current user: public




Query: TM0015 TM0015 281896 PDB-2007-09-14, from T.maritima

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# E-value Template Links and tools%idFirst MPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIGDEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKICVVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRALRRGYEEVKCSELast
1 3.000e-93gi|501542475|ref|WP_012547593.1| pyruvate synthase [Dictyoglomus thermophilum]  clstr ali  56  1...MKDMLEIRWHARAGQGAKTASYLLAETAMEAGKYIQAFPEYGPERTGAPMKAYTRISDKPIRIHSQIYNPDVVVVLDKTLIGKNVLEGLPSDGIIIVNTTQPPEEIREQLGSDRKIYTVDATGIALETIGRPIPNTPMLGALIRVVPIISLDEVLNQFRKKFEGRFKPEVIEGNLQAIKRAYEEVKGE. 190
2 9.000e-91gi|647308788|ref|WP_025748644.1| pyruvate synthase [Caldicoprobacter oshimai]  clstr ali  50  1...MGRMIEIRWHGRGGQGAKTASLLLAEAAFDTGKYVQGFPEYGPERMGAPITAYNRISDEPITIHSNIYEPDYVIVVDETLVSVDVTAGLKKDGAIVINSAKDPEEFRPLLGFEGKIYTIDARKISVEELGRYFPNVPMLGAIAKITKLMDEDAFIEAMERSFHHKFKPHVIEGNMRALKRAMREVK... 190
3 1.000e-90gi|737176300|ref|WP_035162480.1| pyruvate synthase [Caloranaerobacter azorensis]  clstr ali  47  1..MAKQMIEIRWHGRGGQGAKTASLLLAEAAFATGKFIQGFPEYGPERMGAPITAYNRISDSKIRIHSNIYEPDYVVVVDETLLDVDVTAGLKKEGAIVINSEKSPEELRPLLGYEGRVYTIDARKISIETLGKYFPNTPMLGAIVKVANIMEEEDFLKAMEESFAHKFKPEVIEGNMEAIKRALKEVKGDE 194
4 5.000e-90gi|2052278|emb|CAA59455.1| gamma subunit of pyruvate ferredoxin oxidoreductase [Thermotoga maritima MSB8]  clstr ali  99  22MPVAKKYFEIRWHGRAGQGAKSVSQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIGDEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKICVVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRALRRGYEEVKCSE 213
5 8.000e-90gi|496185119|ref|WP_008909626.1| pyruvate synthase [Caloramator australicus]  clstr ali  48  1...MGKLVEIRWHGRGGQGAKTASLLLAEVAFNTGKYIQGFPEYGPERMGAPITAYNRISDEPITIHSNIYEPDYVVVVDETLIKVPVTAGLKEGGAVIVNTAKSPEEIKKELNFNGKVYTIDARKISEETLGAYFPNTPMLAAVVKITGVIPVDVFLNDIEASFKHKFKPHVVPKNMEAVKRALEEVKGNE 192
6 2.000e-89gi|306490885|gb|ADM95003.1| hypothetical protein [uncultured candidate division JS1 bacterium]  clstr ali  53  1...MKKIIEVRWHGRGGQGAVTASKLLATSALAEDKYIQAFPEYGPERMGAPIQSFTRISDEPIKIHCHVTNPDMVVVLDPTLITVDITEGLSEDGIIVVNTSESPAQIRKKLNLKGKIFTVDASKIALEELGRSLPNTPMIGALIRATGLLKLENVINDIKDKFSGKFSQKIVDGNVNAIKRAYQEVKSE. 190
7 2.000e-89gi|503196055|ref|WP_013430716.1| pyruvate synthase [Caldicellulosiruptor kronotskyensis]  clstr ali  50  1...MGKMIEIRWHGRGGQGAKTASLLLAEAAFNTGKYVQGFPEYGPERMGAPITAYNRISDEKITIHSNIYEPDYVVVVDETLISVDVTKGLKKDGAIIVNTSKSPEEVKKMLGFDGKVYTIDARKISMECLGKYFPNIPVLGAVIKVTGIIPEEEAIKDMEGSLKHKFKPDVIEGNLKAFVRGMQEVQGE. 192
8 5.000e-89gi|737399027|ref|WP_035380393.1| pyruvate synthase [Fervidicella metallireducens]  clstr ali  47  1...MAKLVEIRWHGRGGQGAKTASLLLAEVAFKTGMYIQGFPEYGPERMGAPITAYNRISDEPLRVHSNIYEPDYVVVVDETLIKVPVTAGLKKDGAIIVNTSKTPEEIRKELKYDGRVYTIDARKISEETLGANFPNTPMLAAVVKVSGVISEEVLLNNMEDSFKHKFKPQVVPKNMEALKRSLQEVK... 189
