLAAAVAVSDIMPRDKFIHEMRASYEHKFKPEVIDGNMKALERAYDVVEEA. 200
204 9.000e-72JGI.Meta 7027895214 SRS021948_Baylor_scaffold_926__gene_997 ketoisovalerate oxidoreductase subunit vorA [Human Stool microbiome from visit n  ali  28  1...MKK--EIIIAGFGGQGVLSMGKILAYAGLMDDLEVSWMPSYGPEQRGGTANVTVILSDQPISSPVLDTY-DVAVILNQQSLDK-FESRIKPGGILIYD---PYGIHHKPTRSDIKIYEVNGMDAAIDMKNSKTYNMILLGALLAIVPIVPVESVMKGLQKVLPERH-HHLLPLNRDAILRGMSLV.... 177
205 9.000e-72 GL0122785 [Complete] locus=scaffold19209_1:595:1131:-  ali  26  5........EMILAGFGGQGILFTGKILAFAAMLKDKKLSWLPSYGPEMRGGTANCHVIIDDEPIGSP-IVTRPNILVAMNKPSLDK-FENTVSDGGYVFIDTSLID---RRAEREDVNEICVNATETAHNIGNKSLANMVMLGAVLKKTELFTIDEIEYTMKKSLPE-NKHKLIEMNIKAVKEGYNLV.... 178
206 9.000e-72 GL0114960 [Complete] locus=scaffold35126_3:587:1144:+  ali  23  4........EIIIAGFGGQGVLSMGKILAYSGLMEGKEVSWMPSYGPEQRGGTANVTVILSDDRISSPVL-NEYDIAIILNQPSMDK-FENKVKKGGIIIYD---GYGIHTPVKRTDVSVYRVDAMDAATEMKNEKAFNMLILGGLLKIVPMVKLENVLLGLKKSLPERH-HKLIPMNEAAIKKGMEIIQ... 178
207 9.000e-72gi|495666227|ref|WP_008390806.1| pyruvate synthase [Clostridium sp. SS2/1]  clstr ali  47  1...MNNGLEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDKVIRVHSNIYTPGLVVVVDETLLHVDVTAGLKEDGAIIVNTPKSADEIKPILGYQGKVYTVDARKISVQALGKYFPNSPMLAAAVAVSGIMKKDAFISEMRASYQHKFKPEVIDGNMQALELTYEELKDV. 192
208 9.000e-72 GL0008767 [Complete] locus=scaffold82734_1:6935:7474:+  ali  22  1...MKE--EMIIAGFGGQGVLSMGKILAYSGLMDDKEVTWMPSYGPEQRGGTANVTVILSDDRISSPILNMY-DTAIVLNQQSLDR-FESQVKPGGVLIYDS---YGIHNPPTRTDINVYCINAMEASFEMKNGKAFNMIVLGAYLKIKPVVSIENVLAGLKKAIPERH-WNLIPLNEEALKKGMSLVKE.. 179
209 1.000e-71gi|652836142|ref|WP_027118816.1| pyruvate synthase [Lachnospiraceae bacterium YSB2008]  clstr ali  47  1...MRKHIEIRWHGRGGQGAKTAALLLADVAWSTGMYVQGFPEYGPERMGAPITAYNRIGDTEIRAHSNIYYPDYVVVVDETLLHVDVTKGLSKDGGILINTEKSKEEIVSLLGYEGKVYTIDARKISMETLGKYFPNSPMLAGIVKVANIMEKDEFLSQMEASYQHKFKPEVIEGNMQALRRAFEEVQ... 190
210 1.000e-71gi|571052250|gb|AHF25916.1| pyruvate synthase subunit PorC [uncultured bacterium Contigcl_1539]  clstr ali  44  1...MNIM-EIRWHGRGGQGAKTASLLLADAAFMAGKYVQSFPEYGPERSGAPITAYNRISDERCSIHSNIYEPDYVVVVDETLLEVDVTAGLKEEGGIVINSAKSAAELKPLLGYQGKVYTVDAGTISRKHLGDYFPNTPMLAAIVAISGCVEKETFLKDMEEAYTHKFKPQVIKGNLDCLAEAMQAVRE.. 190
211 1.000e-71JGI.Meta 7058172480 SRS049959_WUGC_scaffold_12288__gene_23431 2-oxoglutarate ferredoxin oxidoreductase, gamma subunit [Human Stool microbiom  ali  25  4........EILLAGFGGQGILFMGKMLAYFGLYENKEVSWLPSYGPEMRGGTCNCSVCVSDDPIGSPL-VDSPNTLIVMNTPSYDK-FIGSVVPGGTVIIDSTLVDA---KCDRTDINVYYVPATALANEHDMKGLANIILVGKLLKETNLTSMETVKKAMEKVIPPK-KAHLIDANIKAIELGM....... 174
212 1.000e-71gi|547008725|ref|WP_021909771.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Prevotella sp. CAG:755]  clstr ali  25  1...MKE--EIIISGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEPISSPILSRY-DTAILLNQPSLEK-FEPKVRPGGTLIYD---GYGIADPPTRADIEAWRIDAMDAAAELKMMKCFNMFVLGALLKLHPIVSVSNVMQALRKTLPERH-HDLLPLNEQAILKGMELVR... 178
213 1.000e-71gi|489612742|ref|WP_003517183.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Ruminiclostridium thermocellum]  clstr ali  26  1MKMADQ--QIIMAGFGGQGILSAGRILAYAGMLENKNVSWLPSYGPEMRGGTANCNVIISDDVIGSP-ILNSATTLIVMNGPSLDK-FESYVESGGIIIKDSSLVQ---REPARTDVKVYGVPATETAFKMGNPTFANIILLGKLIALTNIVSKENFEIALRKTLPSK-KHNLIPEEMKALEFGMQY..... 179
214 1.000e-71gi|651364146|ref|WP_026476492.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Alkaliphilus transvaalensis]  clstr ali  26  1......MTEVILAGFGGQGVMSMGQLLTYAGMIENKQVSWLPSYGPEMRGGTANCAVIVSKSPVGSPIITTDATAALVLNLPSLLK-FEDSIVANGNLLINSSLIEE---KAKRSDLNAYYIPANDIANEIGNSRVANMVMLGAYLELTKVVSVDSVIEALKKVFGP-DKQHLVPLNKEALDRGAAAVK... 179
215 1.000e-71gi|653208452|ref|WP_027424948.1| pyruvate synthase [Lachnospiraceae bacterium NC2004]  clstr ali  42  1...MKDTVEIRWHGRGGQGAKTAALLLADVCFKHGKNVQGFPEYGPERMGAPITAYNRISDKKLRVHSNIYDPDYVVVVDETLLEIDVTAGLNPEGAIVINTTRPKEEIIPHLGYEGKVYTLDARKISEEALGKYFPNSPMLAAIVAVSKVMEKDEFMTQMRDSYQHKFKPEVIDGNMKALEMAFTEV.... 189
216 1.000e-71 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2  ali  45  14...MKKNIEIRWHGRGGQGAKTAALLLADVAFNTGMHVQGFPEYGPERMGAPITAYNRIGESEIRVHSNIYHPDYVVVVDETLLHVDVTNGLKEDGAIVINTPRPKEEILPLLGYKGSVYTIDAHKVSMETLGKYFPNSPMLAAIVKVADIMDKDVFLSQMQASYEHKFKPEVIDGNMRALKMAFEEVK... 203
217 1.000e-71gi|502879133|ref|WP_013114109.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Brachyspira murdochii]  clstr ali  27  6.........IIFAGFGGQGVMSMGQMIAYAGMIENKHVTWCPSYGPEMRGGTANCSVVVSDELVGSPIISHDANAAVIMNLPSLTK-FEKDVLPNGILLINSSLID---KKASRDDIKVAYVEANKIAGDIGNPKSANMVMLGALLTLQNVVSFDSVQQAFLKVFGER-KKDFLPSNEKALNAGRDAVK... 180
218 1.000e-71gi|547282151|ref|WP_022015523.1| pyruvate ferredoxin oxidoreductase gamma subunit [Clostridium sp. CAG:122]  clstr ali  43  1...MNNGIEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAYNRISEDKIRIHSNIYTPDYVVVVDETLLDVDVTAGLKKDGAIIINTPKSRDEIKKLNGYEGKVYTVDARHISVKTLGKNFPNSPMLAAVVAVSNVMPRDTFIREMRASYQHKFKPEVIDGNMEALEMTFD...... 187
219 2.000e-71gi|548304730|ref|WP_022495732.1| 2-oxoglutarate ferredoxin oxidoreductase gamma subunit [Ruminococcus sp. CAG:624]  clstr ali  25  2......TTEILLAGFGGQGVLFAGKILAYCGLMDSKELSWLPSYGPEMRGGTANCSVCISDEPIGSPL-VLTPDILIAMNQPSFDK-FINSVKPGGIALIDSTLIE---SKCERTDITCFYVPSSQLADDNNLKGGSNIILLGKLLKETNICSLDTMKKAIEKVVPP-SKAHLIQNNFKAIELGMNA..... 176
220 2.000e-71JGI.Meta 7073746025 SRS023468_LANL_scaffold_12683__gene_26332 hypothetical protein [Human Posterior fornix microbiome from visit number 1 of  ali  26  3.......TEIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERISSPILSMY-DIAIVLNQPSLDK-FMPKVKPGGILIYD---GFGIMDKPNRDDITIYRIDAMDKAAEMKNSKVFNMIVLGGLLKVAHVVSTDGINKALFKTLPERH-HGLIPLNMEALGVGMDIIKKV. 180
221 2.000e-71gi|503068627|ref|WP_013303596.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Ignisphaera aggregans]  clstr ali  45  1..MSLKRIEIRWHGRGGQGAITASMILAEGAIYQGKYAQAYPEFGAERRGTPTRAYTRISDEPIYSRAPIIHPDVVVVLDPTLDKSLYMGGLKSNGILVMNTKRSAKEVRDIIREDIRIVRVDATRIALEILKTPIVNMAMIGALLKSVPVVDMHYVEEAIKENF----RPKVAEANILAMKRAFEEAE... 184
222 2.000e-71gi|655444080|ref|WP_028828476.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Proteocatella sphenisci]  clstr ali  26  1..MENK---VICAGFGGQGVMSMGQLLAYAGMIEDKHVSWLPSYGPEMRGGTANCAVTVSDEEISSPVITNDADIAIVMNLPSLTK-FEKDVKPGGKIFINSSLIE---KKVERTDIQAYYIDANKLAADIGNIKAANLVMLGAVLKANQIVDVESILEAFKKVFGP-SKEKFIPQNREALIKGGESI.... 178
223 2.000e-71JGI.Meta 7018926684 SRS022609_Baylor_scaffold_86040__gene_153426 hypothetical protein [Human Stool microbiome from visit number 2 of subject  ali  26  1...MKE--EILIAGFGGQGVLSMGKILAYAGLMSGLEVTWMPSYGPEQRGGTANVTVIVSDSPISSPVLDSY-DTAVLLNQQSLDK-FENKVKPGGTLIYD---PSSIHRLPARTDIAIVAIDAMTAAIEMNNAKTYNMILLGALLKRRPIVSVDAVIKGLKKTLPERH-HHLIPLNEEAINRGMSLV.... 177
224 2.000e-71gi|502259056|ref|WP_012744891.1| pyruvate synthase [Kosmotoga olearia]  clstr ali  64  1..MPEKYFEVRWHGRAGQGAKSASQLLAEAALEAGMYAQSFPEYGAERSGAPMKAFNRISDVPIRVHHTVENPDIIVIVDDTLLGSAITEGVKEDTVMIVNTVRGSNFVREKTGFKGKIFTIPATDIALEEIGRGIPNTVMIGALLKASNDIPLDAVLNRVKKMFSGKLTEEKIEANLRAVRRGYEEVK... 189
225 2.000e-71gi|696592531|ref|WP_033118463.1| pyruvate synthase [Intestinimonas butyriciproducens]  clstr ali  43  1..MSKQMTEIRWHGRGGQGAKTACLLLADAAFSSGKYVQGFPEYGPERMGAPITAYNRISDVPCTIHSNIYQPDYVVVVDESLLSVNVTAGLSPEGAVLINSPKAPGALRPLLRYSGGVYTVDARRLSEQYLGGYFPNTPMLAAIVQVSRVLEPDQFAADMEASFRHKFKPQVIEGNMKCLLQSMKEVR... 191
226 2.000e-71gi|506329934|ref|WP_015849653.1| pyruvate/ketoisovalerate ferredoxin oxidoreductase subunit gamma [Thermococcus sibiricus]  clstr ali  45  2......MIEIRFHGRGGQGAVTAANILAEGAFLEGKYVQAFPFFGVERRGAPVTAFTRIDEKPIRIKTQIYEPDVVVVLDPSLLDVDVTAGLKEGGLVIVNTEKTKEEVEKLKKKPAKLALVDATTIALEILGLPITNTSILGAVAKATGIVKIESVEEAIKEAFSG----ELGEKNAKAAREAFEKTVVYE 185
227 2.000e-71gi|697632696|emb|CEA15173.1| 2-oxoglutarate oxidoreductase, gamma subunit [Porphyromonadaceae bacterium ING2-E5B]  clstr ali  26  4........EIVIAGFGGQGVLSMGKILAYSGIMEGKEVSWFPAYGPEQRGGTANVTVIISDEPISSP-VVNNYDVAIVLNQPSLDK-FQDKVKPGGILIYD---GYGINNKVQRTDINIYRINAMDESVKMENSKVFNMIILGGLLKISSMLKIENVMKGLKETLPERH-HYLLPINEKAIIRGMEVVE... 178
228 2.000e-71JGI.Meta 7016948985 SRS052697_LANL_scaffold_73088__gene_156732 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate  ali  43  1...MNNGIEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAYNRISEDKIRIHSNIYTPDYVVVVDETLLDVDVTAGLKKDGAIVINTPKSRDEIKKLKGYEGRVYTVDARHISVKTLGKNFPNSPMLAAVVAVSNVMPRDTFIREMRASYQHKFKPEVIDGNMEALEMTFD...... 187
229 2.000e-71gi|490169788|ref|WP_004068429.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase, gamma subunit [Clostridium sp. ASF502]  clstr ali  44  1...MRNLTEIRWHGRGGQGAKTAALLLADVAFQTGKYVQGFPEYGPERMGAPITAYNRISDQPIRVHSNIYDPQYVVVVDESLLEVDVTAGLKKDGAILINTRRTKEEIPHLKGYEGEVYIIDAHKVSMATMGKYFPNTPMLAAIVKVAGIMEEETFLREMQASFSHKFKPEVIEGNMAALKMALQEVR... 190
230 2.000e-71gi|503592337|ref|WP_013826413.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanobacterium paludis]  clstr ali  42  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYCQAFPFFGVERRGAPVMAFSRIDDQPIRRRYQVYKPNYVIVLDDGLLEVDVFSGIKDGGKIIINTTSDVKTV-----DGAEVQKIDATGIALEILGVPIVNTVMLGAFAGLTGEISLESLIKIIKETFSGKIG----EKNAKAATIAYNKVRE.. 176
231 3.000e-71 GL0028706 [Lack 5`-end] locus=scaffold106782_2:1132:1731:-  ali  45  8....ENLVEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPIVIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTVKDADYLKKLKGYKGGIYCIDARKVSEEALGRYFPNTPMLAAIVKVANIMDEKDFLNDMKGSFKHKFKPEVIEGNMKALEMALNEVKK.. 197
232 3.000e-71gi|547913341|ref|WP_022316210.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase gamma subunit [Prevotella sp. CAG:592]  clstr ali  25  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERISSPVLSKF-DIAIVLNQPSLDK-FESRVKPGGILIY---EGNGIISPPTRTDIDIYRIDAMDKAAELKNTKVFNMIVLGGMLKVSPVVSENGVEKALFKTLPERH-HKLIPLNMEAIKIGGDIMQK.. 179
233 3.000e-71 GL0144139 [Complete] locus=scaffold92103_1:10565:11101:-  ali  25  1...MKE--EIVIAGFGGQGVLSMGKILAYAGLMDNLEVSWMPSYGPEQRGGTANVTVILSDSRISSPVLDTF-DTAVILNQQSLDK-FESRVKPGGTLIYD---PYGIHHAPTRTDIRIVPVEAMEATFEMKNAKTYNMILLGALLACRPVVSLDAVIRGLRKTLPERH-HHLIPLNEEALRKGMALVK... 178
234 3.000e-71 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and rela  ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYAAMLEGKEVSWMPSYGPEQRGGTANVTVIISDERISSPILSKY-DTAVILNQPSLDK-FESQIKPGGTLIYD---GYGITIPPSRKDIRIYRIDAMDAAAELKLGPAYNMVVLGGLLKARPIIQTEHVTNALRKTLPARH-QHLIPVNEKALLKGMSIITE.. 179
235 3.000e-71gi|699061895|gb|KGM45478.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Bacillus niacini]  clstr ali  26  4........EIIIAGFGGQGVMSMGQLIAYAGMLEGKGVSWLPSYGPEQRGGTANCSVVVSDEPVGSPL-VTSPSTAIVLNNPSFEK-FEHRVRPGGLLISNSSLV---TRASKRCDIEIIEITATDMASDLGNTRVANMILLGAYLGFTKVVTCDSIIESLKKVLPE-EKHHLIEVNKQALNKGASMI.... 177
236 3.000e-71gi|516484378|ref|WP_017872822.1| hypothetical protein [Candidatus Caldatribacterium saccharofermentans]  clstr ali  46  1...MEKPLEIRWHGRGGQGVVTASRILADALLREGKYFQAFPEYGPERMGAPVKAYNRVSSTPIRIHSGVTSPEMVVVVDPTLLGVDVLEGLAENGTVVANFPGTPGDLRNLLHFSGTVVVVDASRISREILGRVVVNTPILGALCRVLPEVKLENILEAVKAQFGEKLRAEVVEKNLACLRRAYEEAQ... 188
237 3.000e-71gi|649360500|gb|KDR94468.1| ketoisovalerate oxidoreductase subunit VorA [ [[Clostridium] litorale DSM 5388]  clstr ali  24  5........KIISAGFGGQGVMSLGMLITYAGMLEKKEVSWLPSYGPEMRGGTANCSVIVSDQPVGSPIITNDATTAVIMNLPSL-VKFEKDVAPGGKIFINSSLIS---QKVERDDVEVYYVPCNDIAIELGNPKVANMVMLGAYLEVTGIVATDSILEAFKKVFGP-SKEKFIPLNTEAIKKGQEAIKVA. 182
