current user: public

Query: TM0015 TM0015 281896 PDB-2007-09-14, from T.maritima

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
144 4.000e-73gi|505138643|ref|WP_015325745.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Methanomethylovorans hollandica  clstr ali  41  1......MKEIRIHGRGGQGSVTAAELLAVAAFADGKFSQAFPAFGVERRGAPVQAFTRMDDTPIRLRSQVYEPDYVIVQDPTLIEVDVASGLKEDGIIIINSEFDPSTFK--LNTKAKVVTVNATKIALEIIGRPIVNTVLLGAFAGATGNIRPESIKEAVKERFPGKVG----ERNAEAIQQAYDMMKEA. 180
149 5.000e-73gi|548216883|ref|WP_022436183.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Prevotella sp. CAG:279]  clstr ali  28  3.......HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVILSDEKISSP--ILNADIAVVLNQQSLDK-FESKVKPGGILIYD---NYGIHRAPTRKDIKVYNVAAMDATLEMKNSKTYNMIVLGALLKVCPMVTLESVIKGLKKSLPERH-HKLIPLNEEAIRKGMSLINE.. 179
199 7.000e-72gi|545418115|ref|WP_021657033.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Clostridiales bacterium oral ta  clstr ali  28  5........EILFAGFGGQGILSMGKFLAYAGMDAGLNVSWLPSYGPEMRGGTANCSVILAEDPVGSP-IVNEATTLVVMNRPSLDK-FEDAIKPNGLLIVDSDLVN---RLPERNDVEVISIPAQSIAEEIGSKTIANMVLLGALVAKTGIVSMEDLLKALKE----HGKEKFYEANKKALEKGAEYA.... 175
312 6.000e-70gi|503062058|ref|WP_013297034.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Thermoanaerobacterium thermosaccharolyticum]  clstr ali  30  5.........IIFAGFGGQGIMSMGLIMAYAGMMDGKNVSWLPSYGPEMRGGTANCHVTISDEPVGSP-IINEATVVVAMNRPSLER-FEKHLVKGGILLINSSLIDI---GPQRSDIEVYRIPANDIANQMGNLKIANSIMIGALMSLKNIVSEDAVINAFKKVFEGK--EKLIPINIQAYNRGKESI.... 176
317 7.000e-70gi|521284011|ref|WP_020448279.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family protein [Candidatus Methanomassi  clstr ali  45  3......TLEVRWHGRGGQGIVTANEILAGAALYEGKFMKAFPEFGPERMGAPIRAFARVSDEPIKVHSQVYFPDYVAVLDPTLININVLEGLKETGSLIVNNTASVSELKKTLDTDMDVHVVDASKIALETIGKPLANTAMLGALVKISGIVGLDSIIAEMQIKLGGKLPAPVVEKNVLSVKRAYEEVQ... 186
324 1.000e-69JGI.Meta 7007347930 SRS016095_WUGC_scaffold_29363__gene_72915 hypothetical protein [Human Stool microbiome from visit number 1 of subject 76  ali  26  2...............GGQGVLSMGKILAYAALMEGKEVSWMPSYGPEQRGGTANVTVIISDQRISSPILSRY-DTAVILNQPSLEK-FEPCIKPGGTLIYD---GYGITEPPRRKDIAVYRIDAMDTAAELHNPKGFNMIVLGGLIKVRPLVETENVIQALKKTLPERH-HALIPMNEEALRRGMEVI.... 168
395 3.000e-68gi|630829780|gb|KCZ71493.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Candidatus Methanoperedens nitroredu  clstr ali  39  1......MKEIRIHGRGGQGSVTAAELLAVAAFEDGKYSQAFPAFGVERRGAPVTAFVRLSDKPIRLRSQIYEPDYVIVQDATLVDVDVEKGAKCDGIILINTEKNPSSFKFDTKASIK--TLDATKLAMDFIGKPIVNTTLIGAFAGVSGLIRPESIINAVMERFPG----PIGEKNAKAIQAAYDLME... 178
406 4.000e-68gi|494124555|ref|WP_007064332.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma, partial [Clostridium carboxidivorans]  clstr ali  27  5........QIIFAGFGGQGILSMGKFLAYAGMDANLNVSWLPSYGPEMRGGTANCSVILTDEAIGSP-IVTKADTIVVMNRPSLEK-FEDIIEPNGVIIMDSDLVDIV---PKRKDVKVISIPAQTIAEEIGSKKIANMILLGALVKETGIVSIE----ALLDSLKAHGKEKFFESNKNAIQKGIDFVK... 176
458 7.000e-67gi|504626178|ref|WP_014813280.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Desulfomonile tiedjei]  clstr ali  44  1......MIEMRFHGRGGQGAVTCAELVAQAAIDTGRYATAFPSFGPERRGAPVIAFARVDEQPIRLRSKIYAPDVVVVLDPSLLDIASPAGLRDNGILIVNSPYDPETLKKHLGYQNRIAVVDAGRIAREVLGLPITNTTMVGALVKGTGIMDVESLKAPFRKRFG-----KIADRNIQAMERAFNE..... 177
476 2.000e-66JGI.Meta 7006447484 SRS013818_Baylor_scaffold_31672__gene_36889 2-oxoglutarate oxidoreductase, gamma subunit [Human Tongue dorsum microbiome  ali  22  20.................QGVLSMGKILAYSGLMEDKEITWMPAYGPEQRGGTANVTVIISDDRISSPILSKY-DVAIVLNQPSLDK-FEPKVKPGGLLIYD---GYGVFNPPTRKDITVYRINAMDKAAEMKNAKVFNMIVLGGLLKVCPVVSTDGLKKALFKSLPERH-HKLIPLNMEAVEEGMKII.... 184
477 2.000e-66gi|521284463|ref|WP_020448731.1| 2-oxoglutarate ferredoxin oxidoreductase, gamma subunit [Candidatus Methanomassiliicoccus intestinalis]