9 2.000e-88gi|2622871|gb|AAB86210.1| pyruvate oxidoreductase, gamma subunit [Methanothermobacter thermautotrophicus str. Delta H]  clstr ali  47  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYSQAFPFFGVERRGAPVMAFTRIDDSPVRRRYQVYNPDYVVVLDEGLVDVDVFSGLKDDGVVVLNKSGDF------QGGDVKVHTIDATGIALETLGRPIVNTVMLGAFAGVTGLVSIDSLIKIIKETFPGK----IGEKNAEAARMAYEEIEK.. 175
10 5.000e-88gi|969855851|gb|ALU11717.1| pyruvate ferredoxin oxidoreductase subunit gamma [Ignicoccus islandicus DSM 13165]  clstr ali  48  4.......VEVRWHGRGGQGAVTASEIVAIAAISEGKYAQAFPSFGVERRGAPVEAYTRISDSPIYVRSKIYTPDIMVVLDPTLLEPRLAQGLKEGGTVIVNTEKSPEEVKKILREDAKVATVDATKIALETLKRPIVNTAILGAFVKVTGLVSLDSVLEAVKSKVPPRT----VEANIEAVKRAYEEV.... 181
11 5.000e-88gi|503547538|ref|WP_013781614.1| pyruvate synthase [Mahella australiensis]  clstr ali  53  1...MGKMIEIRWHGRGGQGAKTASLLLAEALFNTGKYIQGFPEYGPERSGAPLTAYNRISDEPIRVHSNIYEPDYVVVVDETLLSVDVTAGLKETGGIVVNTPKSPEEIRHYLKDKGKVGTVDAKKISEEELGRYFPNVPMLGAIMAMTGLVEKEQFIKSMEESFHHKFKPEVIDGNVRALKRAMEEVRI.. 191
12 2.000e-87gi|516898213|ref|WP_018154510.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanothermococcus thermolithotrophicus]  clstr ali  43  1......MIEIRFHGRGGQGAVTAAQILAKAAFFDGKFCQAFPFFGVERRGAPVMAFTRIDDRKIRLRSQIYKPDYVVVQDPTLLDVDVTSGLKKGGKLIINT------LKDVKMDDYEVYPIDATGISLEVLGLPIVNTTMLGAFAGATNEVTLESLKKAILETFPGK----LGQKNAEAAEVAYNRIK... 174
13 3.000e-87gi|652832935|ref|WP_027116761.1| pyruvate synthase [Lachnospiraceae bacterium P6B14]  clstr ali  48  1..MNDDMIEIRWHGRGGQGAKTASQLLADAAFSAGQYVQSFPEYGPERSGAPITAYNRISKERCNIHSNIYDPDYVVVVDETLLEVDVTAGLSPDGAIIVNTEKDPAEIRPHLGYTGRVCTIDARKISIDCLGKYFPNTPMLAAVVAVSGCVEKDSFLKDMEASYSHKFKPQVIEGNLKCLRRSMKEVKEE. 193
14 3.000e-87gi|985671923|gb|KXB02692.1| pyruvate synthase [candidate divison MSBL1 archaeon SCGC-AAA261D19]  clstr ali  51  3......MVEINWHGRGGQGVITASELIAEAALPEGKYVQANPEFGPERMGAPVRAFTRISDEKIDIHSNIYEPDIVVVLDPTLLQVNITEGLQEDGVLIVNTSKSKDEIRKLTGFGGEVHTLDATKIALENIGRPIVNTSCSGALIKITGLVSLENLKDKIRKKFEKKLSSKALEGNLKAVDEAYAEVE... 186
15 4.000e-87gi|931542654|gb|KPL18197.1| pyruvate synthase [candidate division Zixibacteria bacterium SM23_81]  clstr ali  50  1...MTEMTEIRWHGRGGQGAVTAAKILAQAALGEGRHIQAFPEYGAERRGAPVRAFTRISEEPIYIHSPIHTPDAVAVLDSTLLDVDVTEGLPEAGILVVNTLESPGTIRKRLTLKGKIFTVDATQISIDCIGKPIPNAPMIGAVMKATGILPLEGLVDGFRNKFSEKFRPEVIKGNIKAIKRAYKEVKTE. 190
16 1.000e-86gi|524187373|emb|CCZ55730.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:1219]  clstr ali  47  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDTPIRIHSNIYEPDYVVVVDDTLLHVDVTKGLKSDGAILINTQKSPDEIKKLSDYKGHIYTIDATKISEDCLKANFPNTAMLSAIVKITSIMTKEDLIKNMEESFKHKFKPEVIAPNIEVIKRAYDEI.... 186
17 2.000e-86gi|1001925411|gb|KXS45817.1| pyruvate ferredoxin oxidoreductase, gamma subunit [Halobacteroidaceae bacterium T328-2]  clstr ali  48  1...MANLTEIRWHGRGGQGSKTASILLGKVASKTGKNIQAFPEYGPERMGAPVLAFNRISDEKLTVHCQVYSPDIVMVLDPTLLEVDVDEGVPADGTIIINTTLQPSEIKEKLGFDGKVFTVDANGISTEEIGAPFPNTPMLGALIKATGLLEFEGFKTEIKKEFEKKFKPEVIDGNMKSIERAYQEVKSE. 191
18 2.000e-86JGI.Meta 7006258450 C3059854__gene_175854 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Tongue  ali  51  31...MKDIVEIRWHGRGGQGAKTASLLLADAAFNTGKYVQGFPEYGPERMGAPITAYNRISGERSTVHSNIYEPDFVVVVDETLLTVDVTAGLKEDGAIVINSSKDPQELRALKGYKGKVCTIDARKISEEELGKNFPNTPMLAAIVKVSGVVPQEEFIKDMQASFEHKFKPAVIEGNMKALKRSMEEVK... 220