238 3.000e-71gi|494007467|ref|WP_006949929.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella marshii]  clstr ali  27  1...MKK--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDDRISSPILSSY-DVAIVLNQPSLDK-FESKVKTGGILIYD---GFGMLHPPTRTDIEVYRIDAMDKVAEMKNSKVFNMVVLGGFLRVCPIVTESGLEKALRKTLPERH-HRLIPLNMTAVEAGKTLIQREE 181
239 4.000e-71gi|546379562|ref|WP_021853315.1| keto/oxoacid ferredoxin oxidoreductase gamma subunit [Prevotella sp. CAG:255]  clstr ali  26  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTCNVTVIVSDERVSSP-IVSEYDVAIVLNQPSLDK-FEPKVKKGGFLIYDTS---GIINPPKRTDITVCPIAAMDKAVEMKNSKVFNMIVLGGLLKVCPVVSDKGVEKALYKTLPERH-HGLIPLNMEAITAGKEII.... 177
240 4.000e-71gi|547178254|ref|WP_021920713.1| pyruvate ferredoxin oxidoreductase gamma subunit [Firmicutes bacterium CAG:114]  clstr ali  44  1.MKENGLVEFRWHGRGGQGAKTACLLLADAAFSSGKFVQGFPEYGPERMGAPITAYNRISDTRCSIHCNIDCPDYVVVVDETLLDVDVTKGLSPTGAVIVNTAKSPGEIRGKLRHTGPVCTIDARRISEETLGRNFPNTPMLSAAVRVSGVLEEERFKQDMEESFHHKFKPQVVAGNMAALMQAWEEVQV.. 193
241 4.000e-71JGI.Meta 7021036349 C782953__gene_56203 hypothetical protein [Human Posterior fornix microbiome from visit number 2 of subject 159005010] :_  ali  24  2......TYEIVIAGFGGQGVLSMGKTIAYSGMMEDKEVSWMPSYGPEQRGGTSNVTVIVSDEKVSSPVLNSY-DIAITLNQPSLDK-FAPRVKKNGILIY---EPNGIHTITDRKDINIYEVDATEIANAMGNDKLFNMIILGGLLKLVPFVKYESVITGLKKSLPERH-HKLIPLNEEAIKRGMEAIK... 178
242 4.000e-71gi|491472799|ref|WP_005330552.1| pyruvate synthase [Dorea formicigenerans]  clstr ali  46  1...MSNHTEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEVIRVHSNIYDPEFVVVVDESLLEVDVTAGLKKEGAILVNTARPKEEIPHLKGYEGKLYTIDAHKVSMEAMGRYFPNTPLLAAIVKVANIMDEETFLREMQASFKHKFKPEVIDGNMKALEMALKEVK... 190
243 4.000e-71gi|517532994|ref|WP_018703202.1| MULTISPECIES: hypothetical protein [Veillonellaceae]  clstr ali  26  1...MSQTHEIIMSGFGGQGIMLMGQLLTYAGMLEGKEVTWIPSYGPEMRGGTAYCSVIVSEDPIGAP-MVSEPSMVVAMNLPSLTR-FEGALQKGGTLIINSSLID---KDATRKDINVFKVPVNEIAAELGNPKVGNMVMLGAIIAAAEPVKTESMLGAFKKMFEKKFKPDLFKINEAAIQRGADFIKK.. 184
244 4.000e-71gi|503409432|ref|WP_013644093.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanobacterium lacus]  clstr ali  44  1......MIEVRFHGRGGQGAVTAAEILAKAAFEDGKYCQAFPFFGVERRGAPVMAFTRIDDKPIRRRYQVYNPDYVVVLDDGLLEVDVFSGIKEGGNVIINTNNGVENSN-----GVKINKIDATGIALDILGVPIVNTILLGAFAGVTGQVSIESLIKIINETFSG----SVAEKNVKAAKMAYDAAKK.. 176
245 5.000e-71gi|652814460|ref|WP_027105853.1| pyruvate synthase [Lachnospiraceae bacterium V9D3004]  clstr ali  46  1...MEKTVEIRWHGRGGQGAKTAALLLADVSFKAGKYVQGFPEYGPERMGAPITAYNRISDNKITVHSNIYDPDYVVVVDEGLLDIDVTAGLSPEGAIVINSAKKPEELASKLRYTGKIYTVDARKISVEALGKYFPNSPMLAAIVAVSGVMDRDQFLNEMEASYRHKFKPEVIEGNMNALRMTFEEV.... 189
246 5.000e-71gi|547303460|ref|WP_022035698.1| pyruvate ferredoxin oxidoreductase gamma subunit [Roseburia sp. CAG:50]  clstr ali  43  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYNRISSDVIRVHSNIYDPDFVAVVDETLLHVDVTAGLKKEGAIIVNTAKSKEEIPQLNGYEGRVVTIDARTISEEALGKYFPNSPMLAAVVATTGVMPKETFLHEMRASYKHKFKPEVIDGNMKALEMAFAAVEEA. 192
247 5.000e-71 GL0104083 unmapped_[Complete]_[mRNA]_locus=scaffold786056_1:116:649:+  ali  26  2.....KTANILLAGFGGQGILFAGKFVAYSGLYEDKEISWLPSYGPEMRGGTSNCSVIISDTPIGSP-IVNNPDILLAMNMPSLDK-FENAVNPGGKIFVDSTLVE---RKVNRTDVDVYYVPATKMAADAGMPTLANMILVGKIIKETGIVSFDNMDGVLKKVVSAK-KQDLLDLNKKALDLGYNF..... 177
248 5.000e-71gi|519103677|ref|WP_020259552.1| MULTISPECIES: hypothetical protein [unclassified Aminicenantes]  clstr ali  27  4........EMIFAGFGGQGVLSMGELLAYAAMKEGKNISWMPSYGPEKRGGTANCMVNISDQQISSP-IVSEYDAAVVLNLPSLKK-FESRVKKGGILIWESSNIKE---PPTRKDINIYALPAYEIAKDLNNIKVMNMIMLGALVKLNKLVKTESLLLALKETLPERH-HHLIPLNKKAIEIGMGLVQ... 179
249 5.000e-71gi|490986969|ref|WP_004848702.1| pyruvate synthase [Coprococcus eutactus]  clstr ali  45  15....KDTIEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISSEPIRVHSNIYEPQYVVVVDESLIEVHVTAGLAEDGAIIINTPKTPDEVRPLKGYKGRVYTLDAKEISLKTLGKNFPNSPMLAAIVAVSGIMEEGPFLEDMRQSYQHKFKPEVIEGNMEALKLAFREVMK.. 204
250 5.000e-71JGI.Meta 7053805477 C2705071__gene_138870 2-oxoglutarate oxidoreductase, gamma subunit [Human Tongue dorsum microbiome from visit number 2 o  ali  25  8.KAMKK--EFIIAGFGGQGVLSMGKMLAYTGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDSRISSPILSKY-DVAVVLNQPSLDK-FEPKVKEGGILIYDGN---GIINPPKRKDIQVYRIDAMKKAIELKNAKVFNMIVLGGMLKVCPIVSVQGLEKALFKSLPERH-HHLIPLNMKAVNVGLESIEQ.. 188
251 6.000e-71gi|496509701|ref|WP_009217984.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Bacteroidetes oral taxon 274]  clstr ali  26  1...MKK--EIIIAGFGGQGVLSMGKILAYSGLLEGKEVTWMPAYGPEQRGGTANVTVQISDKKISSP-ILKFYDIAIVLNQPSMDK-FEERVKPGGILIYDSN---GMTRKPNRKDISVYRIDATDKALEMGAQKTFNMIVVGGLLKADPMVKTENVMLALKKSLPERH-HKLLPANEEAMKVGMQIIEK.. 179
252 6.000e-71gi|656326631|emb|CDN30119.1| 2-oxoglutarate oxidoreductase, gamma subunit [Rikenellaceae bacterium M3]  clstr ali  23  1...MKE--EIIIAGFGGQGVLSMGKILAYAGVMHNQEVSWYPSYGPEMRGGTANVTVILSERKISSP-VIHEFDTAIILNQQSLDK-FEEMIKSGGVLLYD---PNGITHPPKRKDIIVYTIDATAQAAEMGNVKVFNMIVLGAYLKIKPVVTIDNVIEALRKSLPER-AHKLIPDNERAIVRGMELVH... 178
253 6.000e-71JGI.Meta 7075601684 C4854629__gene_129579 ketoisovalerate ferredoxin oxidoreductase [Human Stool microbiome from visit number 1 of subject 1  ali  25  1...MKK--EIVAAGFGGQGVLSMGKILAYAGLMDDLEVTWMPSYGPEQRGGTANVTVVVSDKPISSPVLDAY-DTAVILNQQSLDK-FESKIKPGGVLIYD---PYGIHRKPTRTDIDVYPVEAMEASIELKNAKVYNMIVLGALLKVNPVVDIESVMRGLKKALPERH-HHLLPANREAILKGMELVEV.. 179
254 6.000e-71gi|673066409|emb|CDZ23764.1| Pyruvate/ketoisovalerate oxidoreductase, catalytic domain [ [[Clostridium] cellulosi]  clstr ali  25  1...MAFTHSILLAGFGGQGILFAGKVIAYAGLVDGREVSWLPSYGPEMRGGTANCSVTISDEPIGSPLII-NPSILIAMNLPSLDK-FINNVIPGGIVIVDSTLIN---KKVERTDVKTFYVPATGLADEKGLRGLANMIILGKLLKETKFADYDSVIAGLRKSVPPR-KAQLIDSNIKAIGIGMEL..... 178
255 6.000e-71gi|547210314|ref|WP_021950957.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:678]  clstr ali  45  1...MQNCVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISTDPIRVHSNIYDPDFVVVVDEGLLDVHVTDGLSENGAILINTAKDKSEIEKLHGYKGAVYTIDAKKVSKACLGRYFPNTPMLAGIVKVSGVMEWDDFYNEMRASFMHKFKPEVIDGNMNALKMAFDEVR... 190
256 7.000e-71gi|517797942|ref|WP_018968150.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella loescheii]  clstr ali  25  3.......HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDQRISSPVLSKY-DVAIVLNQPSLDK-FEPRVKPGGILIYDGN---GIASPPSRTDIKVYRMDAMDKAAEMKNAKVFNMIVLGGLLKVCPVVSTEGLNKALFKTLPERY-HNLIPLNMEAVEQG........ 173
257 7.000e-71gi|497238876|ref|WP_009553135.1| 2-oxoacid:acceptor oxidoreductase subunit gamma [Burkholderiales bacterium JOSHI_001]  clstr ali  39  1......MLQIRIHGRGGQGVVTAADMLAIAAFNQGRHAQSFPSFGSERTGAPVVAFCRIDDREIRLREPILSPDVLIVQDPTLLHVDVFQGLKPDGYVLINSRKSLDELGLSERDRSHLLTVPATDIAIAHVGRPLPNAVLLGGFAALAGLISLDAVEHAIRDRFTGK----VAEGNVAAARQAFEHVRQ.. 185
258 7.000e-71gi|655059648|ref|WP_028507981.1| hypothetical protein [Ruminococcaceae bacterium AB4001]  clstr ali  28  4.......FSVIFAGFGGQGILSAGKMAAEAALYEGKEVSWFPSYGPEMRGGTANCSVVISDEPIGSP-VVNDADVVICLNQPSMEK-FEKQLKPGALMILDSSLIK---TRPERTDIKVIAMEASDIASELGKMMFAPITMLGCMATATGCFTRESFEKSLFEILPER-KHNLIPINMEAFDRGAAFAK... 179
259 8.000e-71gi|497437823|ref|WP_009752021.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit [Prevotella sp. oral taxon 473]  clstr ali  26  2......TQEIIIAGFGGQGVLSMGKILAYAALMEGKEVSWMPAYGPEQRGGTANVTVIISDENISSP-ILSNYDTAILLNQPSIDK-FQPKVKPGGTLIFD---GFGVMQPPSREDINVYSVAAMNTATEMKLAKCFNMFILGSYLKVHPIVKVESVMKALRKTLPERH-HHLLPANEQAILKGMDLV.... 177
260 8.000e-71JGI.Meta 7036419810 C2166001__gene_246668 putative 2-oxoglutarate synthase subunit [Human Stool microbiome from visit number 2 of subject 76  ali  23  17........EIIIAGFGGQGVLSMGKILAYSGIMQDQEVAWMPSYGPEMRGGTANVTVILSDERISSP-ILTKYDTAIVLNQQSMDK-FESMVKPGGTLIYD---PNGITHEPTRKDINIYKIEGTAIAAEQGNPKVFNMIVLGGFLKVKPIVKLDNVEKGLQKSLPPRH-HKMIPMNIEAIQTGMKSVEVV. 193
261 8.000e-71gi|493797514|ref|WP_006745506.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Bacteroides coprosuis]  clstr ali  23  4........EIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDKKISSPILSSY-DIAVVLNQPSLNK-FESKVKPGGVLIYEES---GIINPPTRKDIQVYRIGAIDAANEMDNSKAFNMIVLGGLLKVRPMVSLESVIKGLRETLPERH-HHLIPLNEEAINLGAKIIRQ.. 179
262 8.000e-71gi|547903150|ref|WP_022306621.1| pyruvate/2-ketoisovalerate family acceptor oxidoreductase [Roseburia sp. CAG:380]  clstr ali  44  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDKIRVHSNIYHPDYVVVVDETLLSVDVTAGLKKTGAIIINTPKSREEVMDELGYEGRVYTVDARKISVETLGKNFPNSPMLAAAVAVSDIMPREKFIHEMRASYQHKFKPEVIEGNMKALECAYDVVEAA. 192
263 8.000e-71 GL0011323 [Complete] locus=scaffold3321_7:6227:6796:+  ali  26  8.KVMKQ--EIIIAGFGGQGVLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTANVTVIVSDERISSPILSQY-DTAIILNQPSLAK-FENKVKPGGILIYD---GYGIIEPPTRKDIQIYRIDAMDAANERGIAKTFNMIVLGGLLKLRPVVAIESVLKALRKTLPERH-HHLIPVNEEAIHIGMEIIK... 187
264 9.000e-71JGI.Meta 7030216153 C7194894__gene_350911 2-oxoglutarate oxidoreductase [Human Supragingival plaque microbiome from visit number 2 of subjec  ali  26  1...MKK--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDDHISSPILSSY-DVAIVLNQPSLDK-FESKVKTGGILIYD---GFGMLHPPTRTDIEVYRIDAMDKVAKMKNSKVFNMVVLGGFLKVCPIVTESGLEKALRKTLPERH-HRLIPLNMTAVEAGKTLIQREE 181
265 9.000e-71JGI.Meta 7033891879 C5464584__gene_236464 hypothetical protein [Human Supragingival plaque microbiome from visit number 1 of subject 6048120  ali  25  4........EIIVAGFGGQGVLSMGKILAYSGIMQGQEVSWMPSYGPEMRGGTANVTVILSDTRISSP-IVQEYDTVIALNQQSLDK-FEPRVKKGGTLIYD---PNGISTPPSRTDISIYKIAAADEAAKMNNSKTFNMIVLGGLLKVKPIVELGNVEKGLTKSLPERH-HKLIPLNMDAVKRGMEIVEKV. 180
266 9.000e-71gi|503147058|ref|WP_013381719.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Eubacterium limosum]  clstr ali  27  2.....ETKKICFAGFGGQGVLSVGKLLAYAAMIKDKEVSWCPSYGPEMRGGTANCTVIISDEPIGSPVVTKNASSAVVMNEPSFRK-FENVVAPGGAMIINANLIS---LKPERTDIRTIYVPASDIAKELGNPKLMNMVLLGALLEVDHTISEEAVLEAFTKVFGE-GKAKFIPVNRQALEKGKNYAR... 180
267 9.000e-71gi|502828835|ref|WP_013063811.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella]  clstr ali  26  3.......KEIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERISSPILSKY-DIAVVLNQPSLEK-FEPKIKPGGILIYD---GFGIINKPTRKDITVYEINAMDKAAEMKNGKVFNMIVLGGLLKVAPVVSDKGVEKALYKTLPERH-HGLIPLNMEALKEGAKIIQEIK 181
268 1.000e-70gi|501164171|ref|WP_012208425.1| pyruvate synthase [Petrotoga mobilis]  clstr ali  63  1..MPEKYFEIRWHARAGQGAKSASQFLTEAAEEAGKYSSSFPEYGAERSGAPMKAFNRVADVPIRLKSNIETPDVVVVIDDTLLNSEVTSGLAEDKLLLVNTSRSIEEVRKLSGYKGRIGVIPATEIALEEIKRGIPNTVMIGALIRATDVVPLDAVKEKIKAAFSKKFSDEVVRANIRALERGYQEVKLSE 191
269 1.000e-70gi|502645577|ref|WP_012881934.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Dehalococcoides mccartyi]  clstr ali  43  1...MKHFIEIRWHGRGGQGAVTSAELIAQAAIGKGKYAQAFPSFGPERRGAPVQSFNRISDNPIRERSGISQPDIVVVLDPSLVIINVVSGLKEGGTLIINTTKPLEYFASQYGDRWKVATVDATAIAKEVLGVNIVNTTMLGALIKATALADMEAFEEPLKHRFG-----KLAAKNMAAMKKAFEEVKELK 188
270 1.000e-70JGI.Meta 7021038390 C784795__gene_58244 hypothetical protein [Human Posterior fornix microbiome from visit number 2 of subject 159005010] :_  ali  24  3.......TEIIISGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDQRISSPILSKY-DVAIVLNQPSLDK-FEEKVKPGGILIY---EGNGIINPPKRTDIQIYRINAVEKAAELKNSKVFNMIVLGGLLGVCPVVSNDGLQKALYKTLPERH-HGLIPLNMEAVEAGKSIMKK.. 179
271 1.000e-70JGI.Meta 7051336101 SRS020328_Baylor_scaffold_34651__gene_83376 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate  ali  25  2......TYNILFAGFGGQGVLFSGKLTAYAALIENKEVSWLPSYGPEMRGGTANCSVIVSDSPIGSPL-VLEPNILIAMNGPSLDK-FEKSVEPGGVIIVDSTLV---TRKVKRDDVKAFYVDATRIASEHDLKGLANVIIMGKMLKETNFTTLDILKKSVEKCVPPR-KAHLIEANIKAIEEGMKL..... 176