19 2.000e-86gi|928957884|ref|WP_053982449.1| pyruvate synthase [Lachnospiraceae bacterium mt14]  clstr ali  45  1...MNNVVEIRWHGRGGQGAKTASLLLAEAAFDTGKYIQGFPEYGPERMGAPITAYNRISDERVTIHSNIYDPDYVIVVDETLLDVDVTAGLKKEGAILINSEKTPEELAPKLGYEGRVCTIDARKISMETLGKYFPNTPMLGAIIKIAKIMDEDTFISSMEKSFKHKFKPQVIEPNMAAVKRALEEVR... 190
20 5.000e-86gi|974128815|gb|KUO43338.1| pyruvate ferredoxin oxidoreductase [Hadesarchaea archaeon YNP_N21]  clstr ali  44  1......MIEIRFHGRGGQGAVTAARLLAEAAFLEGKYCQAFPFFGAERRGAPVVAFARINENPIRTRTQIYEPDYVAVLDPTLVEVNITSGLKPNGMIILNSKKVPDSLK-----NRKVATVDATSIAVETLGAPITNTAMLGSLAKATGLVSLDSVEKVIKKYF----KGKLAEKNIPAVRAAYERTVIHQ 178
21 5.000e-86gi|503565409|ref|WP_013799485.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanotorris igneus]  clstr ali  44  1......MIEIRFHGRGGQGAVTAAQILAKAAFYDGKYCQAFPFFGVERRGAPVMAFTRIDDKKIRLRCQIYEPDYVVVQDATLLDVDVTSGLKNDGKVIINT------VKDIKLGDYDTYCIDATGIALDVLGVPIVNTTMLGAFAGVTGEVSIESLKKAIMETFPAK----LGEKNAKAAEVAYEAIEKYK 178
22 5.000e-86gi|653188041|ref|WP_027424363.1| pyruvate synthase [Lachnospiraceae bacterium AC3007]  clstr ali  45  1......MIEIRWHGRGGQGAKTASQLLADAAFMSGKYVQSFPEYGPERSGAPITAYNRISDERCLIHSNIYEPDFVVVVDETLIEVDVTSGLKEEGAVIINSSRSPDELRGSLGYRGRVCAIDARKISMDCLGSYFPNTPMLAAVVAVSGCVDREQFLSDMETSYRHKFKPQVIEGNLKCLKAAMEEVR... 187
23 6.000e-86gi|740494919|ref|WP_038325821.1| pyruvate synthase [bacterium MS4]  clstr ali  48  1...MKDMVEIRWHGRGGQGAKTASLLLADAAFNTGKYVQGFPEYGPERMGAPITAYDRISTERCTVHSNIYEPDYVVVVDETLLSVDVTAGLKADGAIVINSTKKPEELRRLKGYQGKVCTIDAGKISVETLGKNFPNTPMLGAIVKISGVVPEKEFIQDMEGSFRHKFRHQVIEGNIKALIRSMEEVQV.. 191
24 7.000e-86gi|502865756|ref|WP_013100732.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Methanocaldococcus infernus]  clstr ali  47  1......MIEIRFHGRGGQGAVTAAQILAKAAFYDGKYCQAFPFFGVERRGAPVRAFTRIDDKEILIRSQIYEPDYVVVLDPTLLDVNVLEGLKKDGAVIVNTVKDLD-------LGYKVYTLDATKIALDVLGVPIVNTSMVGAFAGATKLVSLESVKKAILETF----KGKLGEKNALAAEKAYNEI.... 172
25 1.000e-85gi|496289768|ref|WP_009001806.1| MULTISPECIES: pyruvate synthase [Clostridiales]  clstr ali  43  1...MDNMIEIRWHGRGGQGAKTAAMLLAEAAFDTGKFIQGFPEYGPERMGAPVTAYNRISNERILVHSNIYEPDYVVVVDETLMDTDVTAGLKKEGALLINSPKSPAEIREKGGYEGRIYTIDADRIAMETLGKNFPNTSMLSAVVKITKVEEEERFLESLQESFRHKHKPQMIEPNMQAAARAFREVKE.. 191
26 2.000e-85gi|974235252|gb|KUO75084.1| pyruvate synthase [Clostridia bacterium BRH_c25]  clstr ali  47  1...MGRLVEIRWHGRGGQGAKTASLLLADAAFSTGKYIQGFPEYGPERMGAPITAYNRISDERITIHSNIYEPDYVVVVDETLISIDVTAGLKETGAIIINTEKTPDEVRKYLKDKGKVCTINARKISEETIGKNFPNTPMLGAVVKVGGIMEPQKFLEDMKDSFAHKFKPEVIEGNMKAIERAMQEVQ... 190
27 2.000e-85gi|524620158|emb|CDD37457.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:356]  clstr ali  44  1...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDKPITIHSNIYEPDYVVVVDDTLLSVPVTAGLKKEGAIVINTTKKPEELKELLGYDGSVYTIDARKVSEEALGRYFPNTPMLAAIVKVAGVMTDEELLEDMKTSFKHKFKPEVIDGNMKALEFALKEVTKIQ 193