272 1.000e-70gi|498109903|ref|WP_010424059.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Anaerophaga thermohalophila]  clstr ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYSGVIQDMEVSWMPSYGPEMRGGTANVTVVLSDHRISSPILHSF-DTAIILNQQSLDK-FEPKVKPGGVLLYDSN---GITRHPERDDINIYRIDATEEAARMKSTKTMNMIVLGAYLKIKPIIEMENILKGLRKSLPQRH-HHLLPMNEKAIQRGKEIVSEV. 180
273 1.000e-70 GL0091528 [Complete] locus=scaffold29395_3:378:917:+  ali  25  4........ELIISGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEKISSPILSTF-DTAILLNQPSLEK-FENKIKPGGTLIYDA---FGISEPPTRTDISIYRINAMDVAAELKMMKAFNMVVLGSFLKVHPIVTIENVIKALKKTLPLRH-HNLIPLNEQAIKKGMEII.... 177
274 1.000e-70gi|490200737|ref|WP_004099229.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Acetonema longum]  clstr ali  31  2......THEMIIAGFGGQGIMVMGQLLTYAGMLEEKNVSWIPSYGPEMRGGTANCSIIVADEPIGAP-IVSESSAVVAMNLPSLDK-FESTLRPGGILIINSSLID---KQAQRTDIKIFRVPANDIANELGNAKVANMVALGALVAATKAVDTESVVKAFAKMFAKK--PELLAINKTAINRGVEQIH... 177
275 1.000e-70gi|511048272|ref|WP_016302159.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase, gamma subunit [Lachnospiraceae bacterium COE1]  clstr ali  44  1...MKDTVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISSEPITVHSNIYEPDYVVVVDESLLEIDVTKGLSKNGAVIINSEHTKEELAPLHGYEGAVYTVDAKEISIKALGKNYPNSPMLAATVAVSGIMDKDAFLGEMRALFEHKFKPEVIDGNMQALEMAFQEA.... 189
276 1.000e-70 GL0061198 [Complete] locus=scaffold77368_1:342:887:-  ali  25  4........EILLAGFGGQGILFMGKMLAYFGLYENKEVSWLPSYGPEMRGGTCNCSVCVSDDPIGSPL-VDTPNTLIVMNTPSYDK-FIGSVVPGGTVIIDSTLVDA---KCDRTDINVYYVPATALANEHDMKGLANIILVGKLLKETNLTSMETVKKAMEKVIPPK-KAHLIDANIKAKELGM....... 174
277 1.000e-70gi|491630860|ref|WP_005488398.1| Pyruvate:ferredoxin oxidoreductase, gamma subunit [Halanaerobium saccharolyticum]  clstr ali  53  1......MMQIRWHGRGGQGAKTASLLLADAAFSTGKYVQGFPEYGPERMGAPITAYNRISDDKIRVHSNIYKPDYVVVVDETLLEVDVTAGLKEEGAIVVNTAKDGEKIRKKKGYEGELFTVDAREISMATIGRYFPNTPMLSALVKVAGIMEEEDFVTEMEKLFKKKFKPEVIDGNVEAVKKALKEVNAH. 189
278 1.000e-70gi|695912667|emb|CEG29761.1| pyruvate/ketoisovalerate oxidoreductase [Bacillus sp. B-jedd]  clstr ali  26  4........EIIIAGFGGQGVMSMGQLIAYAGLHEGKNVSWLPSYGPEQRGGTANCAVVVSDEPIGSPL-VSAPSAAIVLNIPSFEK-FEPKVRAGGLLLTNSSLIG---KKSQRTDLTAIEINATAMANELGNGKVANMILLGAFIKATGILSPESVLSSLQQVLSP-DKHYLLEMNRLALNKGAEIVCEIK 181
279 1.000e-70gi|657646877|ref|WP_029451325.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Clostridium algidicarnis]  clstr ali  29  5........EIIFAGFGGQGILSMGKFIAYAGMDANMNVSWLPSYGPEMRGGTANCSVILADEPVGSP-IVTMPDSVVVMNRPSLDK-FEKTIKKGGLVILDSDLIA---REVERDDIQVIRVPAQTIAAELGSTKIANMVLLGALVAKTGIVSMEVLLGSLKD----HGKEKFFEVNKKALEKGAEYAK... 176
280 1.000e-70gi|516660753|ref|WP_018027763.1| MULTISPECIES: hypothetical protein [Porphyromonas]  clstr ali  27  1...MKKSYEIVISGFGGQGVLSMGKILAYSGLMGGKEVSWMPSYGPEQRGGTANVTVIISEEGISSP-ILNEYDVAIVLNQPSMDK-FLPMVKKGGIVLYDSNGVSHV---PERDDINVFRVDAVDESVKMNNTKVFNIIVLGGLLKVAPMVDINNIEAGLKKSLPERH-HKLIPLNLDALKRGMEIV.... 179
281 2.000e-70gi|655460747|ref|WP_028843727.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Thermotoga elfii]  clstr ali  28  1..MM--MHSIIFAGFGGQGVMLMGQVLAQAAMNQGKHTTWFPSYGPEMRGGTANCTVVVSDEPVASP-VVDTPLEVVAMNIPSLLK-FEPKLKKDGYLFINTSVID---RKPQRNDVKVIEIPANDIAEKLGNVKVANMVVLGAFVYTTKCTEVDSLIEAMKYKLSAKNS-EIIELNVKAIFEGVKHV.... 178
282 2.000e-70gi|504400645|ref|WP_014587747.1| Pyruvate:ferredoxin oxidoreductase subunit C [Methanosaeta harundinacea]  clstr ali  43  40....SRLKEIRFHGRGGQGAVTAAELIAIAAFEDKKYSQAFPAFGVERRGAPVMAFARIASEPIRIRSQIYEPDYVIVQDVTLLEVDVASGLKPEGKIIINTDRDPKDLK--LKTGAEVVTIDATRIALEKLGRPIVNTTMLGAFCGATGEVSLESVNKAILSRFSG----SLGEKNLAAIKTAYEGV.... 218
283 2.000e-70gi|503665205|ref|WP_013899281.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanosalsum zhilinae]  clstr ali  39  1......MKEIRIHGRGGQGSVTAAELLAVAAFADGKYSQAFPAFGVERRGAPVQAFTRLSDRPIRLRSQVYQPDYVIVQDPTLIEVDVANGIKDNGTIIINSEFEPEQFSFS--TGAKVMTVDATRIALDVIGRPIVNTILLGAFAAATGEIQPGSIADAVKQRFSGKIG----EKNAEAIDRAYNMTMEAK 181
284 2.000e-70gi|655457643|ref|WP_028840687.1| pyruvate synthase [Thermodesulfobacterium hveragerdense]  clstr ali  45  1......MVEIRLHGRGGQGAVTSAELIAVAAISQGDYAQAFPSFGPERRGAPVQAFARIDKNPIRSREKIYEPDVILVLDPTLPKVNITQGLKPSGIAILNSNLPEPELRKLLHNQGKIAVVDATKIAIEELGLPITNTTMLGAFLKATGLVSLEAIEQAITARFG-----RLAEKNIKALKRAIDETK... 180
285 2.000e-70gi|496146203|ref|WP_008870710.1| pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Desulfonatronospira thiodismutans]  clstr ali  42  1......MWEIRLHGRGGQGAVTSAELLARAAISREKFAQAFPSFGPERRGAPVQAFVRVDDKKIRKREKIYQPDMVLVLDPSLLDVNVAEGLKEDGIVVVNSPQDSAELKQKHNWPG-AYTVDATKIAMDILSVPITNTTMLGALLKASGILEPQDMEEVIMDRFG----PKLGPKNFEALKKAYELA.... 178
286 2.000e-70gi|516804592|ref|WP_018109468.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Bacteroides propionicifaciens]  clstr ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMEDKEVTWMPSYGPEQRGGTANVTVIVSDERISSP-IVSTFDIVVVLNQPSLEK-FESKVKPGGLLIYEESTI---INPPTRTDIKVHSIAAIDAANEMHNSKAFNMIVLGGLLKLKPMVSTEGVLKGLFKTLPERH-HHLIPVNEQAITLGGQIIK... 178
287 2.000e-70gi|695879803|gb|KGK85508.1| pyruvate synthase [Clostridium sp. HMP27]  clstr ali  45  1..MNNKLVEIRWHGRGGQGAKTASLLLAEAAFNVGMYVQGFPEYGPERMGAPITAYNRIANFELRVHSNIYEPDYVVVVDETLLKVPCTKGLKKEGAIIINSKKKPEELRELKGYEGRVYTIDAKGISEEILGANFPNTPMLAAVVKVSGVLEEKQFVEDMENSFKHKFKPHVIPKNIEALKRSLQEV.... 190
288 2.000e-70gi|640558784|ref|WP_024990317.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella albensis]  clstr ali  27  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTANVTVIISDNRISSPILSSY-DIAIVLNQPSLDK-FESKVKPGGILIYD---GFGVMNPPKRKDIKVYRIDAMDKAAEMKNSKVFNMIVLGGLLQVCPILPDKALEKALYKTLPERH-HNLIPLNMEAVGEGRKIINE.. 179
289 2.000e-70gi|501110653|ref|WP_012160247.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Alkaliphilus oremlandii]  clstr ali  28  6.........VILSGFGGQGVMSAGQLLTYAGMIENKEVSWLPSYGPEMRGGAANCAVVVSDAPVGSPVITNDATAAIVMNLPSLK--FAKNVVADGVVIVNSSLVEE---KVARDDVKTYYVPANDIALEMGNSRVVNMIMLGAYLEATKAVSVDSVLEAFKKVYGP-SKEKLIPLNKEALERGAAAVR... 179
290 2.000e-70gi|490133875|ref|WP_004034236.1| hypothetical protein [Clostridium sp. ASF356]  clstr ali  27  6.........VCCAGFGGQGVLSMGKLLAYAGMLEGKEVSWCPSYGPEMRGGTANCSIVVSDEPVGSPVITAGATASIVMNQPSYDK-FVEIVGAGGTIILNSSLIE---SKVERTDVKAFYVPANEIAKDLGNPKLANIILLGALLEVDKTVSEQAILDAFTKVFGE-NKAKFIPINKEALAKGAEYVRNQQ 183
291 2.000e-70gi|517148338|ref|WP_018337156.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Butyricimonas synergistica]  clstr ali  23  4........EIIIAGFGGQGVLSMGKILAYSGIMQDQEVAWMPSYGPEMRGGTANVTVILSDERISSP-ILTKYDTAIVLNQQSMDK-FESMVKPGGVLIYD---PNGITHEPTRKDINIYKIEGTAIAVEQGNPKVFNMIVLGGFLKIKPIVKLENVEKGLQKSLPARH-HKMIPMNIEAIQTGMNSVEVV. 180
292 2.000e-70JGI.Meta 7004878074 C3886371__gene_246334 2-oxoglutarate oxidoreductase, gamma subunit [Human Tongue dorsum microbiome from visit number 1 o  ali  24  4........EIIIAGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIISDEKISSPILSQY-DTAILLNQPSLDK-FQPKVKIGGTIIYDS---FGIIEKPKREDINNFCLDAMNTAAEMKLMKTFNMMVLGGFLKLHPIVSIESVMKALKKSLPERH-WDLLPMNEQAILKGMEIIHK.. 179
293 3.000e-70JGI.Meta 7058544087 SRS011529_WUGC_scaffold_18283__gene_34262 2-oxoglutarate oxidoreductase, gamma subunit [Human Stool microbiome from visi  ali  24  4........EIIISGFGGQGVLSMGKILAYAALMEKKEVTWMPAYGPEQRGGTANVTVIISDEPISSPILSSY-DTAILLNQPSLDK-FQSKVKTGGTLIYDS---FGIIDKPSRTDIISWHIPAMETAAEMSMMKCFNMFILGGFLKVHPIVSIESVMKALHKTLPERH-HDLLPMNEQAILKGRDIISK.. 179
294 3.000e-70JGI.Meta 7037370633 C1863691__gene_128962 hypothetical protein [Human Stool microbiome from visit number 1 of subject 160582958]  ali  28  4........EILISGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIISDENISSPVLSEY-DTAILLNQPSLEK-FEHKIKPGGILIYDT---FGISTPPTRSDINVYKIDAMDVAAENKMMKAFNMVVLGAYLKVRPILNSTDIVSALKKSLPERH-HNLIPMNEKAILKGMDLIK... 178
295 3.000e-70gi|82617390|emb|CAI64301.1| pyruvate synthase, gamma subunit [uncultured archaeon]  clstr ali  40  1......MKEIRIHGRGGQGSVTAAELLAVAAFADGKFSQAFPAFGVERRGAPVQAFTRISDSTIRLRSQIYEPDYVIVQDPTLLEVDVASGAKDDGIIIINSEFGPETFK--LDTKATIMTVDATRIALDIIGRPIVNTVLLGAFAGATGEIDPTSIQDAVKERFPGKVGKK----NAEAIQKAYDMMMEAK 181
296 3.000e-70gi|506404069|ref|WP_015923788.1| pyruvate synthase [Halothermothrix orenii]  clstr ali  43  1......MLEIRWHGRGGQGSKTASILLAKIASATGKHIQAFPEYGPERMGAPVLAYTRISDGPIHLHCQVETPDLVVVLDPTLITVDITQNLKKGGNLIINSDYEPDKIRDKLGADVNTYTIDANTISEEEIGRIFPNTPMLGAINRVVNLMDQDSFLNQAREELKKKHKPEVIEGNMRSIDMAYREVK... 188
297 3.000e-70gi|503041887|ref|WP_013276863.1| pyruvate synthase [Thermosediminibacter oceani]  clstr ali  52  1...MAKVMEIRWHARGGQGAKTAALMLAESVAAMGKYVQGFPEYGPERMGAPMLAFNRISDEPIYIHSNVINPNVVIVLDPTLIGKKITEGVPEDGIYIINTTKTPAEVREMLDKGGKIYTLDANQISLDTIGRAIPNTPMMGAFIRATGIIPFDQFMSHIKELLSKKFKPEVVEGNLKAIERAYREVKE.. 191
298 3.000e-70gi|652930914|ref|WP_027184653.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Desulfovibrio inopinatus]  clstr ali  24  1...MSLYKDVIIAGFGGQGVMLIGNLLAYAGMNHGLNVTYIPVYGPEMRGGTANCTVVVSDEEIGSP-IIQSPESVIIMNRPSLDK-FGPSLKDGGVAVINSSLVDPTLAEKDRYS--VFAVPAVDIADKIGNTRMANMVALGAYIKASNVMPLDVVKDSLENVISAHYKH-LIPKNSEALQAGYDHV.... 180
299 3.000e-70gi|503448828|ref|WP_013683489.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Archaeoglobus veneficus]  clstr ali  44  1......MLEVRFHGRGGQGSVTAAEVLAIAAFKDGKYSQAFPIFGVERRGAPVQAFCRIDEKPIKQRCQVYEPDLVVVQDATLMDVDVTAGLKEGGILLINSAKSPEEFGINSNTTVK--TIDATRLALETLGRPIVNTVMLGALAKL-GIVSLNSIVEAV----GEKFGCKLAEKNILAVKKAFEE..... 175
300 3.000e-70gi|506404391|ref|WP_015924110.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [[Clostridium] cellulolyticum]  clstr ali  26  1...MKQ-LELIIAGFGGQGILSAGRLLAYAGMLEGKNVSWLPSYGPEMRGGTANCSVVISDEPVGSPILDTT-NVLVVMNGPSLEK-FEKSVVSGGLIISDSSLVEA---KPKRTDIEFIGIPATQLASDMGNLTFANIIILGKLLAKTGIVSKESFEAALKKVLSPK-KHHMIPDEMKALVMGHDY..... 177
301 4.000e-70 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2  ali  41  1......MIEVRWHGRGGQGAFTAARLLGQAAIHEHKYVQAFPSFGPERRGAPVLAFTRIDDKKITDRSEVETCDYVVVLDDTLYGENVTKGLKDGGVLVINTTK--EASAFPKVGDYQVITIDATALALDILGRPITNVPMLAALAAASGNVSVDSVLAAIDDQLAPRIR----EKNKKLFVAAYNAVK... 178
302 4.000e-70gi|503025017|ref|WP_013259993.1| pyruvate/ketoisovalerate oxidoreductase, subunit gamma [Desulfarculus baarsii]  clstr ali  49  1......MIEVRFHGRGGQGAVTSAELMAQAAIAEGKYAQAFPSFGPERRGAPLQAFLRISDEQIRLREKIYEPDVVVVLDPSLLATNVNAGLKPDGVLVVNSAKNVEAVRGECQFNGRTAIVDASKIAEEELGVPITNTTMLGALLKAAGHVDL----KAIEKPLAARFG-RIAEKNLRALKRAYEE..... 177
303 4.000e-70gi|503554319|ref|WP_013788395.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Thermoanaerobacterium xylanolyticum]  clstr ali  27  4........KIIFAGFGGQGIMSMGLIMSYAGMMDGKNVSWLPSYGPEMRGGTANCHVTISDEPVGSP-IINEATVVVAMNRPSLEK-YEKYVVPGGKLFINTSLIKE---KAKRKDIEVYEIAANDIANELGNLKIANMVILGALIKATNITKIESTLKALVEVLGP-SKEHLVSINEKALEKGAELI.... 177
304 4.000e-70gi|504218338|ref|WP_014405440.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanocella conradii]  clstr ali  42  1......MKEIRIHGRGGQGSVTAAELIAVAAFEDGKWSQAFPYFGTERRGAPVTAFARISDKKIRVRSQIYEPDYVIVQDPSLLSVDVASGIKKDGLIIVNTEKDPSELK--MDTNATVKTIDATTLAIKILGVPIVNTALLGAFAGASGQIRLESVSKAIKERFPGKVG----EKNVEAVRQAYEMMR... 178
305 4.000e-70gi|502632755|ref|WP_012869337.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Thermanaerovibrio acidaminovorans]  clstr ali  27  1..MNTRM---IFAGFGGQGVMLMGQIISYAGMLEGKHVTWMPSYGPEMRGGTANCTVVISDQEVASP-VTNDAEVVVAMNIPSL-VKFEPAVTPNGCLLINQSVID---REPQRTDLVSVKVPCNEIAEKLGNLKVANMVMLGAVAGATGVVSKESIVKALEKKLSAGGKAALIEVNKNAIERGFETAKAA. 181
306 4.000e-70gi|640576861|ref|WP_025007208.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Marinilabilia salmonicolor]  clstr ali  24  4........EIIIAGFGGQGVLSMGKILAYSGVMQGQEVTWMPSYGPEMRGGTANVTVVLSDNRISSP--ILHADTAIILNQQSMDK-FEPLVKPGGLLLYD---PNGITRHPEREDINIYKIEAAEEAAQLKSAKTFNMIVLGAFLKIKPVVEMENVLKGLKKSLPERH-HHLIPMNEKAIQRGVEIVKEV. 180
307 4.000e-70gi|547200714|ref|WP_021941841.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:632]  clstr ali  45  1...MSHTIEIRWHGRGGQGAKTAALLLADVAFKTGMHVQGFPEYGPERMGAPITAYNRISDAPIRVHSNIYTPQYVAVVDETLLEVDVTAGLREDGAIIVNTSRPKEILPHLKGYKGSVYTVDAHKISMATLGKYYPNSPMLAAVVAITKVMEPEAFLREMELSFQHKFKPEVIAGNMEALRMTFKEVQ... 190
308 5.000e-70gi|548064186|ref|WP_022377269.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:62]  clstr ali  44  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDVIRVHSNIYHPDYVVVVDETLLDVDVTAGLKETGAIIINTPKKREDIPKLNGYKGRVYAIDARHISVETLGKNFPNSPMLAATVAVSEVMEKETFIHEMRASYEHKFKPEVIDGNMEALERAFDVV.... 189
309 5.000e-70gi|497980890|ref|WP_010295046.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Clostridium senegalense]  clstr ali  28  5........DIIFAGFGGQGILSMGKFLAYAGMDADKNVSWLPSYGPEMRGGTANCSVIVTDDEVGSP-VVTNPSTVVVMNRPSLDK-FENDLVKGGLLIIDSDLVD---REPERSDIEILKIPAQTEATKLGSSKIANMILLGALVAKTKIVTMDELLAALK----SHGKEKFFEVNKKALELGANYVK... 176
310 5.000e-70gi|503178680|ref|WP_013413341.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanothermus fervidus]  clstr ali  42  1......MIEIRFHGRGGQGAVTAAEILAKAAFYDGKYSQAFPFFGVERRGAPVLAFVRIDNKPIRIRYQVYKPNYVIVLDDKLVEVDVFKGLHEPAVVVINSK------NEIKKEGVKIYSVDATNIALETLGSPIVNTAMLGAFVGATKIIKLDSLIKAIKNSF----KDKIGEKNAKAAVKGYESV.... 173
311 6.000e-70gi|553310899|ref|WP_023055882.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit [Peptoniphilus sp. BV3C26]  clstr ali  27  3......TRKIVMAGFGGQGVMAMGQLISYAGMLEGKHVSWYPSYGPEMRGGAANCSVVVSTDPVGSP-IIAVADDVVVMNEPSLE-LFESHVKPGGNLLLNSSLVQSE---PTRKDINIYKIPVNDIAGQIGNPRVANMVMLGAYLKVTGLVEKDSIIAAFTKVYGDK-KKKLIPINEKAIGEGQNAV.... 178
312 6.000e-70gi|503062058|ref|WP_013297034.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Thermoanaerobacterium thermosaccharolyticum]  clstr ali  30  5.........IIFAGFGGQGIMSMGLIMAYAGMMDGKNVSWLPSYGPEMRGGTANCHVTISDEPVGSP-IINEATVVVAMNRPSLER-FEKHLVKGGILLINSSLIDI---GPQRSDIEVYRIPANDIANQMGNLKIANSIMIGALMSLKNIVSEDAVINAFKKVFEGK--EKLIPINIQAYNRGKESI.... 176
313 6.000e-70JGI.Meta 7011663204 SRS019601_WUGC_scaffold_45599__gene_99528 pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Human Stool microbiome  ali  26  1..MKKEY---IFAGFGGQGMLLIGKFLAMACMLDGKHVSWLPSYGPEMRGGTANCSVIVSDDPVASPL-VDMADCVVAMNRPSLDK-FESHVKPGGVLVINSSIID---RKAERDDIQVVYCDANGIAESVGNPKGANVAILGALMEKAPVVSNEILGEAIRIELGEK-KAKFLEGNMKALEAG........ 173
314 6.000e-70JGI.Meta 7068310320 C3404772__gene_245790 pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Human Stool microbiome from visit number 1  ali  27  2......THEIIIAGFGGQGVLSMGQLLVRAGLNEGKEVSWLPSYGPEMRGGAANCSVIISDEPVVAP-IVTDASCLMAMNRPSLEK-FAGSVVPGGLVLVNSSLIDI---KVERTDVTVYYIPCNDLANELGNAKVAGNIMLGAFLAATNAVQPEHVEASLEYVF--KKKQHLIELNKKAIEAGEKTIK... 177
315 6.000e-70gi|500041927|ref|WP_011722645.1| pyruvate synthase [Clostridium novyi]  clstr ali  46  1..MDKKLIEIRWHGRGGQGAKTASLLLAEVAFNTGMYIQGFPEYGPERMGAPITAYNRIANFPLRVHSNIYEPDFVVVVDESLLKVNCVAGLKKEGAIIINTKKSIDEIRKELGYEGKVYTIDARTISEETLGAYFPNTPMLAAIVKVLGIMDLDEFIEDMKDSFKHKFKPQVISKNMNALKRSLQEV.... 190
316 7.000e-70gi|503040665|ref|WP_013275641.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Thermosediminibacter oceani]  clstr ali  28  3.......VEVIMAGFGGQGIMLMGEILAHSAMLEGREVSWIPSYGPEMRGGTANCMVVVSDKRIPSP-IISSPDILVAMNKPSMDK-FTPIVKSGGIVILNKALIDE---KPARQDIEVIEVDASGIADELGNMKVANMVALGVLVGRTGVVRPETVLKSIDHFLPE-HRKNMFEINEKALMRGIEEVKK.. 179
317 7.000e-70gi|521284011|ref|WP_020448279.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family protein [Candidatus Methanomassi  clstr ali  45  3......TLEVRWHGRGGQGIVTANEILAGAALYEGKFMKAFPEFGPERMGAPIRAFARVSDEPIKVHSQVYFPDYVAVLDPTLININVLEGLKETGSLIVNNTASVSELKKTLDTDMDVHVVDASKIALETIGKPLANTAMLGALVKISGIVGLDSIIAEMQIKLGGKLPAPVVEKNVLSVKRAYEEVQ... 186
318 7.000e-70gi|489452050|ref|WP_003357379.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Clostridium botulinum]  clstr ali  28  5........QIIFAGFGGQGILSMGKFLAYAGMDANMEVSWLPSYGPEMRGGTANCSVVLSDTPVGSP-IVTKPDTVVVMNRPSLDK-FEDMVVPGGLIIIDSDLVD---RMPKRDDVKVIAIPAQSEADKISSKKIANMILLGALVKETGIVTMDEITASLKD----HGKEKFFELNKEALKAGEEYVK... 176
319 8.000e-70gi|496709728|ref|WP_009348496.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Alloprevotella rava]  clstr ali  24  4........EIIIAGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIISDEKISSPILSRF-DTAILLNQPSLDK-FQPKVKAGGTIIYDS---FGIIEKPTREDVNNFCLDAMNTAAEMKLMKTFNMMVLGGFLKLHPIVSVKSVMKALKKSLPERH-WDLLPMNEQAILKGMEIIHE.. 179
320 9.000e-70gi|548184569|ref|WP_022405627.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Prevotella sp. CAG:485]  clstr ali  27  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMDDKEVTWMPSYGPEQRGGTANVTVILSDEKISSPVLDKY-DVVIALNQQSLDK-FGPKVKPGGILIYDT---DGIHNPCHRDDITIYPIDAMGATLAIGNSKAYNMIVMGALLEVMPYLPMENVIKGLKKSLPERH-HKLIPMNEQAIEKGRELVK... 179
321 9.000e-70gi|701166276|ref|WP_033191291.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Fervidobacterium islandicum]  clstr ali  26  2......TTRMIFAGFGGQGVMLMGQILSLAGMLQGKNVTWMPSYGPEMRGGTANCTVVISNEPVASP-VTDKAEVIVAMNIPSLLK-FEPAVTPNGYLFVNQSVVD---REPVRNDINIIKVPCNEIADKLGNLKVANMVMLGAVVGATDVVDVESVFKALEKKLSG-GKATLIEINKQAILKGIEIAKE.. 179
322 1.000e-69gi|503673950|ref|WP_013908026.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Thermodesulfatator indicus]  clstr ali  45  1......MIEVRLHGRGGQGAVTSAELIAISAINQGNYAQAFPSFGPERRGAPVMAFVRISDQRIRTREKVYNPDIVVVLDPSLPTVNVTDGLKKDGWVVLNSAKDEKTLREILGFKGKLAVVDATKIAIEELGLPITNTTMLGAFLKATGLVDQEYLEEALEHRFG-----RLAEKNKAAMARAIKETK... 180
323 1.000e-69gi|545443629|ref|WP_021680891.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit [Ruminococcus callidus]  clstr ali  28  2......TTEIILAGFGGQGILFAGKILAYCGLIAGKELSWLPSYGPEMRGGTANCSVCISDEPIGSP-VVTTPDYLIAMNGPSYKK-FIDAVKPDGLVLFDNSIVEET---CERTDITAISLPATDIATNAGLNGAANMVLLGRMLAETNLFDMDTVKKAMEKCIPPK-RAHLIEANLKAIALGMAEKK... 178
324 1.000e-69JGI.Meta 7007347930 SRS016095_WUGC_scaffold_29363__gene_72915 hypothetical protein [Human Stool microbiome from visit number 1 of subject 76  ali  26  2...............GGQGVLSMGKILAYAALMEGKEVSWMPSYGPEQRGGTANVTVIISDQRISSPILSRY-DTAVILNQPSLEK-FEPCIKPGGTLIYD---GYGITEPPRRKDIAVYRIDAMDTAAELHNPKGFNMIVLGGLIKVRPLVETENVIQALKKTLPERH-HALIPMNEEALRRGMEVI.... 168
325 1.000e-69gi|500773805|ref|WP_011993303.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Fervidobacterium nodosum]  clstr ali  28  2......TTRMIFAGFGGQGVMLMGQIISLASMIEGKNVTWMPSYGPEMRGGTANCTVVVSDEPVASP-VTDKAEVVVAMNIPSLLK-FEPYVVENGYLFLNQSVID---RESKRNDINVLKIPCNEIADEIGNLKVANMVMLGAVVGATNVVSTESIFKAIEKKLSG-GKTALIEVNKQAIMRGYELAKK.. 179
326 1.000e-69gi|490130345|ref|WP_004030731.1| pyruvate ferredoxin oxidoreductase subunit gamma/delta [Methanobacterium formicicum]  clstr ali  44  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYCQAFPFFGAERKGAPVMAFSRINDKPIRRRYQVYNPDHVLVLDETLIEVDVLSGLKDGGKVIVNTK------EDLKLGDADVHTIDATGIALDILGVPIVNTVMLGAFAKIIGGVSLDSIIKITKETFPGKIG----EKNAEAAKIAFEQAK... 174
327 1.000e-69gi|653069163|ref|WP_027320351.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Bacillus sp. URHB0009]  clstr ali  28  4........EMIIAGFGGQGIMSMGQLIAYAGMLEGKNVSWLPSYGPEQRGGTANCAVVVSDTPVGSPL-VSRPSTVIVLNNPSFDK-FEPMVRPGGLLISNISLVD---RTSARKDITNIEVEATDLANELGNPKIANMILLGAYLEHCRIVQEESILESLKKVLS-KDKHHLLELNKQALRKGA....... 174
328 1.000e-69 GL0094072 [Complete] locus=scaffold11853_1:1466:2023:+  ali  23  5........EIIIAGFGGQGVLSMGKILAYSGVMQGLEVSWMPSYGPEMRGGTANVTVILSDRQISSP-IVHDYDTAIILNQQSMDK-FEPRVKPGGVLIYD---PNGVVRPPQRKDIRVYAIPATEEAARLGNIRVFNTMILGGYLKVKPVVSLDNVFRGLAKSLPERM-ASLIPANEAAIQKGMEIIRVPE 182
329 2.000e-69gi|503743892|ref|WP_013977968.1| pyruvate synthase [Clostridium sp. SY8519]  clstr ali  46  1...MSKGIEIRWHGRGGQGAKTAALLLADVAFKTGKQVQGFPEYGPERMGAPITAYNRISEEEIRVHSNIYDPDYVAVVDETLLHVDVTAGLSEQGAIIVNSPRSAREVAELPDYHGKVVTIDARKISEETLGKNFPNSPMLAAVVAVTQVMNREEFLREMRASYGHKFKPEVIEGNMRALER......... 184
330 2.000e-69gi|504669824|ref|WP_014856926.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Melioribacter roseus]  clstr ali  21  4........EIIIAGFGGQGVLSLGQILCYGGVIEDKEVSWMPSYGPEMRGGTANCITIISDSKISSP-IISKFDTLIALNQPSLDK-FENSIKPGGLLIYEASTI---LNPPKRTDIEILPVEAANEAAKLKNTRVMNMVVLGAYLKKKPVISFDTALEALKKVLPERY-HHLIPLNKQAIEKGMELAEKV. 180
331 2.000e-69gi|503484508|ref|WP_013719169.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanosaeta concilii]  clstr ali  42  1......MKEIRLHGRGGQGSVTAAEIIAVAAFEDKRFSQAFPAFGVERRGAPVMAFARIADKPIRVRSQIYEPDYVIVQDVTLLDVDVASGLKPDGKIIINTDRSGEQLK--LDTKAEVITIDATKIAMEVLGRPIVNTTMLGAFCGASGEVGLESLNKAI----SERFRGELGKKNLLAIKTAYERV.... 177
332 2.000e-69JGI.Meta 7004166933 C4167179__gene_237862 hypothetical protein [Human Stool microbiome from visit number 1 of subject 160400887]  ali  27  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMDDKEVTWMPSYGPEQRGGTANVTVILSDEKISSPVLDKY-DIVIALNQQSLDK-FGPRVKEGGILIYDT---DGIHNPCRREDISIYPVDAMGATLQMGNSKAYNMIVMGALLEVMPYLPMENVVKGLKKSLPERH-HKLIPMNEQAIEKGRELVRK.. 180
333 2.000e-69gi|500016075|ref|WP_011696793.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanosaeta thermophila]  clstr ali  44  1......MKEIRFHGRGGQGAVTAAEMIAIAAFEDGRFSQAFPAFGVERRGAPVMAFARINDKPIRMRSQVYEPDYVIVQDVTLLDVDVTGGLKSDGKIIINTDRDASALK--LNTEAEVVTIDATRIAIDTLGRPIVNTTMLGAFCGATKEVKLESLEKSILTRFSG----SLGEKNIQAVRTAYERV.... 177
334 2.000e-69gi|516840489|ref|WP_018125372.1| hypothetical protein [Desulfovibrio oxyclinae]  clstr ali  45  1......MIEIRLHGRGGQGGVTSAELLAKAAIAEGKYAQAFPSFGPERRGAPVMAFVRVDDEQIRLREKIYSPDIVLVLDPSLLDVDVAEGLSENGTVVVNSAMTPEELKEKYGFP-KVATVDANKVAMEELGVPITNTTMLGALLKASGIIGVQEMEEPIGERFGGK----LGPKNFKALERAY....... 175
335 2.000e-69gi|500775754|ref|WP_011994034.1| pyruvate synthase [Fervidobacterium nodosum]  clstr ali  69  32.......FEIRWHGRAGQGAKSASQMLAEAALDMGKYVQAFPEYGAERTGAPMKAFNRISDEPILLHSSVETPNLVVVIDDTLLNPDILAGTNEETVLIVNTVRSIEWVRQKSGFKGKICVVKATDIALEELGRGTPNTVMLGAIARVTGVIELKYVEDKIRDMFLKKFGEEVVNKNIRALHRGYEEV.... 213
336 3.000e-69gi|494109016|ref|WP_007049800.1| pyruvate synthase [Anaerofustis stercorihominis]  clstr ali  43  1...MNDCVEIRWHGRGGQGAKTAALLLADVAFQTGKYVQGFPEYGPERMGAPITAYNRISDKPVRVHSNIYTPQFVVVVDESLLSVDVTKGLREDGAIVINTTKEKEDIKHLLNYKGDIYTIDAKKVSIACLGKYFPNSPMLAAIVKVSNIMDEKLFLSEMKSSFEHKFKPEVVNGNMKALKMALKEVR... 190
337 3.000e-69gi|501384075|ref|WP_012415641.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Elusimicrobium minutum]  clstr ali  30  5.........IRISGFGGQGVVSAGILLAQAGLIDGKKVSWLPSYGPEMRGGTANCSVVIASDEVYTP-IVTAPDTVIVMNEPSLPK-FEPLLKKDGLLIINSSLIN---SKPKRTDIKVIYVPCNEIAEKLGSLKVATLVAMGAFAKATGAVSIDTIASAMKAVF-KRAKPEMLELNKKALEEGAKAA.... 177
338 3.000e-69gi|517419359|ref|WP_018590930.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Terrisporobacter glycolicus]  clstr ali  24  6.........VICAGFGGQGVMSMGQLLTYAGMLEGKEVAWLPSYGPEMRGGTANCAVTVSDKQVGSPVITDDATCAVIMNKPSMK--FVDDVVPGGHILVNSSLIDA---KVERDDVHVTYIAANELAAEIGMPKVANMIMLGACLKVTESVDIESVLQAFLKVFGER-KSKFIPMNREALQKGMDAVTTVQ 182