28 2.000e-85 GL0069822 unmapped_[Complete]_[mRNA]_locus=scaffold134630_1:619:1197:-  ali  41  1..MMKDMTEIRWHGRGGQGAKTACLLLADAAFTAGKYVQGFPEYGPERMGAPITAYNRISEERCSIHSNIYEPDYVVVVDETLLEVDVTKGLNPEGAIVINSERSAAELRPMLRYEGRVYTIDARKVSEECLGKYFPNTPMLAAIVEVSRVLEPEQFIADMEASFRHKFKPQVVEGNMQCLKRAMKEVRA.. 192
29 2.000e-85 GL0054011 [Complete] locus=scaffold56418_1:3183:3764:+  ali  46  1...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSNIYEPDYVVVVDDTLLEVEVTDGLKEDGAIIINTTKNYDYLKNVLGYNGKVYTIDAREISMEALGKYFPNTPMLAAVVKVTGIMTDEEFLNDMQGSFKHKFKPEVIDGNMKALQLALNQV.... 189
30 3.000e-85gi|524617324|emb|CDD35864.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Roseburia sp. CAG:309]  clstr ali  45  1...MSELTEFRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYDRISDTEIRVHSNIYDPDYVVVVDETLLHVHVTEGLKEDGAILVNTAKTSDEIRPLLGYKGRVYTIDAREVCMKTLGKYFPNTPMLAAIVKISKIMEEENFIKEMEASLSHKFKPEVLEGNMQALRLAMQEVRGDE 193
31 3.000e-85 GL0136813 [Complete] locus=scaffold56170_2:845:1423:+  ali  47  1...MENLIEIRWHGRGGQGTKTASLLLADAAFNTGKYIQGFPEYGQERRGAPITAYNRISDDPITVHSNIYEPDYVVVVDDTLLEVDVTAGLKTNGAIVINTTKSEDYLKSVLGYKGKVYTIDARKVSTQALGRYFPNTPMLAAIVKVTGIMNDEDFLKDMEGSFKHKFKPEVIDGNMKALEMALKEVKE.. 191
32 4.000e-85JGI.Meta 7005598743 C2537626__gene_195209 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  47  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISETPIRVHSNIYEPDFVVVVDDSLLDVDVTKGLKPEGAILINTAASIDSIRQKLGFEGKIYTINASKISKECLKANFPNTAMLSAIIKITGIMTKEELLKDMEESFKHKFKPEVIEPNMEAIKRAYDEI.... 186
33 4.000e-85gi|503151903|ref|WP_013386564.1| pyruvate synthase [Ilyobacter polytropus]  clstr ali  47  1...MSNLVEIRWHGRGGQGAKTASLLLADAAFTIGKFVQGFPEYGPERMGAPITAYNRISGEKIRVHSNIYEPDYVVVVDDTLLSVDVTKGLKKEGAIIINTSIPKEILSKLKKYDGNVFLCDARKISEESLGKNFPNTPMLGAVVKVSGIMSEEEFLGSMEESFKHKFKPEVIKGNMKALKVSMGEVKICE 193
34 7.000e-85gi|524549207|emb|CDC78920.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:465]  clstr ali  48  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDTPIRIHSNIYEPDYVVVVDDSLIGVDVTSGLKDNGAIVINTNEDIDSLRKKLGFSGKIYTIDASKISLECLKANFPNTAMLAAVVNITKIMSKEELVDNMKDAFSHKFKPEVIEPNMEALLKGYDEIK... 187
35 7.000e-85gi|524597338|emb|CDD17852.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:798]  clstr ali  44  1...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDAPITIHSNIYEPDYVVVVDDTLLEVDVTAGLKEEGAIVINTTKNYDYLKNVLGYKGKVYTIDARAISMEALGKYFPNTPMLAAIVKVSGIMTDEEFLNDMQGSFKHKFKPEVIEGNMKALQLALNQV.... 189
36 1.000e-84 GL0003926 [Complete] locus=scaffold66995_3:253:834:-  ali  48  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPMTAYNRISVNPIRVHSNVYEPDYVVVVDDTLLSVPVTDGLKEEGAIIINTTKGIDEIKPLLGYNGNVYTIDAKKISEEALGKYFPNTPMLAAIVKVTEIMEDEAFIKDMEGSFKHKFKPEVIDGNMQAIKEALKQVKKVQ 193
37 1.000e-84 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-  ali  44  1...MSELTEFRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYDRISDTEIRVHSNIYDPDYVVVVDETLLHVHVTEGLKEDGAILVNTAKTSDEIRPLLGYKGRVYTIDAREVCMKTLGKYFPNTPMLAAIVKISKIMEEEKFIQEMEASLSHKFKPEVLEGNMQALRLAMQEVRGDE 193
38 1.000e-84gi|737672735|ref|WP_035642051.1| pyruvate synthase [Lachnospiraceae bacterium FE2018]  clstr ali  47  1...MKNTVEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAFNRISKEKIRVHSNIYEPDYVVVVDETLLHVNVTDGLKEEGAIIINTPRSKEEVLPQLGYKGRVVTIDARAISEQTLGKNFPNTPMLAATVAVTKVLERDQFINDMRASFEHKFKPEVIDGNMKALEMAYEAV.... 189