339 3.000e-69gi|502772381|ref|WP_013007365.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Deferribacter desulfuricans]  clstr ali  26  2......MFDCVMAGFGGQGILSAGMILAQMAVRKDLNVTWWPSYGAEQRGGTANCTVVISDEEIGSP-IVSKPNYGFIMNRPSLDK-FQPRFNTGANVIVDTSLVERE--FLTRDDINFYGINATEIANELGNTKVANMVMIGALLSVSKLFNLNEAEEALKYAIPEKY-HSLLPINRDALKTGYNEVKK.. 180
340 3.000e-69JGI.Meta 7016201163 SRS063288_LANL_scaffold_48609__gene_81403 2-oxoglutarate oxidoreductase, gamma subunit [Human Tongue dorsum microbiome f  ali  25  3.......HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDSRISSPVLSKY-DVAIVLNQPSLDK-FQPRVKPGGILIYDGN---GIASPPTRTDIKVYRMDAMDKAAEMRNAKVFNMIVLGGLLKVCPVVSTEGLNMALFKTLPERY-HNLIPLNMEAVEQG........ 173
341 4.000e-69gi|501012439|ref|WP_012065324.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Alkaliphilus metalliredigens]  clstr ali  25  5........KIIMAGFGGQGVMSMGQLLTYSGMIEEKQVSWLPSYGPEMRGGTANCAVIVSDKQVGSPIITEDATTAIVMNLPSLTK-FQNNIIKGGRILINSSLIE---QKTNRDDLDAYYIPANEIANEIGNARVANMVMLGAYLELTKTVSVDSIIEAFKKVYGP-GKQHLIPLNEEALKRGASCV.... 179
342 4.000e-69gi|494422246|ref|WP_007221274.1| pyruvate ferredoxin oxidoreductase gamma subunit [planctomycete KSU-1]  clstr ali  42  1......MIEIRVHGRGGQGSVTAAELLGFAAHSDGKYAQAFPSFGSERMGAPVQAFVRISDKPIRIRSQVYKPNYVIVQDPTLLEVNVLDGLQEDGLLLINSKKKVAELG--VNTTIKVKTIPAMEIALEVIGRPIMNTTLLGAFAAATGEISLEGIRKAIHHKFPGSVG----EKNIAAVLKAFDFIKK.. 179
343 4.000e-69gi|502730419|ref|WP_012965403.1| pyruvate/ketoisovalerate oxidoreductase, subunit gamma [Ferroglobus placidus]  clstr ali  37  1..MSFILIEVRFHGRGGQGAVTAADILAIAGFKQGYYTLSFPMFGAEKRGTPVVSFLRISDKPIVVRDEVRNPDYVVVMDPSLLDVDVLAGIKKGGMLIANYPKGSEELKEKLKEDVEIYTINATKMATEILGRPITNTAMVGAFVGATNVVKLEYVEEAIREFFEDK---DIAEKNVQLVRKAYEYMREV. 188
344 4.000e-69gi|504866582|ref|WP_015053684.1| pyruvate synthase, gamma subunit [Methanolobus psychrophilus]  clstr ali  42  1......MKEIRIHGRGGQGSVTAAELLAVAAFADSKFSQAFPAFGVERRGAPVQAFTRINDTPIRLRSQIYKPDYVIVQDPTLLEVDVASGLKDDGILIINSDFDPE--KFKLDTKAKIMTVNATKIALDIIGMPIVNTVLLGAFAGATGEIRPESIMEAVRERFPGKVG----DRNAQAIMEAYKMMEGQK 181
345 4.000e-69JGI.Meta 7016111453 C3306628__gene_248629 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  48  2....KNTVEIRWHGRGGQGAKTAALLLADVAFKAGKYVQGFPEYGPERMGAPITAYNRISDEKITVHSNIYDPDYVVVVDEGLLDIDVTAGLNPEGAIVVNSAKPSEIIPKLHGYTGKVYTVDAHKISVAALGKYFPNSPMLAAIVAVSKVMDKEQFLTEMEGSYKHKFKPEVIDGNMKALRMTLEEV.... 189
346 4.000e-69gi|547186438|ref|WP_021928344.1| putative uncharacterized protein [Alistipes sp. CAG:831]  clstr ali  23  1...MKE--EIIIAGFGGQGVLSMGKILAYSGIMQDQEVAWMPSYGPEMRGGTCNVSVILSDKKISSPILSKF-DTAIILNQQSLDK-FESRVKPGGLLVYD---PNGITHHPTRTDISIYKIDAADEAAKLGNAKAYNMIVLGAFLKVKPIVKMENVTAGLKKSLPPRH-HNLIPMNEQAIKVGMDAVVKV. 180
347 4.000e-69gi|511025661|ref|WP_016279924.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase, gamma subunit [Lachnospiraceae bacterium A4] :_  clstr ali  43  1...MKDTVEIRWHGRGGQGAKTAALLLADVAFQTGKYVQGFPEYGPERMGAPITAYNRISASPITVHSNIYEPDYVVVVDESLLDIDVTKGLSPKGAVIINSTRSKEEIEHLHGYQGAVYTVDAKEISMRALGKNYPNSPMLAAVVAVSKIMEKEEFLAEMKASFQHKFKPEVIDGNMMALELAFEAA.... 189
348 5.000e-69gi|675585558|gb|KFN37764.1| pyruvate synthase [Smithella sp. F21]  clstr ali  47  1......MIEVRWHGRGGQGAVTSVELLAVAAIAAGKYAQGFPSFGPERRGAPVAAFTRIDDKKINVRSGIYEPDVVLVLDSSLIGINVTDGLKPDGKLVVNTLKTPEEIRKELNFNGTVATVDGTGIARKEMGVPIANTTMIGALLKVTGIMQLDAMKESIEHRFG-----RIAQKNLNAMKRAYDEIQIIK 182
349 5.000e-69gi|516838594|ref|WP_018124181.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Desulfovibrio oxyclinae]  clstr ali  24  1...MSRYLDTIIAGFGGQGVMLIGNLLAYAGMQDGLNVTYIPVYGPEMRGGTANCTVVLAEEEIGSP-IIRRPTSLIIMNRPSLDK-FQSRLQDDGICVVNSSLVDMELADTDRL--NCLAVPANDIADKLGNTRMANMVALGAFIQATQVMPLDVVQGALENVISAHYSH-LIPKNAEALQAGADHVK... 181
350 5.000e-69JGI.Meta 7015400146 C2758584__gene_175162 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Subging  ali  31  1......MQRIIVAGFGGQGVLSLGQMLAYAAMYENKAATWLPSYGPEMRGGTANCSVVIDDHEVASP-IIARPDCLIAMNKPSLDK-FAGNVLDGGIIIVNSSLISD---KVNRKDVKTYYIKANDIAHEVGNDKAMNLVILGAYVKITGIFTKEQMLSTIEKVFANK--PQFIESNKKCLLAGYEL..... 174
351 5.000e-69gi|503143957|ref|WP_013378618.1| pyruvate/ketoisovalerate oxidoreductase [Eubacterium limosum]  clstr ali  40  1......MIEIRWHGRGGQGAFTAARLLGDAVVCDDKSALAFPSFGPERRGAPVLAFTRIDDAPIKDRSDVVDCDCAIVLDETLLGAPVKAGLKPGAKVIINTMKPAEVFDFSDCEDCKVITVDATGLALKILGRPITNVPLLGALTAATELTSLDSIYKAIDTQLPEKVRAK----NKTLLEETYNTVKEA. 181
352 5.000e-69gi|503303483|ref|WP_013538144.1| pyruvate synthase [Thermovibrio ammonificans]  clstr ali  53  1......MIEIRWHARGGQGAVTASKILASAVIREGKYAQSNPDYGAERSGAPLRAYNRVSEEPITLHCMVLNPDIVVVVDPTLLKVPFLEGTSEDAVLVINTNKTPQEVREKYNIQGKIYTVDATKIAMEELKRPLMNVPMLGALVKVLGLVDIKTVEEDIKKTFGKKISENALAANVRALYRAYEEVK... 186
353 6.000e-69gi|506230775|ref|WP_015750550.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Desulfohalobium retbaense]  clstr ali  27  1...MSLYKDVIIAGFGGQGVMLIGNLLAYAAMDAGLNVTYIPVYGPEMRGGTANCTVVISDEDIGSP-IIHAPQSLIAMNRPSLEK-FQPRVQDGGIQIVNDSLVEEQLAEKVR--VRSYFVPANDLANEVGTAKMANMVALGAYIQATGVLPLERVKNSLEKVIAAHYAH-LIPKNQAALQAGADHVQK.. 182
354 6.000e-69 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and rela  ali  30  3.......KEIICAGFGGQGVLTAGMLLINAGMEQDKNVLFYPSYGSEMRGGTANCTVKISDKLIASP-ISKKPDILFTMNTPAIDK-FEERLKPGGLLLVNSSIVPDD--RKYRDDITVVKVPATDIAAEVKNPKGANLVMLGALAAHSDLFSIEYMESAIVSFFEKKGKGKFNEKNVACYRRGVE...... 177
355 6.000e-69gi|503633021|ref|WP_013867097.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanothermococcus okinawensis]  clstr ali  45  1......MIEIRFHGRGGQGAVTAAQILAKAAFYDGKFSQAFPFFGVERRGAPVMAFTRIDDKKIRLRSQIYEPDYVIVQDPTLLDIDIKGGLKKGGKIVVNT------HNNLQFSDCEVYTIDATGIALEVLGLPIVNTAMLGAFTGVTGEVTIESLKKAIMDTFPKK----LGEKNAKVAEVAYNMVK... 174
356 6.000e-69gi|505402853|ref|WP_015589955.1| pyruvate ferredoxin oxidoreductase, gamma subunit [Archaeoglobus sulfaticallidus]  clstr ali  32  1..MSDILVEVRFHGRGGQGVVTAADMLAVAGFKDGYYTLSFPTFGAEKRGTPVASFLRLSDEPIVSRDEIYYPDYVVVMDPTVIGVKVDAGIKSDGKIIANYPKGPEELKESMGVDVEVYTINATRMAMEHLGRPITNTAMVGAFVGATGIIKIDSVLETVREWFSG----ELAEKNAKLITEAYNYMKEV. 186
357 7.000e-69JGI.Meta 7011951609 C3375588__gene_177914 2-oxoglutarate ferredoxin oxidoreductase, gamma subunit [Human Stool microbiome from visit number  ali  26  2......TTEMLFAGFGGQGILFSGKQMAKSAMYAGKNVSWLPSYGPEMRGGAANCSVIISDEEVGSPL-VTNPDILVAMNLPSYDK-FEANVKPGGYLILDSSLIN---KKCERTDIHVCYIPATAIASDNHIEGMANVIILGQLLKLTGLFDYDTFLSDMIRGIPE-SKSALIEKNKTALELGYNY..... 176
358 7.000e-69gi|501568855|ref|WP_012573289.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Candidatus Azobacteroides pseudotrichonymphae]  clstr ali  27  3.......HEIIIAGFGGQGILSMGKILAYAGLLEGKEVTWFPSYGPEQRGGTANVTVILSDERISSPVL-NEYNIAIILNQLSLEK-FEQTLKAGGVLLYDKYRI---TQLPTRKNIRIFETDATNTSIKEGSTKVLNMIVLGGIIKITQIVKIESIIDSLKKSLPERN-HKFLPMNQRAFFKGMDLIKEMK 181
359 7.000e-69 GL0015692 [Complete] locus=scaffold8887_1:3515:4057:-  ali  25  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERISSPVLSKY-DIAIVLNQPSLDK-FESRVKPGGVLIY---EGNGIINPPTRKDIDIYRIDAMDKAAELKNTKVFNMIVLGGMLSVAPVVSEKGVEKALFKTLPERH-HKLIPLNMDAIKVGGEIMQK.. 179
360 7.000e-69gi|511308260|ref|WP_016359004.1| pyruvate ferredoxin oxidoreductase gamma subunit PorC [Methanobrevibacter sp. AbM4]  clstr ali  41  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYSQAFPSFGVERRGAPVSAFTRIDEKPIELRYQIYNPDHILVLDDGLANVDIYSGIKENSDVVINT------HKDISSDKIPVHKIDATKIALDVLGRPIVNTIILGYFAKKSGVVSIESLEKVIKDVFPGKVG----EKNVRAVREAYEM..... 172
361 8.000e-69gi|503676298|ref|WP_013910374.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Thermodesulfobacterium geofontis]  clstr ali  42  1......MIEIRIHGRGGQGAVTSAELIAVAAINEGKFAQAFPSFGPERRGAPVQAFARIGEERIRTREKIYHPDIILVLDPSLPKTKVTEGLKENGVAILNSHLSEEEVRKILGYKGKLALVNATKIAIEEIGVPITNTTMLGALLKATGLIEVKSMEEALKERFG-----KLAEKNIKALHRALEETQIYK 183
362 9.000e-69 GL0057489 [Complete] locus=scaffold76512_5:45:581:+  ali  29  1......MKEIICAGFGGQGVLVAGMIIIYAGMGEGKQVTWFPSYGAEMRGGTANCTVKISEEEIASPY-VKQIDVLMAMNETSIDK-FESKLRPNGVLLVNSSIVS--PNREYRDDIRVIQVPANDIAAQTNNPKGLNIIMLGALAEATDIFEKDYLKKSMNQYFADKGKKN--PKNDICFDEGASYVHK.. 178
363 9.000e-69gi|504061692|ref|WP_014295686.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Marinitoga piezophila]  clstr ali  25  7..........IAAGFGGQGVMLFGKILSLAAMYENLYTTWLPSYGPEMRGGTANCTVVISEKYIASP-VVDKPSEVIAFNIPSMYK-FEKFLPEGGLLLLNTSVID---REPERKDVKVIKIPANEIADELGNIKVQNMVMLGAYLKATDAVSFDSVKAALEKSLKGK-KADLLELNLKAIEAGMKAAEE.. 180
364 9.000e-69 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and rela  ali  22  1...........MAGFGGQGVLSMGKILAYSGIMQDQEVAWMPSYGPEMRGGTANVTVILSDERISSP-ILTKYDTAIVLNQQSMDK-FESMVKPGGTLIYD---PNGITHEPTRKDINIYKIEGTAIAAEQGNPKVFNMIVLGGFLKVKPIVKLDNVEKGLQKSLPPRH-HKMIPMNIEAIQTGMNSVEVV. 174
365 9.000e-69 GL0025041 [Complete] locus=scaffold1812_10:882:1418:-  ali  26  2......TTQILIAGFGGQGVLFAGKFLAYKGLSEGREVSWLPSYGPEMRGGTANCSVILSDEPVGSP-IVAKPDVLMAMNLPSFDK-YESSVVPGGYVFVDSTLIA---RKAQRTDIKAFYIPATKMAAQAGTPTLANMIIVGKMMKETGAVSLEGLEATMKKFVPAKH-ADLVDANMNAIMAGYNYA.... 177
366 1.000e-68gi|496455475|ref|WP_009164320.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Pyramidobacter piscolens]  clstr ali  25  1..MAGFYKELIAAGFGGQGVMMLGQLVAYAGMDEGRNVSWIPSYGPEMRGGTANCSTVVSEEPVGSP-IINKCDVCVVFNQPSLAK-FESSPRAGGVLVYNSDLVKYEN---PRQDITVIPVPAEKLAAECGSPKTANIVLLGAAVAASGIISRESAKHVVEEKLGKK-KPQFLPMNLKALQCGFEQADKA. 183
367 1.000e-68gi|652798684|ref|WP_027096536.1| pyruvate synthase [[Clostridium] viride]  clstr ali  46  1.MANKTMVEIRWHGRGGQGAKMACLLLAEVAGQVGKFVQGFPEYGPERMGAPITAYNRISDTRCPVHSNIYTPDYVVVLDETLLDVDVTHGLRDGGAIIVNTPSSGEVIRPKLRYTGALYTLDARHLSEEILGRNFPNTALLAAVVKVSGVLELEAFLEHIEASFRKKFKPQVIAGNLEILRKASEEV.... 191
368 1.000e-68gi|499327960|ref|WP_011018452.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanopyrus kandleri]  clstr ali  44  1......MIEIRIHGRGGQGAVTAAEILAIAAKEDGKYSQAFPFFGVERRGAPVTAFARIDDEFIKIRSQIYEPDHVIVLDSSLLAVDVTEGLPEDGLIVINAREEELDKIMEKFEDSDVYTVDATQIALDELGVPIVNTAMVGAYLKASDILTLDAVKKAIHARFSG----EIAEKNVRAVERAYREVKAV. 182
369 1.000e-68JGI.Meta 7004198443 C4204138__gene_269372 hypothetical protein [Human Stool microbiome from visit number 1 of subject 160400887]  ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYAALMNDLEVSWMPAYGPEQRGGTANVTVILSDTPISSPVLDSY-DIAVVLNQQSLDK-FEPKVKPGGLLIYDS---YGIHRAPQRGDITVHEIKAMDATFDMGNSKAYNMVVLGALLGIRDLVPLDAVMRGLKKTLPERH-HHLLSMNEEAIQLGMTLVNE.. 179
370 1.000e-68gi|547918034|ref|WP_022320603.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:349]  clstr ali  26  1......MEKIIIAGFGGQGVLSLGQFIAYAALYENKAVTWLPSYGPEMRGGTANCSVVVDDTEVASP-IIAVPDTLIAMNKPSLDK-FKNKVRPGGLIIVNSSLISD---KVERTDVTTIYVPANELAHEAGNDKTANIVVLGAYMKYSKLFPREVMLSTIEKVFHAK--PKVIPVNQKAFDIGY....... 172
371 1.000e-68 GL0124775 [Complete] locus=scaffold37346_1:10948:11493:+  ali  23  4........EIIIAGFGGQGVLSMGKILAYSGIMQDQEVAWMPSYGPEMRGGTCNVSVILSDKKISSPILSKF-DTAIILNQQSLDK-FESRIKPGGLLVYD---PNGITHHPTRTDIQIYKIDAADEAAKMGNAKAYNMIVLGAFLKVKPIVKMENVTAGLKKSLPPRH-HNLIPMNEQAIKVGMEAAVKV. 180
372 1.000e-68gi|647586360|ref|WP_025863526.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prolixibacter bellariivorans]  clstr ali  24  4........EIIIAGFGGQGVLSMGKILAYSGVMQDQEVTWFPSYGPEMRGGTANVSVIISDERISSP-ILHEFDTAIILNQQSLDK-FEEQVKPGGVLLYD---PNGIVHPPTRKDINIYKVEGARLAAEMGNPKTFNMIVMGAYLKVKPIFGMEKVKKGLEKSLPERH-HKLIPLNLEAIEVGQKNMETV. 180
373 1.000e-68 GL0006131 [Complete] locus=scaffold14237_8:292:915:-  ali  43  15...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISQDVIRVHSNIYHPDYVVVVDETLLEVDVTAGLKKEGAIIVNTPKSKEEIEHLKGYEGDVYTVDGRKISVDALGKNFPNSPMLAAIVAVSKVMPRDKFITEMRASYEHKFKPEVIDGNMKALEMAFDAVE... 204
374 1.000e-68gi|547319249|ref|WP_022050601.1| 2-oxoglutarate ferredoxin oxidoreductase gamma subunit [Ruminococcus sp. CAG:254]  clstr ali  28  2......TTEFILAGFGGQGILFAGKILAYCGLMAGKELSWLPSYGPEMRGGTANCSVCISDEPIGSPL-VTAPNCLIAMNGPSYTK-FVNTVQPNGLILLDNSVVEEEA---VRDDVKTISLPATDMATENGLNGSANMILLGRMLAETKLFDLDTVQKAMEKCIPPK-RAHLIEANMKAVRIGAE...... 175
375 1.000e-68gi|653272241|ref|WP_027470175.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Cytophaga fermentans]  clstr ali  22  4........ELIIAGFGGQGVLSMGKILAYSGVMQDMEVSWMPSYGPEMRGGTANVTVILSDEKISSP-ILHEFDTAIILNQQSMDK-FEKQVKPGGTLIYDGN---GITNHPTRKDISIYRVDATEEAAKMRTTKTFNMIVLGGYLKVKPVVKMENVINGLKKSLPERH-HHLIPMNEKAINRGMDII.... 177
376 1.000e-68JGI.Meta 7011083964 SRS024625_LANL_scaffold_5217__gene_7521 ketoisovalerate oxidoreductase subunit vorA [Human Stool microbiome from visit n  ali  23  197.........IIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERISSPILSQY-DTAIILNQPSLEK-FEGKIKPGGILIYD---GYGIIEPPTRKDIQIYRIDAMDAANEKGMAKTFNMIVLGGLLKLRPVVSIESVIKALRKTLPERH-HHLIPMNEEAXKEELSIAEK.. 371
377 1.000e-68gi|547191879|ref|WP_021933560.1| pyruvate/ketoisovalerate oxidoreductase catalytic domain [Firmicutes bacterium CAG:124]  clstr ali  25  4.......HQIVIAGFGGQGLLFSGKVLAYAGLIEGRELSWLPSYGPEMRGGTANCNVILSDAPVGSP-IVNTPNVLMVMNNPSLDK-YENAVQPGGKIFLDSTLIA---RKVTRTDVEAYYVPATKMAMDMGMPTLANMILLGALIAKTGCVREESLADALHKVIPAR-KADLFDLNMQALQAGKEFA.... 178
378 1.000e-68 GL0040024 [Complete] locus=scaffold89642_2:174:710:+  ali  26  3......YTQILIAGFGGQGILFAGKFLAYKGLLEGKQISWLPSYGPEMRGGTANCSVIISDTPVGSP-IVSNPDILVVMNLPSLDK-YENAAVPGSKIFVDSALID---RKVQREDVDVFYIPATKLASDAGIPTLANMIMMGKMIRQTSVVSFDDIKSALEKVVSAKH-ADMLSYNLKALETGYNY..... 177
379 2.000e-68gi|506349757|ref|WP_015869476.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Kosmotoga olearia]  clstr ali  31  6.........LIAAGFGGQGVMLLGQVLATAAMFEDKHSTWLPSYGPEMRGGTANCTVVISDEFIASP-ISDTPNELIIMNIPSLLK-FEKNLTPSGIMILNTSVVD---REPTRTDIKVAKVDANKIAEEIGNLKIANMVALGAYLAMTGAVSTGSIEKALRKKLTGK-KVELIDLNLKAIEAGMRAVK... 179
380 2.000e-68gi|517422158|ref|WP_018593578.1| hypothetical protein [Blautia producta]  clstr ali  29  3.......KEIICAGFGGQGVLTAGMLLINAGMEQDKNVLFYPSYGSEMRGGTANCTVKISDKLIASP-VSKHPDILFTMNTPAIDK-FEERLKPGGLLLVNSSIVPED--RTYREDITVVKIPATDIAAEVKNPKGANLVMLGALAAHSDLFTIEYMETAIVSFFEKKGKGKFNEKNVACYRRGVE...... 177
381 2.000e-68gi|548209247|ref|WP_022428981.1| 2-oxoglutarate ferredoxin oxidoreductase gamma subunit [Ruminococcus sp. CAG:403]  clstr ali  27  2......TTEIILAGFGGQGILFAGKILAYCGLMDGKEVSWLPSYGPEMRGGTANCSVCISDELIGSPL-VTTPNYLIAMNGPSF-VKFIDAVQPGGSVYLDNSVVDET---CERTDITAVALPATDLATQAGLNGAANMVLLGKMLADTGLFSMETVQKAMEKCIPPK-RAHLIEANMKAIQIGAE...... 175
382 2.000e-68gi|490131938|ref|WP_004032310.1| MULTISPECIES: pyruvic-ferredoxin oxidoreductase, gamma subunit [Methanobrevibacter]  clstr ali  38  1......MIEIRFHGRGGQGSVTAAEILAKAAFKDGKYVQSFPFFGVERRGAPVMAFTRIDDKPIDIRYQVYNPDYVLVLDDGLMNVDVFSGIKENTEVIIN---IAEEFKGSGEHP--VHSIDATGIALDLLGRNIVNTIILGYFAKKTNVVSIESLIEVIKETFPGKVG----ELNAEATKKAYDM..... 173
383 2.000e-68gi|496177165|ref|WP_008901672.1| 2-oxoglutarate oxidoreductase [Peptoniphilus duerdenii]  clstr ali  24  8...NKMTRKIVMAGFGGQGVMAMGQLISYAGMLEGKHVSWYPSYGPEMRGGAANCSVVVSEDPVGSP-IIAVADDVIVMNEPSLS-LFESHVRPGGNLFINSSLVKKET---TRTDIEVHKIPVNDIAIDLGNARVANMVMLGAYLNITKLVKVESVIQAFTKVYGDK-KKKLIPINEKAIEAGGNAA.... 186
384 2.000e-68 GL0041651 [Complete] locus=scaffold13986_3:7167:7757:-  ali  24  21........EIIISGFGGQGVLSMGKILAYAALMEGKEVTWMPAYGPEQRGGTANVTVIISEEPISSPILSSY-DSAILLNQPSLDK-FQPKVKPGGTLIYDS---FGIIEKPVRTDIESWQIPXXXXXXXXXXXKCFNMFVLGGYLKLHPIVSIESVMKALRKTLPERH-HGLLPMNEQAILKGMEIIHQ.. 196
385 2.000e-68gi|518983647|ref|WP_020139522.1| 2-oxoacid:acceptor oxidoreductase subunit gamma [Streptomyces sp. 351MFTsu5.1]  clstr ali  40  1......MFQVRIHGRGGQGAVTAAELLSVAAFVEGRYAQAFPSFGSERTGAPVMAFCRIDDRPIRVREPVMRPDALVVQDPTLLHVDVFDGLHPGGAVLVNSPLTAAELGLAELVVARVLTVPATALALRHFGRPVPNAVLLGGLAALTGCVAIDSLTAAVRERFPG----SLGTANADAAREAYEHVK... 181
386 2.000e-68gi|505138698|ref|WP_015325800.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Halobacteroides halobius]  clstr ali  46  1...MASLTEIRWHGRGGQGAKTASILLGKVAAKTGKHIQAFPEYGPERMGAPVLAYNRISEDDITVHCQVTDPGIVTVLDPTLLNVDVTDGVPEDGTLVVNSEEDVATIKEQLEFDGDIWVLDAYGVANKEIGRPFPNTPMLGALMQATDLLPFENFVKQIKVELEKKHKPEMIDKNVAAIKRAYKEVAK.. 190
387 2.000e-68gi|547833849|ref|WP_022241751.1| 2-oxoglutarate ferredoxin oxidoreductase gamma subunit [Clostridium sp. CAG:413]  clstr ali  26  2......TTQILIAGFGGQGVLFAGKFLAYKGLSEGREVSWLPSYGPEMRGGTANCSVILSDEPVGSP-IVAKPDVLMAMNLPSFDK-YESSVVPGGYVFVDSTLIA---RKAQRTDIKAFYIPATKMAADAGTPTLANMIIVGKMMKETGAVSLEGLEAIMKKFVPAKH-ADLVDANMNAIMAGYNYA.... 177
388 3.000e-68 GL0270929 [Complete] locus=C18716790_1:103:627:+  ali  26  1......MEKIIIAGFGGQGVLSLGQFIAYAALYENKAVTWLPSYGPEMRGGTANCSVVVDDTEVASP-IIAVPDTLIAMNKPSLDK-FKNKVRPGGLIIVNSSLISD---KVERADVTTIYVPANELAHEAGNDKTANIVVLGAYMKYSNLFPREVMLSTIEKVFHAK--PKVIPVNQKAFDIGY....... 172
389 3.000e-68gi|530785554|ref|WP_020962320.1| hypothetical protein [Thermofilum sp. 1910b]  clstr ali  38  1..MEREFYEVRWHGRGGQGVVTSSELLALAALKEGKHVYHAPEFGPERRGAPVRAYTRIGNVPLELHSGIYEPDIVVVIDPSMQNEPFFAGLKKNGTLVINAKTPSEVLENVKNLGLNLWIVDAYKIAMEVFGRPFYNTPMLGALVKASNIVNLDSVLSAVSERFSK--DSKIAQLNVLAIKRAYEEVKKYE 190
390 3.000e-68gi|696213426|gb|KGL52430.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas canoris]  clstr ali  25  4........EILIAGFGGQGVLSMGKILAYSGLMGGKEVSWMPAYGPEQRGGTANVTVIVSDDKVSSPILNSY-DIVVVLNQPSLDK-FLNSVKPGGILIYDDNSIP---VPPKRDDINIYLVEGVKASVEMANDKVFNMIILGGLLKVAPIVDLQHITLGLKKSLPERH-HKLIPMNEEAIKKGMEIIKK.. 179
391 3.000e-68gi|661272087|ref|WP_029966175.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Desulfonauticus sp. A7A]  clstr ali  27  1...MSKYQDVIIAGFGGQGVMLIGNLLAYAGMEAGLNVTYIPVYGPEMRGGTANCTVVISEEEIGSP-IIFNPKSLIIMNRPSLDK-FQPRLEDKGTLILNSSLVDVDLVDKKR--IKAFAVPANEIADSLGNTRMANMVALGAYIEATQIIPLKVVQEALPQVISSHY-QHLIPANSQALEAGANYVQE.. 182
392 3.000e-68gi|728876142|gb|AIY90453.1| pyruvate ferredoxin oxidoreductase, gamma subunit [Geoglobus acetivorans]  clstr ali  38  1...MDILKEVRFHGRGGQGAVTAADILAVAGFKDGYYTLSFPMFGAEKRGTPVVSFLRISDEPIVIRDEVKNPDFVVVMDPSLVDVDVLAGIKDGGIAIINYPKGSEDLKQKLDTDVEIHAINATKMAMEILGRPITNTAMVGAFVGATGIVKIESVEETIMEWFGNK---DIAEKNVRLVREAYDHMKEV. 186
393 3.000e-68 GL0361612 unmapped_[Complete]_[mRNA]_locus=scaffold661974_2:17:550:-  ali  28  3.......KEIVIAGFGGQGVMSIGKSLVEAGLEEGLEVSWVPSYGPEMRGGTANCSVIMSDEPVGSP-IVYHPTELIAMNGPSLKK-FEDEVVPGGTVFLNSSIIKE---KVDREDLRVIQVPCDTIANELGNGKVANMVMLGAYIAATGALKADTLREMIRQMFTG-PKAKLVDLNMTALARGMECV.... 177
394 3.000e-68 GL0068048 [Complete] locus=scaffold75050_4:559:1092:+  ali  28  2......TTEFILAGFGGQGILFAGKILAYCGLMAGKELSWLPSYGPEMRGGTANCSVCISDEPIGSPL-VTAPNCLIAMNGPSYTK-FVHAVQPNGLILLDNSVVEE---KAVRDDVKTISLPATDMATENGLNGSANMILLGRMLAETKLFDLDTVQKAMEKCIPPK-RAHLIEANMKAVRIGAE...... 175
395 3.000e-68gi|630829780|gb|KCZ71493.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Candidatus Methanoperedens nitroredu  clstr ali  39  1......MKEIRIHGRGGQGSVTAAELLAVAAFEDGKYSQAFPAFGVERRGAPVTAFVRLSDKPIRLRSQIYEPDYVIVQDATLVDVDVEKGAKCDGIILINTEKNPSSFKFDTKASIK--TLDATKLAMDFIGKPIVNTTLIGAFAGVSGLIRPESIINAVMERFPG----PIGEKNAKAIQAAYDLME... 178
396 3.000e-68 GL0020956 [Lack 3`-end] locus=scaffold2489_2:32:649:+  ali  25  4.......HQIVIAGFGGQGLLFSGKVLAYAGLIEGRELSWLPSYGPEMRGGTANCNVILSDAPVGSP-IVNTPNVLMVMNNPSLDK-YENAVQPGGKIFLDSTLIA---RKVTRTDVEAYYVPATKMAMDMGMPTLANMILLGALISKTGCVREERLADALHKVIPAR-KADLFDLNMQALQAGKEFA.... 178
397 3.000e-68JGI.Meta 7003248334 SRS024132_Baylor_scaffold_5158__gene_9921 2-oxoglutarate ferredoxin oxidoreductase, gamma subunit [Human Stool microbiom  ali  26  1......MEKIIIAGFGGQGVLSLGQFIAYAALYENKAVTWLPSYGPEMRGGTANCSVVVDDTEVASP-IIAVPDTLIAMNKPSLDR-FKNKVRPGGLIIVNSSLISD---KVERTDVTTIYVPANELAHEAGNDKTANIVVLGAYMKYSNLFPREVMLSTIEKVFHAK--PKVIPVNQKAFDIGY....... 172
398 4.000e-68 GL0034999 [Complete] locus=scaffold93051_1:5374:5952:-  ali  43  10.......TEICWHGRGGQGVVTANEILAESAIYSGKYVKAFPEFGPERMGAPIRAFSRISDGPVRVHTQVYEPDIVIVIDPTLIGKDVAKGLKKGGFILANYEGTPAELQKAIGTTAECHSVNASKIALEEIGKPLVNTAMLGALIKIRPIITYSEMEDNITDKFTGKLSDKLIVKNLSALKRAYEEVE... 192
399 4.000e-68gi|661272280|ref|WP_029966364.1| pyruvate synthase [Desulfonauticus sp. A7A]  clstr ali  43  1......MLEIRIHGRGGQGGVTSAELLAKAAIDKGKYAQAFPSFGPERRGAPVEAFVRVSDEPIKIREKIYEPDVVLVLDPTLLDVKVDAGLKEKGLVVVNTPEQAESVKKKYSYP-RLAQVDALKIALETLGVPITNTTMLGALLKATNLLSPADMEGVLMERFGAK----LGPKNFAALQKAFE...... 176
400 4.000e-68 GL0080399 [Complete] locus=scaffold1407_2:2751:3299:-  ali  27  1...MEEML--IIAGFGGQGVQLIGKMLVEAGMEEGKEVSFLPSYGAEMRGGTSNCNVIISDEPVCSP-IVNEATCVMALNRPSLDK-FESAVLPGKTLLINSSLVD---RKAERTDIEAIYVPANDIANELGNNKVANMVMLGAYIEVAHAVTVDTVMNNLKVMFGER-KAHLLPINREAIERGMACVRDH. 180
401 4.000e-68gi|547778038|ref|WP_022189139.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase gamma subunit [Ruminococcus sp. CAG:177]  clstr ali  24  1...MKDM-NALLAGFGGQGILFMGKVIAYAGLTDGKEVSWLPSYGPEMRGGTANCSVCISSDPICSPLVVT-PNVFVAMNGPSYDK-FIDSVVPGGIVILDSTLVEREVK---RDDITVCLVPATQMAEEHGLKGLANIILIGKLMEQTGFCNLDTMSKAIAKVVPAR-KQHLVPKNVEAIELGMNY..... 177
402 4.000e-68gi|503209385|ref|WP_013444046.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Paludibacter propionicigenes]  clstr ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMQGQEVSWMPSYGPEQRGGTANVTVILSEERISSPVLNSY-DTAIVLNQPSLDR-FESKVKPGGTLIFDGN---GFHKFPTRTDINVYRIDATEYAYANDSAKTMNMIILGGLLKVRPIVQVENVLKGLKKSLPERH-HHLLASNEKAIQIGMGLIQK.. 179
403 4.000e-68JGI.Meta 7045797046 C3095843__gene_220258 2-oxoglutarate ferredoxin oxidoreductase, gamma subunit [Human Stool microbiome from visit number  ali  25  2......YTQILIAGFGGQGILFAGKFLAYQGLMEGKEISWLPSYGPEMRGGTANCSVIVADTPVGSP-IVSNPDILAVMNLPSLDK-YENEAVPGAKIFVDSTLIE---RKLARTDVTAYYIPATGMAREAGIPTLANMILIGKLIKETGVVSFGDIRKGLEKVVSARH-ADLLELNLKALEAGYNY..... 176
404 4.000e-68 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and rela  ali  26  2......TTEIILAGFGGQGILFTGKILAYCGLMADKELSWLPSYGPEMRGGTANCSVCISDEPIGSPL-VANPDILIAMNGPSYNK-FIDAVKPGGLVLVDNSVVDEE---CNRDDITYIAVPATDIASENGMNGSANMILMGRMLAESGLFDMDTVRKAMEKCIPPK-RANLIEVNMKAVEIGA....... 174
405 4.000e-68gi|651362816|ref|WP_026475166.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Alkaliflexus imshenetskii]  clstr ali  23  4........EIIIAGFGGQGVLSMGKILAYSGVMQDMEVSWMPSYGPEMRGGTANVTVILSDSRISSP-ILKKYDTAIILNQQSMDK-FEKSIKPGGLLLYDGN---GITRHPERTDINICRVDAAEEASKMNSSKTFNMIVLGAYLKLRPIVTMDNVMEGLKKSLPERH-HHLLPLNRDAIVRGTEIVKSV. 180
406 4.000e-68gi|494124555|ref|WP_007064332.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma, partial [Clostridium carboxidivorans]  clstr ali  27  5........QIIFAGFGGQGILSMGKFLAYAGMDANLNVSWLPSYGPEMRGGTANCSVILTDEAIGSP-IVTKADTIVVMNRPSLEK-FEDIIEPNGVIIMDSDLVDIV---PKRKDVKVISIPAQTIAEEIGSKKIANMILLGALVKETGIVSIE----ALLDSLKAHGKEKFFESNKNAIQKGIDFVK... 176
407 5.000e-68gi|502607998|ref|WP_012845066.1| pyruvate oxidoreductase subunit gamma [Rhodothermus marinus]  clstr ali  48  1......MLEIRWHGRGGQGAITVSKILALAALRSGKYAQAFPEYGPERSGAPVRAYNRLDDRPIVLHSGVYTPHRVAVLDETLLEEDVCEGLAPDGVLVINTTRPPEAIREQTGYPGRIVCVDAAAIAEETGSR-FANVPLLGALASTLEFIQLPTLEGALQAFLGKR-RPEVVEANLEALRRGYRETVALE 185
408 5.000e-68JGI.Meta 7017302681 C3365162__gene_207930 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  44  1...MSSGLEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAYNRISREQIRVHSNIYTPDLVVVVDETLLHVDVTAGLKENGAIIINTAKSREEVLPLLGYRGSIYTVDGRKISVEALGKNFPNSPMLAAAVAVSGVMPKKEFISEMRASYQHKFKPEVIEGNMKALTMAYDAVEEM. 192