39 1.000e-84JGI.Meta 7052105202 C3508723__gene_217263 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  44  4...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGKNVQGFPEYGPERMGAPITAYNRISSDEIRVHSNIYHPDYVVVVDETLLHVDVTAGLKEQGAIVVNTPKSPQEIAPQLGYKGKVYTVDARKISVETLGKNFPNSPMLAAIVAVSKVMDKDTFIREMKNSYQHKFKPEVIDGNMKALEVAYDAVIAHE 196
40 2.000e-84 GL0066660 [Complete] locus=scaffold14074_1:79:696:+  ali  46  13...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDCPITIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTTKDENYLKNALGYNGNIYTIDARKVSMETLGKYFPNTPMLAAIVKVSHIMSDEELLNDMEGSFKHKFKPEVIDGNMKALKMALNEVKK.. 203
41 2.000e-84gi|671613434|ref|WP_031582930.1| pyruvate synthase [Lachnospiraceae bacterium AC2028]  clstr ali  46  1...MEDMIEIRWHGRGGQGAKTASQLLADAAFMSGKYVQSFPEYGPERSGAPITAYNRISDERCPIHSNIYDPDYVAVVDETLLEVDVTAGLSEKGAIIINSSKDPEEFRPLLGYAGRVCTIDARAISIAYLGKYFPNTPMLAAVVEVSGCVDKEQFLKDMESSYRHKFKPQLVEGNLQCLRAAMKEVR... 190
42 2.000e-84gi|524005656|emb|CCX85884.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:590]  clstr ali  47  1...MKNTVEIRWHGRGGQGAKSAALMLADAAFMTGKHVQGFPEYGPERMGAPITAYNRISEDPIRVHSNIYDPDYVVVVDETLLEVDVTNGLNPEGAIVINTTKSVEEVKPHLGYPGKVYTLDAREISEKCLGRYFPNSPMLAAIVAISKVMTKEDFFREMEGSYKHKFKPEVIEGNLKALHMAYEEVE... 190
43 2.000e-84gi|156567027|gb|ABU82432.1| pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Ignicoccus hospitalis KIN4/I]  clstr ali  48  9.......VEIRWHGRGGQGAVTASEIVAKAAIAQGKYAQAFPSFGVERRGAPVEAFTRIDEKPIYIRSKIYEPDIIVVLDPSLLGPKLAEGLKEGGMAIVNTEKTPDEVRKLLREDVKVAVVNATKIALETLKRPIVNTAILGAFAKATGLVDLDALLEAVKEKVPPRT----VEANLEAVRRAYEEV.... 186
44 2.000e-84gi|524800911|emb|CDE96671.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:567]  clstr ali  45  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRIGNTPIRIHSNIYEPDYVVVVDDSLLEVDVTAGLKPDGAIVINTTKSGNELKPLLGYTGDVYTIDARKISLETLGKYFPNTPMLAAIVKVSGVIEEKDFLADMEGSFKHKFKPEVIDGNMKALEMALKEVNK.. 191
45 2.000e-84 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2  ali  46  15...MKEIFEIRWHGRGGQGAKTASLLLADAAFSGGMYVQGFPEYGPERMGAPITAYNRISKERVTVHSNIYEPDFVVVVDETLIEVDVTKGLKEDGAIIINSSKPASEFKALLGYKGRVYTCDARTISEETLGKNFPNTPMLGAVVKVSGVMEEKAFLEAMENSFAHKFKPEVLKGNMAALVRSMNEVKE.. 205
46 2.000e-84gi|501539343|ref|WP_012544830.1| pyruvate synthase [Coprothermobacter proteolyticus]  clstr ali  56  1...MTVLLEIRWHGRAGQGVKTAAYLLAEAAMDTGKYIQAFPEYGAERSGAPIAAFTRIGDEPIRIHYGIRTPDVVVVVDESLIGMDVTSGLKENGILLVNSNQSPEIYRQKLPFHGKIATVDATQIALDCIGRPIPNIPIMGALIRASGIVSLEDLEPRLRHKFSAKFSEQVVEGNVKALKRGYEEVKI.. 189
47 3.000e-84gi|973075650|gb|KUK39265.1| Pyruvate synthase subunit PorC [Synergistales bacterium 54_24]  clstr ali  76  1..MPVKYFEVRWHGRAGQGAKSASQMLAEAALGAGKHVQAFPEYGAERSGAPMKAFNRIGDVPVLVRSSVENPDVVVVIDDTLLSPAVAEGLSDDGVLLVNTAKDAAFVAEKTQLKGKICTVNATEIALQEIKRGIPNTPMLGALAKVTGVVTPEALEARIEEMFGDKFPKEVVEANKRALKRGYEEVRCSQ 190