409 5.000e-68gi|547462221|ref|WP_022081438.1| 2-oxoglutarate ferredoxin oxidoreductase gamma subunit [Ruminococcus sp. CAG:488]  clstr ali  23  1...MSNTCRMLFAGFGGQGILFAGKFLAYKGLIEGKQVSWLPSYGPEMRGGTANCSVIISDEPIGSP-IVDKPDVLVAMNLPSLEK-YENEVVSGGMIFVDSTMID---KKVDRTDVDVYYIPATKMANDNGTPTLANMIITGKILKEVPQFSIDFTDDALKKVVSARHL-DLLDVNKGAVKAGYDY..... 178
410 6.000e-68 GL0080295 [Complete] locus=scaffold5795_7:8029:8562:-  ali  32  3......TKKVFVAGFGGQGVLLIGQMLAYAAMYEGKEATWMPSYGPEMRGGTANCTVCISDKPIASPL-VTACDVLVAMNGPSLDK-FEDMLVPGGHLFVNASVI---HYKARRTDVHVHYVDCTHIAEEVGNGKTANMVMLGAIIRASGVVSLEIMDKVLAKTMTGK-KEKLIPANKTAL........... 172
411 6.000e-68gi|652920830|ref|WP_027174704.1| pyruvate synthase [Desulfovibrio aminophilus]  clstr ali  39  1......MIEIRIHGRGGQGGVTSAELLARAAIADGRFAQAFPSFGPERRGAPVQAFVRVDGKKIRLREKIYEPDLVLVLDPTLLDVDVAEGLKEGGMVVVNSAQPAEELKRKYGWP-KAACVDAGKVALEELGVPITNTTMLGALLKASGLLDVD----GMREVIDERFGPKLGPKNYKALERAFRE..... 177
412 7.000e-68gi|655513095|ref|WP_028894158.1| pyruvate synthase [Syntrophorhabdus aromaticivorans]  clstr ali  42  1......MIEVRFHGRGGQGAVTSAELIAQAAIGMGLYAQAFPSFGPERRGAPVQAFLRVSDKPIRLRSKVYQPDHVIILDPTLLTVNCTEGLKPDGFVIINSNKSLEELKKIFP-DRNIACVDASTIAKEELGVPITNTTMLGCLIKVTSVVDLASLEEPVKHRFGA-----VAYKNVNAYARAHKE..... 176
413 7.000e-68 GL0060249 [Complete] locus=scaffold6740_9:2447:2992:-  ali  25  1...MKDM-NALLAGFGGQGILFMGKVIAYAGLTDGKEVSWLPSYGPEMRGGTANCSVCISSDPICSPLVVT-PNVFVAMNGPSYDK-FIDSVVPGGIVILDSTLVEREVK---RDDITVCLVPATKLAEEHGLKGLANIILIGKLMEQTGFCNLDTMSKAIAKVVPAR-KQHLVPKNVEAIELGM....... 175
414 7.000e-68gi|502484648|ref|WP_012803180.1| pyruvate ferredoxin oxidoreductase [Cryptobacterium curtum]  clstr ali  24  7..........ILAGFGGQGLLFAGKIIAQAGLQEGREVSWLPSYGPEMRGGTCNCSVCVSDTPIGSPL-VTDPDVVIAMNQPSVAK-FMGTIKPGGLLIVDSTLVEEVDG---RDDITIYRLPATHLAEENGFPKLANVILTGKAFRETGFCKRESIDEALRAVIPAR-KKNLLEPNQKALALGIEL..... 177
415 8.000e-68gi|504246746|ref|WP_014433848.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Caldilinea aerophila]  clstr ali  30  5.........IIISGFGGQGALFAGQVLAHAAMESGKEVTWIPSYGPEMRGGTAHCTVVIGDEPIGSPL-VRNPHCVIAMNLPSVDK-YEPLVVAGGRLLYDSTLVK---RPLRRNDILSVAIPAHDIALRCGSQQLVNITMLGALLALCPLVELTAVEQALRTHLPERHADLLRP-NILALYAGAAYIRE.. 179
416 8.000e-68gi|490205554|ref|WP_004103984.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Thermosipho africanus]  clstr ali  26  4..........VFAGFGGQGVMLMGQILAYAGMIEGKSVTWMPSYGPEMRGGTANCTVVVEDKEVASP-VVDKAEVVVAMNIPSMLK-FQSFVTDGGYLFLNESVIDREPER--KDGINIYKINCNEIADELGNLKVANMVMLGAVIGATNIVSKESVIKALEQKLTGK-KADLIDINIKAIERGMQEASK.. 178
417 8.000e-68gi|544737978|ref|WP_021166877.1| ketoisovalerate oxidoreductase subunit VorA [Sporomusa ovata]  clstr ali  31  2......RHEIIMSGFGGQGVMLMGQIVTYAGMLEEKHVSWIPSYGPEMRGGTANCSVIITEGLPGSP-MVEEPTAVVVLNLPSLDK-FEAAVRANGVLIVNSSLID---KAVTRQDIKVYRVPVNDIAIELGNLKMANMVALGALIAATDAVEMEALFTAFAKKFASK--PQVIEANKAAIIRGYDYVKNN. 179
418 8.000e-68JGI.Meta 7028711365 C2510340__gene_158987 pyruvate ferredoxin/flavodoxin oxidoreductase [Human Stool microbiome from visit number 1 of subje  ali  25  2......TTEILLAGFGGQGVLFAGKILANCGLMDSKELSWLPSYGPEMRGGTANCSVCISDEPIGSPL-VLTPDILIAMNQPSYDK-FINAVKPGGKAFIDSTLIE---SKCERTDIECFYIPSSQLADDNELQGGSNIILLGKLIKETGIFSLDTMKKAIEKVVPP-AKAKLIANNFRAIEMGMN...... 175
419 8.000e-68gi|653634684|ref|WP_027637883.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Clostridium cadaveris]  clstr ali  24  6.........MICAGFGGQGVMSLGMLFTYAGMIENKQVTWCPSYGPEMRGGSANCSVTVSDEEIGSPLISNDATVVVIMNRASIK--FIKDLRPGGYAFLNSSLVSDEVK---RDDITVYKIPVNDIASELGNTKLANIVMLGAVNEILHIVDSESIVEAFRKVFGA-TKEKFIPQNKMAMQKGMEYAQNLK 182
420 8.000e-68gi|503378685|ref|WP_013613346.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Odoribacter]  clstr ali  25  4........EIIIAGFGGQGVLSMGKILAYSGIMQDQEVSWMPSYGPEMRGGTANVTVIISDERISSP--VLNADSAIVLNQQSMDK-FEPLVKAGGTLIYD---PNGITHHPTRKDINIYQIEGARLAAEGGNPKIFNMIILGGFLKVKPIINLDNLEKGLKKSLPARH-HNLIPMNIEAVQTGMAELK... 178
421 9.000e-68gi|504855885|ref|WP_015042987.1| MULTISPECIES: pyruvate ferredoxin oxidoreductase [Dehalobacter]  clstr ali  23  1...MSTTLELMIAGFGGQGVLFAGKILVYAGLLAGKEVSWLPSYGPEMRGGTANINVIVSDTPIGSP-IITYPGMLVAMNQPSLEK-FESDVQQNGTIIIDSSLIPIQVQ---RTDVQTFYIPATKLAEDAGLKGLANMVMVGKIAKQADIFDLEMLNKAVSKSIPER-KKDLLASNIKAIEIGYKF..... 178
422 9.000e-68gi|499625285|ref|WP_011306019.1| pyruvate ferredoxin oxidoreductase, gamma subunit [Methanosarcina barkeri]  clstr ali  41  1......MKEIRIHGRGGQGSVTAAEMLSVAAFEDGKFSQAFPAFGVERRGAPVQAFTRINNNPIRLRSQVYTPDYVIVQDATLLEVDVASGVKDDGIIIVNTTENPESLK--LNTKARVMTVDATKVAMDIIGVPIVNTVLLGAFAGATGEINVESIQHAIRARFSGKVG----EKNANAIQKAYKLIRGEE 181
423 9.000e-68gi|496100975|ref|WP_008825482.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Haloplasma contractile]  clstr ali  23  5........KVIIAGFGGQGVMLMGQLLAYAANEQDLNTLWYPSYGPETRGGTANCSVTISDTPVNSP-VISLADTIIVMNGPSLDK-FEDKVKPGGKLFINSSIVD---KKVSRDDIDVFYVPVNDMAVKLGNSRVANMVMLSAYLGKTELFENELILNLLRKSFGER-KAHLIEVNEKALEEGRTFIAEYK 182
424 1.000e-67gi|601044416|gb|EYR65119.1| 2-oxoacid:acceptor oxidoreductase [Actinotalea ferrariae CF5-4]  clstr ali  39  1......MFRVRIHGRGGQGVVTAAELLSEAAFRQGRYAQAFPFFGSERTGAPVVSFCRIADEPIRAHDPVTTPDAVIVQDVTLLHVDVLAGLRPDGYVLLDSPRRPADHGAPPPDRTTVVPLPATAIARHHLGRPLPNTPLLGAFAAVTGLVSLDAVVAALLERFPGAVGQR----NAEAARAAY....... 179
425 1.000e-67gi|518510037|ref|WP_019680244.1| pyruvate ferredoxin oxidoreductase [Ruminococcus flavefaciens]  clstr ali  24  3......TTEILLAGFGGQGILFAGKILAYCGLMDNKELSWLPSYGPEMRGGTCNCSVTISDDPIGSPL-VLTPHLLIAMNQPSFDK-FVSCVRPGGKVFFDSSMIEADTD---RTDIELFGIPSQQMADDNDLKGGSNIILLGKLLKETGICSLETMQKAIEKVVPPK-KAALIPNNFKAIELGMNA..... 177
426 1.000e-67gi|651337688|ref|WP_026460680.1| 2-oxoacid:acceptor oxidoreductase [Actinomyces suimastitidis]  clstr ali  38  1......MVEVRIHGRGGQGVVTASDLLAMAAFTDGHHAQAFPSFGSERTGAPVVSFCRITDTEIRTREPVLEPDVVVVQDPTLLPVDVFAGLKANGYALVNSTKSLDELGQQAHPHGHVLTLPAFDIARKHLGRPVPNVVMLGGVAALTGLIRLDSMAEAIRRRFPGR----LGEANVAAATEAFDTI.... 183
427 1.000e-67 GL0020444 [Complete] locus=scaffold95143_1:750:1289:-  ali  27  3......TTNILIAGFGGQGVLFAGKFLAYAALLEEKQLSWLPSYGPEMRGGTANCSVIISDEGVGSP-IVNKPDILVAMNLPSLDKYETEAV-PGAVILVDSSLIQ---RKVARQDVKAYYIPATKMASDAGIPSLANMILMGYLIAKTGAIPFEIIDQALKKVVSAKHQDKL-EVNRKAIELGYHY..... 177
428 1.000e-67gi|501165060|ref|WP_012209279.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Petrotoga mobilis]  clstr ali  28  6.........LIAAGFGGQGVMLFGQIISLAAMIDGKYTTWLPSYGPEMRGGTANCTVIISDEYIASPVL-DEPNEVAAFNIPSMIK-FEKTLKENGLLLINSSVID---RKPERKDIQLVKVPANEIADELGNLKVLNMVMLGAYLKATQAVSFEAVEEALKEKLTGK-KGKLLEINLKAIKAGMKETVK.. 180
429 1.000e-67gi|499735263|ref|WP_011415997.1| pyruvate:ferredoxin oxidoreductase subunit gamma [Syntrophus aciditrophicus]  clstr ali  46  1......MIEVRWHGRGGQGAVTSVELLALAAIGEGRYAQGFPSFGPERRGAPVEAFNRINDTRIKKRQRIYRPDVVVVLDPGLISVNVSEGLKPEGLLIINTSKSLKEIEKHIQFKGRIALVDATAIAWKELKVPITNTTMLGALVKMTDVVKLESLNEPIEHRFG-----RIANRNLAAMKLAYDEVH... 179
430 1.000e-67JGI.Meta 7049017410 C5091961__gene_253407 putative 2-oxoglutarate synthase subunit [Human Stool microbiome from visit number 1 of subject 15  ali  26  1...MKD--EIIIAGFGGQGVLSMGKILAYAALENDQEVTWMPSYGPEQRGGTANVTVILSTDPISSPVLDSY-DTAVILNQQSLDK-FESHVKPGGVLIYD---PYDIHRAPTRTDIKVVPVNAMEATIAMGQSKAYNMILLGALLAMRPDVPVEAVVRGLKKALPERH-HHLIPVNEQAIRKGMELVADLK 181
431 1.000e-67gi|551218309|ref|WP_022846247.1| pyruvate synthase [Desulfurobacterium sp. TC5-1]  clstr ali  48  1......MIEIRWHARGGQGAVTASKILASSAIREGKYAQSAPDYGAERAGAPLRSFNRVSENPITLHCLVLHPDIVVVVDPTLLKVPILEGTSEDAVLVINTDKTPQEIRSMLNIEGKIFTVNASAIAMEEFGKPFMNVPMLGALVKVINLVSLDSVKEDIKATFGKKVSKELLEANLRALERAYKEVK... 186
432 2.000e-67gi|571050013|gb|AHF23763.1| pyruvate ferredoxin/flavodoxin oxidoreductase [uncultured bacterium Contig1549a]  clstr ali  26  4........QFLIAGFGGQGVLLIGQLLAKAAMHEGMNVSWMPSYGPEMRGGEANCAVVISDEPIGSPLVTEIP-FAVIMNKPSMIK-FTPAMEKGGIMLYNSSLIDIT---PDRDDIVAIPVDCNGIAEELGNSRTANMVMLGAILKKTGVVSIDSAMEALKATFGPK-KEHLLPINRQAMERGAAAVE... 178
433 2.000e-67gi|664790454|gb|AIF53127.1| pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Pelosinus sp. UFO1]  clstr ali  28  2......RHEIIISGFGGQGVMVMGQLLTYAGMLEGKHVSWMPSYGPEMRGGTANCSVIIDERSIGAP-MVTEPTAAVVLNLPSLDR-FEQTVQSKGVLIINSSLID---KPVQRSDIHVYNVPINDIATELGSPKVINVVALGALLAATHAVEMEAAVTAFAKKFASK--PQIVELNKEAMIRGYKAVE... 177
434 2.000e-67gi|656217857|ref|WP_029166588.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Aminiphilus circumscriptus]  clstr ali  26  1..MAEFFRSLLAAGFGGQGVLTLGQLVAYTAMYEGRHVTWIPSYGPEMRGGTANCSVMVSDEEIASP-VVSRADYVVIMNQPSLAK-FEPTVKPGGILLYNEDLVSY---RNPRTDITVVAVPANSLAMELGSEKVANVVVLGALVEAGDIVGADACLATIKDKLGKK-KAQMMEMNITAFEKGREIARK.. 182
435 2.000e-67gi|502720366|ref|WP_012955350.1| pyruvate ferredoxin oxidoreductase gamma subunit PorC [Methanobrevibacter ruminantium]  clstr ali  41  1......MIEIRFHGRGGQGAVTAAEILAKAAFKDGKYSQAFPFFGVERRGAPVMAFTRIDTEPINLRYQVYNPDHVIVLDDGLLNVDVYSGLKENGEVIINT------HEKVESESHKVFDVDATGIALEILGVNIVNTIILGYFAKKTGEVSINSLIEVIKETFPG----PIGEKNAVAAQKAYDMA.... 173
436 2.000e-67 GL0034157 [Complete] locus=scaffold21661_5:874:1404:+  ali  27  2......TTETIFAGFGGQGILFAGKLLAYLGLYQDKQVSWLPSYGPEMRGGTANCTVCVSDQPIGSPY-VTDPDILVAMNAPSYDK-FIEAVKPGGIAIIDSTLVTEE---CSRTDIRSFRIPSTALAAENGLPGMANIILVGKLLKETGFAVLEAVRPVLEKMIPPK-KANLIDANMKALAIGMAL..... 176
437 2.000e-67gi|505305571|ref|WP_015492673.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Thermoplasmatales archaeon BRNA  clstr ali  43  3.......TEICWHGRGGQGVVTANEILAESAIYSGKYVKAFPEFGPERMGAPIRAFARISDTPVRVHTQVYEPDIVIVIDPTLIGKDVAKGLKKGGFILANYEGTSAELQKAIGTTAECHAVKASKIALEEIGKPLVNTSMLGALIKIRPIISYSEMEDHITDKFTGKLSDKLIVKNLTALKRAYDEVE... 185
438 2.000e-67gi|10639793|emb|CAC11765.1| probable pyruvate ferredoxin oxidoreductase, gamma subunit [Thermoplasma acidophilum]  clstr ali  40  8.....EMYEIRFHGRGGQGAVTASRILAAAAFAEGKYVVSFPFFGTERRGAPVTAFTRIDDSEIYLKSQIYNPDIVVVLDTYVLRTNVMEGLKENGTVIINSPRDPADFN----LDANVATVDAVAIAVKHGLNPVINTSMLGAFSRVTGIVSLESVLEATRQNVPAKVKE-----NMDAVKEAYDSVKILK 190
439 2.000e-67gi|505171827|ref|WP_015358929.1| 2-oxoglutarate synthase subunit KorC [[Clostridium] stercorarium]  clstr ali  24  3.......HEIILAGFGGQGILMAGKLLAYAGMLDGKHVSWLPSYGPEMRGGTANSSVVISDRPVDSPVL-YSCNELIVMNRPSLDK-FENLVEEGGVIVMDSSIVD---RDVKRGDIESFKVPATKMASEMGNMAFANIILLGKLIKERKTVTVDNLEKALYEVLPEK-KRNLIPMEIKALKTGMEYI.... 177
440 2.000e-67 GL0055914 [Complete] locus=scaffold4362_13:2106:2645:+  ali  23  1...MSNTCRMLFAGFGGQGILFAGKFLAYKGLIEGKQVSWLPSYGPEMRGGTANCSVIISDEPIGSPIA-DKPDVLVAMNLPSLEK-YENEVVSGGKIFVDSTMID---KKVDRTDVDVYYIPATKMANDNGTPTLANMIITGKILKEVPQFSIDYTDDALKKVVSARHL-DLLDVNKGAVKAGYDY..... 178
441 2.000e-67gi|547894858|ref|WP_022299591.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase gamma subunit [Clostridium sp. CAG:964]  clstr ali  25  1...MSKDFNILFAGFGGQGVLFSGKLAAYAGLYDDKHITWLPSYGPEMRGGTANCSVCISDTPIGSPCVVS-PNAFVALNLPSFER-FKDRVVPGGTMIVDSSMIPV---KCDRTDINIVYVEASKLATENDLEGLSNIILLGKLFKETGFCTAESLDKALLKCIPPKRKH-LLEPNRKALKIG........ 175
442 2.000e-67gi|658521627|ref|WP_029716409.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Atribacteria bacterium JGI 0000079-L04]  clstr ali  28  4........EIIIAGFGGQGIMLIGRLIAYAGMLEGKRVAWMPSYGPEMRGGTANCTVIVSSEEIASP-VVPNPRSIIVMNKPSLDK-FEETVKKDGLIVLNDSLIKQEVN---RKDVTVIRVAANDIADQLGNLKIANMVMLGAYVQKSQAVRMETVVKALEETLSGRN-QTLLELNLQALKKGAQII.... 177
443 2.000e-67gi|666990560|gb|KEZ86022.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Clostridium sulfidigenes]  clstr ali  26  5........EIIFAGFGGQGILSMGKFLAYAGMDVNMNVSWLPSYGPEMRGGTANCSVIVSDEAVGSP-IVTNPTSLVVMNRPSLDK-FEKEILPGGLLILDSDLIE---RPVEREDIEVIKIPAQTEADSLGSKQIANMVLLGALVAKTQIVSMETLLQSLRD----HGKEKFFEINRKALEIGASYVVK.. 177
444 3.000e-67gi|506399724|ref|WP_015919443.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Thermotoga neapolitana]  clstr ali  27  3......YHAVVIAGFGGQGVMLAGQIIAMAAVIEGKNATWLPSYGPEMRGGTANCTVIVDEKPINSP-VVDHPTEVIAMNFPSM-MKFGPRLKHRGILFVNSSIVEHVL---ERDDVETVKVPANEIAEELGNTKAANMVMLGAFLEVTKAVSFEAVREALSEKITRK---DLLEIDLMALDRGREYIKK.. 178
445 3.000e-67JGI.Meta 7064177076 C20380624__gene_108887 hypothetical protein [Human Stool microbiome from visit number 1 of subject 159753524 replicate 2  ali  28  1...MGKTYKISCAGFGGQGVMTMGELITFAGMDEGKEVAWVPSYGPEMRGGTADCSVTVSDEPIGSPVFENNIDIVIAMNLPSYLKYV-DKVAPGGCLFLNSSIIEEEVK---RTDINVYRVPVNDIADELGNQKLVNIIMLGAVIEVTKIVSPETILSAFINLFGE-AKKKLIPANTVALGKGAESVK... 182
446 3.000e-67gi|553957152|ref|WP_023153603.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit [Eubacterium brachy]  clstr ali  29  1..MSNDVKKIFIAGFGGQGVLLIGQMLSYAAMYEDKEVTWMPSYGPEMRGGTANCTVCIGSEPIASPYITDAFDVLIVMNSPSL-VKFESQLKPGGDLFINTSIVDVE---PTRTDVNIHRVDCNELAIEVGNGKTANMVMLGAIIRQAKVVDLNTMNKVFEKVLTGK-KAKLIPSNLEAL........... 175
447 3.000e-67gi|497938388|ref|WP_010252544.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Acetivibrio cellulolyticus]  clstr ali  23  5........DVIIAGFGGQGILSAGRILAYAGMLENKNVSWLPSYGPEMRGGTANCSVILSDEAVGSP-IINYATSLIVMNGPSLEK-FESMVTSGGVIITDSSLIE---KVPTRKDVSVHCVPATKTALDMGNGTFATIILLGKLIAATNIISKESFAEALKKTLPAK-KHYLIPEEIKALEYGMEF..... 177
448 4.000e-67gi|647122755|ref|WP_025641748.1| oxidoreductase [Clostridium ultunense]  clstr ali  30  1......MVEIISAGFGGQGVLTAGLILAKIAINNGKNVTWIPSYGSEMRGGTANCNVKIDDQEIASP-FVKNIDVLIAMNAPSVEK-FENMIKPDGLLIVNSSMVKG---KKYRDDIRIVKVPANDIAREVNNPKGLNITVLGAFAKATGIFDKDSFIEGIDGFFASKGI--VNPANRLCFEKGYDL..... 174
449 4.000e-67gi|547957553|ref|WP_022358007.1| 2-oxoglutarate ferredoxin oxidoreductase gamma subunit [Ruminococcus sp. CAG:379]  clstr ali  26  3.......YDILLAGFGGQGILFAGKLLAYCALIDGKELSWLPSYGPEMRGGTCNCSVCISDEPIGSPL-VLTPDLLIALNQPSYDK-FIGSVRKGGMAFVDSTLVDTTVETP---DIQCFYVPATQMETDANLPKAANIILLGKMLKETGMFSDEVIRKGLEKLIPPK-RAHLIENNLRAINMGMN...... 175
450 4.000e-67 GL0018695 [Complete] locus=scaffold10435_7:877:1413:-  ali  26  1...MEKTF--IFAGFGGQGMLLIGKFVAMACMLDGKHVSWLPSYGPEMRGGTANCSVIVSDDPVASPL-VDKADVIVAMNRPSLDK-FEEHVKPGGVLVINSSIID---RKAVRDDITVVYCDANGIAESIGNPKGANVAILGAVLAVAPVTTVESMMEAIRIELGEK-KARFLEGNKKALLAGMEAAK... 178
451 4.000e-67 GL0060055 [Lack 5`-end] locus=C4061755_1:3:524:+  ali  26  1.........IILAGFGGQGILFAGKILAYCALMDNREISWLPSYGPEMRGGTANCSVCISDEPIGSP-VVTNPDCLIAMNGPSYKK-FIQAVKPNGLVLLDNSIVDEV---CERKDITEISLPATYLATNAGLNGAANMVLLGRMLAETKMFSLETVQKAMEKCIPPK-RAHLIAANMKAIELGM....... 170
452 4.000e-67JGI.Meta 7016070292 C3236211__gene_207468 hypothetical protein [Human Stool microbiome from visit number 1 of subject 764062976]  ali  24  1...MSKNYNMLLAGFGGQGILFAGKVIAYGGLMDEKEISWLPSYGPEMRGGTANCSVCISDTPVGSPL-VLTPNVLVAMNLPSLDK-FIGSVEPGGTVIIDSFLID---KKIERGDVNVFYVPATRLAEENGLKGLANIILVGKLFKETAFCSDEALDRAIQKSVP-KSKAHLLDANRKAIRIGMEY..... 178
453 5.000e-67gi|671604387|ref|WP_031577253.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Proteiniclasticum ruminis]  clstr ali  23  2......TQEVIFAGFGGQGILSMGKFLAFGGMDKGMNVSWCPSYGPEMRGGTANCSVILSDEEIGAP-IISAPDTIVVMNRPSLDK-FEKTVKPGGLIILDSNLV---TREVDRDDVTVIRIPSQTEAEAIGSAKIANMILLGALVEKTGIISKDELLESLK----GHGKETFFEMNKNAIEKGIEYAKKA. 177
454 5.000e-67gi|548250168|ref|WP_022467964.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Acidaminococcus sp. CAG:917]  clstr ali  27  1......MERLIVAGFGGQGVLSLGQIIAYASMYENKNVTWLPSYGPEMRGGTANCSVVVDDNPIASP-VIATPDTLIAMNKPSLDK-FIDKVKSGGLVLVNSSLISE---KVKREDVTVVYVDANAVAHKVGNDKASNLVVLGAYIKYSNLFPKEVMLSTIEKVFASK--PKFIESNKACFMAGYE...... 173
455 5.000e-67gi|494846304|ref|WP_007572404.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella multisaccharivorax]  clstr ali  27  1...MKK--EIIISGFGGQGVLSMGKILAYSGLVAGKDVTWMPAYGPEQRGGTANVTVIVSDDSISSPILSSY-DIAIVLNQPSLDK-FLPKVKPGGLLIYDGN---GIVNSPLRGDITIYRIDAMAKAAEMHNNKVFNMIVLGGLLQVTGFLPDDALEHALYKTLPERH-HDLIPLNMEAVAEGKKIIKQC. 181
456 6.000e-67gi|497933199|ref|WP_010247355.1| 2-oxoglutarate oxidoreductase [Peptoniphilus rhinitidis]  clstr ali  24  3......TRDIIAAGFGGQGIMAMGQLITYSGMLENKFVSWLPSYGPEMRGGSANCSVVVSDEPVGSPVISQATD-VIVMNEPSLEK-FEEFVAPGGNLFLNSSLIKSF---PKRNDINVFSIPVNDLAIELGNAKVANMVMLGAFLQVTNTVKTESVIKAFTKVYGD-AKKKLLPINERAIATGQDAIKEA. 181
457 6.000e-67gi|499685504|ref|WP_011366238.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Desulfovibrio alaskensis]  clstr ali  24  1...MSLYQDVIIAGFGGQGVMLIGNLLAYAGMESGLNVTYIPVYGPEMRGGTANCTVVVSDEEIGSP-IIQRPASLIIMNQPSMDK-FQPTMQDGGVLLINSSLVDVSQAQSR---VKSYGVPANEIADKLGNTRMANMVALGGYVQATGVLDLEVVKKSLSSVISSHYAH-LIPKNAEALQAGADHV.... 179
458 7.000e-67gi|504626178|ref|WP_014813280.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Desulfomonile tiedjei]  clstr ali  44  1......MIEMRFHGRGGQGAVTCAELVAQAAIDTGRYATAFPSFGPERRGAPVIAFARVDEQPIRLRSKIYAPDVVVVLDPSLLDIASPAGLRDNGILIVNSPYDPETLKKHLGYQNRIAVVDAGRIAREVLGLPITNTTMVGALVKGTGIMDVESLKAPFRKRFG-----KIADRNIQAMERAFNE..... 177
459 7.000e-67 GL0124790 unmapped_[Complete]_[mRNA]_locus=scaffold577210_1:116:649:+  ali  26  4.......TQILIAGFGGQGILFAGKFLAYKGLTDDKNVSWLPSYGPEMRGGTASCNVIISDEPVGSP-IVSKPDILIAMNLPSLDR-YEDSVAKGGCIFVDSSLID---RKVKRDDVKTYYIPATKLASDNSMPTLANMIIMGKLLKETGDFSDDMALKALNKVISAKH-ADMLDINLKALKIGSE...... 176
460 7.000e-67 GL0086137 [Complete] locus=scaffold15296_4:685:1236:-  ali  26  1.MVMKE--EIIIAGFGGQGVLSMGKILAYAALVEGKEVTWMPSYGPEQRGGTANVTVIVSDNKISSPILSMY-DTAVILNQPSLEK-FEQSIKPGGTLIYD---GYGISTPPSRKDITVYRIDAMDAAAEMKAAKAFNMIVLGGLLKVRPLVEVEDVLHALRKTLPERH-HHLIPMNEAALRKGMEII.... 179
461 7.000e-67 GL0038227 [Complete] locus=scaffold5542_1:765:1307:-  ali  26  2......MKQFIFAGFGGQGMLLIGKFVAMAAMLDGKHVSWLPSYGPEMRGGTANCSVIVSDKDVASPL-VDKADVIVAMNLPSLDK-FEEHVKPGGLLVVNSSIIE---RKSTRDDITVVYCDANRIAEAVGNPKGANVAILGAMLEKEPIVDIDKMTEAIRIELGER-KARFLEGNKKALIAGMEAARE.. 179
462 7.000e-67gi|546407796|ref|WP_021857600.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Firmicutes bacterium CAG:555]  clstr ali  26  1...MKK--EFIFAGFGGQGMLLIGKFLAMACMLDGKHVSWLPSYGPEMRGGTANCSVIVSDVPVASPL-VDKADVVVAMNRPSLDK-FESHVKPGGTLVINSSLID---RKAERDDIDVVYCDATRIAEEVGNPKGANVAILGALLQKAPVCSDELMSEAIRIELGER-KAKFLPGNM.............. 167
463 8.000e-67gi|647173830|ref|WP_025657023.1| oxidoreductase [Clostridiales bacterium VE202-21]  clstr ali  29  1...MKK--EIICAGFGGQGVLTAGMILIDAGMKLDKNVLFYPSYGSEMRGGTANCTVKISDKMIACP-VSKHPDILLTLNTPAVDK-FEDSLVSGGLLMVNSSIVPKD--RTYREDITVIKVPATDIAAEVQNLKAANLVMLGALAAATDLFTVEYLEESILQFFEKKGKGRFNEKNAACYRRGVETVQKA. 182
464 8.000e-67gi|495902899|ref|WP_008627478.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Paraprevotella xylaniphila]  clstr ali  26  1.MVMKE--EIIIAGFGGQGVLSMGKILAYAALVEGKEVTWMPSYGPEQRGGTANVTVIVSDDKISSPILSMY-DTAVILNQPSLEK-FEQRIKPGGTLIYD---GYGISTPPSRKDITVYRIDAMDAAAEMKAAKAFNMIVLGGLLKVRPLVEVEDVIHALRKTLPERH-HHLIPMNEAALRKGMEII.... 179
465 9.000e-67gi|494026081|ref|WP_006968283.1| MULTISPECIES: 2-oxoisovalerate ferredoxin oxidoreductase, subunit gamma VorC [Desulfotignum]  clstr ali  25  3.......TEIKFAGFGGQGILLSAKLLAYAAMKQGSFVAWIPSYGPEMRGGTAYCTVVISDRLIGSP-IIKNPTHLVAMNRPSLEK-FENDVKPGGIIFINSSLIPVTSQ---RTDVTQLVVPVNDIAIKAGSVRAANIVALSAFAAKSNLVDLELLKECVKNEFAAK--PKIIPLNMEAFDLGVKSAQ... 177
466 9.000e-67gi|503151825|ref|WP_013386486.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Ilyobacter polytropus]  clstr ali  24  1......MTEIICAGFGGQGVMVLGKLIAYAGMLHDRQVSWLPSYGPEMRGGTANCHVILSEKPIGSPIVSGDADFAIVMNKPSLDK-FESSLVPGGRLLVNSSLISD---KASRDDIEVYYIPANEIASECGIEKDSNLVMLGAYLELTNLIKEKEIIEAFTKVF-DNEKAKLIPLHKKALEKGAESLK... 179
467 9.000e-67gi|557310869|ref|WP_023386605.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Youngiibacter fragilis]  clstr ali  24  2......TYEILFAGFGGQGIMSMGKFLAYGGMDDGLHVSWCPSYGPEMRGGTANCSVILSDDDIGAP-VITEPDVLVVMNRPSLDK-FEHIVKPGGLIIVDSDLVN---RSVERKDVTEIRIPSQSIATEIGAKTIANMILLGAVVEKIGVIPMDVLLASLKE----HGKESFFEMNKLAIEKGIEAVRK.. 176
468 1.000e-66gi|547720491|ref|WP_022135044.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Firmicutes bacterium CAG:176]  clstr ali  25  1...MEKTF--IFAGFGGQGMLLIGKFVAMACMLDGKHVSWLPSYGPEMRGGTANCSVIVSDDPVASPL-VDKADVIVAMNRPSLDK-FEAHVKPGGVLVINSSIID---RKAVRDDITVVYCDANGIAESIGNPKGANVAILGATLAKAPVTSVESMMEAIRIELGEK-KARFLEGNKKALLAGMEAAK... 178
469 1.000e-66gi|671563699|ref|WP_031544103.1| pyruvate synthase, partial [Lachnospiraceae bacterium AC2014]  clstr ali  43  1...MSKDLEIRWHGRGGQGAKTAALLLADVAFSTGAHVQGFPEYGPERMGAPITAYNRISRKPIRVHSNIYDPDLVMVVDETLLEVNVTAGLKQEGAIVINTPKSVEEVRPLLGYEGNVYTIDARKISVDALGKYFPNSPMLAAAVAVSGVMDQKDFIEQMRGSYKHKFKPEVIDGNMRALTLTLDAI.... 189
470 1.000e-66JGI.Meta 7035940420 SRS015133_WUGC_scaffold_6877__gene_12264 pyruvate/ketoisovalerate oxidoreductase [Human Stool microbiome from visit numb  ali  25  4.......FQIVIAGFGGQGLLFSGKVLAYAGLLEGRELSWLPSYGPEMRGGTANCNVILSDTPVGSP-IVQHPNVLMVMNNPSLDK-YEDTVAPGGKIFVDSTLIG---RKVRRTDVEAYYIPATGLAGEMGVPTLANMLLLGALVEKTGCVRFDSIAPALHKVIPAR-KADLFDVNMKAVEAG........ 174
471 1.000e-66gi|502801850|ref|WP_013036826.1| pyruvate ferredoxin oxidoreductase, subunit gamma [Methanohalophilus mahii]  clstr ali  39  1......MKEIRIHGRGGQGSVTAAELLAGAAFEDSQFSQAFPAFGVERRGAPVQAFTRISDAPIRLRSQIYEPDYVIVQDPTLIEVDVESGAKDDGIILINSDFAPEDFD--LDTNARIMTVNATKVALDIIGRPIVNTVLLGAFAGATGEVRASSIVNAVKGRFSGKIG----EKNAEAVQKAYDLMAEEK 181
472 1.000e-66gi|496426105|ref|WP_009134952.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Alistipes indistinctus]  clstr ali  23  1..MAKE--EIIIAGFGGQGVLSMGKILAYSGVMQDMEVSWMPSYGPEMRGGTANVTVILSDKPVSSP-ISHEYDTAIILNQQSLDK-FEPLVKRGGVLIYD---PNGISRHPVRKDIAVYAIDATAEAARMGNMRVFNTMILGGYLKVRPQVLVENVMKGLAKSLPERL-HKLLPANEEAIRHGMEIIRKVE 182
473 1.000e-66 GL0064752 [Complete] locus=scaffold58723_4:1329:1871:-  ali  41  1......MTEIRWHGRGGLGAFTAARLLGCAVLYEGKYALAFPSFGPERRGAPVFAFTRIDNKPITDRSEVVECDIAIVLDDTLFGDPVRNGLKPGATVIVNTTRDKAEFAI---EGCNVVAVDATGLALEILGRPITNVPLLGALIAATGITSVEAVEAAIDNQLA----PKLREKNKKLLKKTYEVVKE.. 178
474 2.000e-66gi|406883775|gb|EKD31293.1| hypothetical protein ACD_77C00347G0006 [uncultured bacterium]  clstr ali  22  4........EIIIAGFGGQGVLSMGKILAYSGIMQNQEVTWMPSYGPEMRGGTANVTVILSDKKISSPILGRF-DTAIILNQQSLDK-FESTVKPGGLLIFD---PNGITKPPVRKDITICSIAAVDISAELGNSKAYNMVVLGAYLKIKPIVSHENVIKGLKKSIPERH-HSLIPMNEKAIVAGKENI.... 177
475 2.000e-66gi|664789218|gb|AIF51891.1| pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Pelosinus sp. UFO1]  clstr ali  28  4........EIIISGFGGQGIMLMGQLLAYAGMLENKQVSWIPSYGPEMRGGTANCSIIISENPIGAPT-VSEPTAVVAMNLPSIEK-FETVIQPGGILIINSSLVE---WNTTRTDLRVYQIPANEISLEFNNSRVSNMVILGALVTAIGTIQSESVIKAFAKIFAKK--PEILWMNEQAILRGSQYI.... 176
476 2.000e-66JGI.Meta 7006447484 SRS013818_Baylor_scaffold_31672__gene_36889 2-oxoglutarate oxidoreductase, gamma subunit [Human Tongue dorsum microbiome  ali  22  20.................QGVLSMGKILAYSGLMEDKEITWMPAYGPEQRGGTANVTVIISDDRISSPILSKY-DVAIVLNQPSLDK-FEPKVKPGGLLIYD---GYGVFNPPTRKDITVYRINAMDKAAEMKNAKVFNMIVLGGLLKVCPVVSTDGLKKALFKSLPERH-HKLIPLNMEAVEEGMKII.... 184
477 2.000e-66gi|521284463|ref|WP_020448731.1| 2-oxoglutarate ferredoxin oxidoreductase, gamma subunit [Candidatus Methanomassiliicoccus intestinalis]  clstr ali  27  1...MSKSTNILLAGFGGQGILFAGKVIAYAGLMDSMEVSWLPSYGPEMRGGTANCSVCLSNTPI<