48 3.000e-84gi|497932453|ref|WP_010246609.1| pyruvate synthase [Acetivibrio cellulolyticus]  clstr ali  47  1...MGKVVEIRWHGRGGQGAKTASLLLADAAFNTGKFIQGFPEYGPERMGAPITAYNRISDEKLTIHSNIYEPDYVVVVDDTLISVDVTAGLKEDGAIIVNTTKSPEELKPLLGYKGKVCTIDARTISIDTLGKYFPNTPMLGAVVKVSRVMNEQEFLKDMVDSFKHKFKPEVVEGNIKALERSMQEVK... 190
49 4.000e-84 GL0095983 [Complete] locus=scaffold5611_1:8785:9366:+  ali  47  1...MSNLIEIRWHGRGGQGAKTASLLLADAAFNTGKFIQGFPEYGPERMGAPITAYNRISDEPITVHSNIYNPDYVVVVDDTLLEVDVTAGLKETGAIVINTTKDINYLSSVLGYKGKIYTIDARKVSMETLGRYFPNTPMLAAIVKVSNVMPEDAFIQDMEGSFKHKFKPEVIEGNMNALKLALKEIKV.. 191
50 4.000e-84gi|652499216|ref|WP_026893628.1| pyruvate synthase [Clostridiisalibacter paucivorans]  clstr ali  46  1..MSKEIVEIRWHGRGGQGAKTGSLLLAEAAFATGKYIQGFPEYGPERMGAPITAYNRISNEKIRLHSNIYEPDYVVVVDESLIDIDVTAGLKSEGAIVINSKKSPEEFRHLNGYKGKVYCIDAHQISMDTIGRYFPNTPMLGAIAKVINIMDGDTFLDAIEKAFQHKFKPNLIKGNMDAVKLAFEEV.... 190
51 4.000e-84gi|524842749|emb|CDF46198.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Roseburia sp. CAG:100]  clstr ali  45  1...MNKTVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEPITVHSNIYEPDYVVVVDESLLEIDVTKGLKKDGAVIINSERSKEELREHLGYEGAVYTVNAKQISLRTLGRNYPNSPMLAAAVAVSNVMERKEFLQEMRASFQHKFKPEVIDGNMQALELAFEEA.... 189
52 5.000e-84 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2  ali  47  1...MSNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDTPITIHSNIYEPDYVVVVDDTLLEVNVTAGLKKEGAIVINTTKSPDEVRLLKGYEGKVCTIDAKTISIDTLGKYFPNTPMLAAIVKVSGIMSDEEFLNDMIGSFKHKFKPEVIDGNMAALKRSLNEI.... 189
53 5.000e-84gi|833815757|gb|KLU40556.1| hypothetical protein AA931_03020 [Peptococcaceae bacterium 1109]  clstr ali  29  1......MTEIIIAGFGGQGVLVMGQLLANAGMLEGKEVSWYPSYGPEQRGGTCNCSVVISAGEIGSP-IVSEPDAVIVMNRPSLDR-FEPAVKPGGILVYNTTLVD---RAPERSDITAIGIPATAVADELGNSRIANMVALGAFLKASPVVSPESISRSLERVLSQRH-HHLIPLNMQALERG........ 172
54 5.000e-84gi|524785733|emb|CDE83564.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:273]  clstr ali  46  1...MNDMIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNTPIRIHSNIYEPDYVVVVDDTLLGVDVTAGLKPNGAIVINTTKDIDYLRKVLGYSGAIYTIDARKVSMETLGKYFPNTPMLAAIVKVANIMEENDFLKDMEGSFKHKFKPEVIDGNMKALEVALKEVKK.. 191
55 6.000e-84 GL0129383 [Lack 5`-end] locus=scaffold223479_1:38:667:-  ali  44  18...MNDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTKPITIHSNIYEPDYVVVVDDTLIEVDVTAGLKKTGAVVINTTKDGEYLKKHLGYEGEIYKIDARKISMETLGKYFPNTPMLAAIVKVSKVMTDEEFLNDMQGSFKHKFKPEVIEGNMKALEMALKEVE... 207
56 6.000e-84gi|671463414|ref|WP_031473320.1| pyruvate synthase [Eubacterium desmolans]  clstr ali  44  1...MNNMVEIRWHGRGGQGAKTACLLLADAAFASGKYVQGFPEYGPERMGAPITAYNRISDERCTIHSNIYEPDYVVVVDETLLSVDVTHGLSPKGAIVINTHKTPDEVRPLLRYEGRVYTIDARAISERTLGKYFPNTPMLAAIVKVSGVLDPWRFISDMEASFRHKFKPQVIEGNMECLTQSLKEVR... 190
57 6.000e-84gi|492554014|ref|WP_005884346.1| pyruvate synthase [Fusobacterium mortiferum]  clstr ali  47  1...MREIFEIRWHGRGGQGAKTASLLLADAAFSGGMYVQGFPEYGPERMGAPITAYNRISKNPVRVHSNIYEPDFVVVVDETLIEVDVTKGLKEDGAIIINSSKPASEVPFLKGYKGKVFTCDARTISEETLGKNFPNTPMLGAVVKVSGVMEEKAFLEAMEESFKHKFKPEVLKGNMDALIRSMNEVKE.. 191
58 7.000e-84JGI.Meta 7011748143 C1977199__gene_184467 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  48  7..SMKDIVEIRWHGRGGQGAKTASLLLADAAFNTGKYVQGFPEYGPERMGAPITAYNRISSERSTVHSNIYFPDYVVVVDETLLSVDVTAGLKKEGAIVINSSKSPAELRPLLGYEGRVCTIDAGKISEEELGKNFPNTPMLAAIVRVSGVIGEEEFIKDMEGSFKHKFKPQVIEGNMRALKRSLEEVQV.. 198
59 8.000e-84JGI.Meta 7051348970 SRS020328_Baylor_scaffold_37703__gene_96245 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate  ali  50  1...MKEIVEIRWHGRGGQGAKTASLLLADAAFNTGRYVQGFPEYGPERMGAPITAYNRISRERCTVHSNIYEPDYVVVVDETLLAVDVTKGLSEEGAVIVNSDKKPEELRGSLGYQGKICTVDAGRISEETLGKNFPNTPMLGAVVKVSGVIPEENFVKDMRQSFAHKFKPQMIEGNMRALVKAMQEV.... 189
60 9.000e-84gi|974235112|gb|KUO74956.1| pyruvate synthase [Clostridia bacterium BRH_c25]  clstr ali  45  1...MANLTEIRWHGRGGQGAKTSSLLLADVAFSTGKYIQGFPEYGPERMGAPITAYNRISDEKIRVHSNIYEPDYVVVVDQTLLQVPVTKGLKKSGAIVINTEKSPEAIKYLKGYEGKIYTIDAKKISEEALGKNFPNTPMLAAIVKISGIMDEGTFIEEMQHSFEHKFKPEVIEGNMKALKNALQEVK... 190
61 9.000e-84gi|524124838|emb|CCY99104.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:793]  clstr ali  47  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTSPIRVHSNIYEPDYVVVVDDTLLKVDVASGLKEDGAIVINTTKIDEIAPLLKGYKGSVYTIDARKVSEEALGKYFPNTPMLAAIVKVAGIMPEADFIKDMQDSFKHKFKPEVIDGNMKALKLALEQVKKIQ 193
62 1.000e-83gi|493931494|ref|WP_006876067.1| pyruvate synthase [Anaerotruncus colihominis]  clstr ali  48  1...MKDIVEIRWHGRGGQGAKTASLLLADAAFNTGKYVQGFPEYGPERMGAPITAYNRISSERSTVHSNIYEPDYVVVVDETLISVDVTAGLKKEGAIVINSGKSPAQLRPLLGYAGRVFTIDAGRISEEELGKNFPNTPMLAAIVKVSGVVEPDAFVKDMEASFHHKFKPQVIEGNMRALKRSMEEVQA.. 191
63 1.000e-83gi|9651770|gb|AAF91262.1|AF230199_4 pyruvate oxidoreductase delta subunit [Methanococcus maripaludis]  clstr ali  44  1......MKEVRFHGRGGQGAVTAAQILAKAAFYDGKFCQAFPFFGVERRGAPVMAFTRIDDEKIRLRSQIYEPDYVIVQDPTLMDVDVTSGIKDGGIILINTLKDI----KLNGYDVK--TIDATGIALDVLGVPIVNTTLCGAFAGLTGEVTIESLKKSILETFPGK----LGPKNADAAEKAYNLTK... 174
64 1.000e-83gi|944557707|gb|KQM10407.1| pyruvate synthase [Methanomassiliicoccales archaeon RumEn M2]  clstr ali  46  3.......LEICWHGRGGQGVVTANEILAETAIREGKYVKAFPEFGPERMGAPIRAFTRISDNPIRIHSQVYEPDIVVVLDGTLVGKDITGGLKKGGIVLVNTHGSPEEIKSALKTEEKCYTIDATKISIEELGRPMANTAILGALVKVAPIVAYSKLEDAVTAKFTGKLSEKLIVKNLTALKRAYEEVR... 185
65 1.000e-83gi|149734325|gb|EDM50242.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Eubacterium ventriosum ATCC 27560] :  clstr ali  48  20...MKDTLEIRWHGRGGQGAKTAALLLAEVAFKTGKNAQGFPEYGPERMGAPITAYDRISDQPIRVHSNIYDPQYVVVVDETLIEVDVTKGLREDGAILINTARPKEEIIPHLGYKGKVYTVDARKIAMETLGKNFPNTPMLAAIVKVTGVIDDETFLNEMEGSFKHKFKPEVIKGNMDALRIALREVK... 209
66 2.000e-83gi|851139534|ref|WP_048082851.1| MULTISPECIES: pyruvate ferredoxin oxidoreductase [Methanobacterium]  clstr ali  47  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYCQAFPFFGAERKGAPVMAFTRINDKPIRRRYQVYNPDHVIVLDETLLEVDVLSGLKEGGKVVINTTDSVN-----LGENVDPYSIDATGIALDILGVPIVNTVMLGAFAGVTNIVSLDSLIKVTKETFPGK----IGEKNANAAKIAYEKIKK.. 176
67 2.000e-83gi|671518532|ref|WP_031503951.1| pyruvate synthase [Pseudothermotoga hypogea]  clstr ali  71  1..MPTKYFEIRWHSRAGQGAKSAAQLVAETVLDEGKYAQAFPEYGAERSGAPMRAFNRISEGKIRVHYSVENPDVVVVIDDTLLSPTIVSGLKEDGVLIVNTKHSFDFVRKKTNFNGKVCIVNATDIALQEIKRGVPNTVMIGTLARVTGLVNLEVVEKKIREMFERKLPEEMIQANIRALRRGYEEVQ... 187
68 2.000e-83gi|1001907621|gb|AMM41367.1| pyruvate ferredoxin oxidoreductase, gamma subunit [delta proteobacterium HotSeep1]  clstr ali  45  1......MLEIRFHGRGGQGAVTCTELIAKAAIAEGKYAQAFPSFGAERRGAPVTAFLRVSDRPIRIRQNIYEPDVIVVLDPTLLGPGVSKGLKKNGFIITNSPKTPTEVKKEYDFEQKVATVDATKIALDTIRLPITNTTMLGAVIRATQIVSLESLAEVLEERFG-----RLAKRNQQAMERAFTETKI.. 179
69 2.000e-83gi|517059510|ref|WP_018248328.1| pyruvate synthase [Orenia marismortui]  clstr ali  45  1...MSDLIEIRWHGRGGQGSKTASILLGKVAAKTGKNIQAFPEYGPERMGAPVLAYNRISDKEITVHCQVTEPDIVSVLDPTLLDVDVTEGVPDNGVIIVNTEISASKLRDKIGFNGELYTVDAYGISTEEIGAPFPNTPMLGALIKATDLLDFEGFLSEMKNEFEKKHKPEVIEGNINSMKRAYQEVKS.. 190
70 2.000e-83JGI.Meta 7004221420 C4227057__gene_292349 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  47  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPLTAYNRISETPIRIHSNIYEPDYVVVVDDTLISVNVTQGLKENGAILINTNKSIDEIKNYFKDKGKIYTIDASKISRECLKANYPNTAMLSAIVKITGIMTKDELLKDMEESFKHKFKPEVIAPNMEAVKRAFDEV.... 186
71 2.000e-83gi|653148965|ref|WP_027398137.1| pyruvate synthase [Anaerovorax odorimutans]  clstr ali  49  1.MRKNNIVEIRWHGRGGQGAKTACLLLADVAFQSGKYVQGFPEYGPERMGAPITAYNRISEERCNIHSNIYGPDYVVVVDETLLSVDVTSGLKEDGAVIINSEKEPGELRHLLGYNGKIYTVDARKISEETLGRNFPNTPMLAAMVRVSNIIESEKFLEDMEKSFHHKFKPQVIEGNMKALRKSMEEV.... 191
72 3.000e-83gi|692121846|ref|WP_032078088.1| pyruvate synthase [Clostridium drakei]  clstr ali  48  1...MSKLIEIRWHGRGGQGAKTASLLMADAAFNTGCYVQGFPEYGPERMGAPITAYNRISTEKITVHSNIYEPDYVVVVDESLLEIDVTAGLKEEGAIVINTEKSPEEIKNHLRDKGKVCTIAAGKISEEALGKNFPNTPMLGAIVKVSGIMDEEAFVKDMEASFVHKFKPEVLKGNMEALKRSMEEVK... 190
73 3.000e-83gi|490741693|ref|WP_004604001.1| pyruvate synthase [[Eubacterium] cellulosolvens]  clstr ali  47  1...MDNTLEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAFNRISKDPIRVHSNIYYPDYVVVVDETLLHVHVTDGLKDEGAIIVNTSKTEEEIRPLLGYTGRVVVIDARDISEKALGKNFPNTPMLAAAVAVSGVMPKDDFIANMRESFGHKFKPEVIDGNMKALEDAFKAV.... 189
74 3.000e-83gi|653227415|ref|WP_027439914.1| pyruvate synthase [Lachnospiraceae bacterium AC2031]  clstr ali  46  1...MSKAVEIRWHGRGGQGAKTAALLLADVAFNTGMYVQGFPEYGPERMGAPITAYNRISEKEIRNHSNIYNPDYVVVVDETLLHVDVTSGLNKDGGIVINTARPKEEIIPLLGYEGAVYTVDARTISLETLGKYFPNSPMLAAIVKVSGIMSKQDFLEQMRGSYQHKFKPEVIDGNMAALERAFEEVQ... 190
75 3.000e-83gi|503588911|ref|WP_013822987.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfotomaculum kuznetsovii]  clstr ali  28  1......MYEILIAGFGGQGVLSTGQLLAYAGMLEGKHVSWIPSYGPEMRGGTANCGVTISDSPISSP-VVTEPTSLIVMNRPSLEK-FEGSVVPGGLILINSSLVDI---KATRKDVRVYYIPANELAEELGNARVAGNVILGALLELTGVVSLDAVEKSLREVLPA-HRHKLIPLNRQALETGAALVR... 178
76 5.000e-83 GL0091539 [Complete] locus=scaffold21813_2:343:915:-  ali  44  1...MNKTVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEPITVHSNIYEPDYVVVVDESLLEIDVTKGLKREGAVIINSERSKEELRKHLGYEGSVYTVNAKQISMRTLGKNYPNSPMLAAAVAVSNVMERKAFLQEMRASFQHKFKPEVIDGNMQALELAFEEA.... 189
77 5.000e-83gi|916993964|ref|WP_051600676.1| pyruvate synthase [Eubacterium sp. AB3007]  clstr ali  47  1...MGNTVEIRWHGRGGQGAKTACLLLADAAFSSGKQVQGFPEYGPERMGAPITAYNRISDDKNRVHSNIYHPDYVVVVDETLLHVDVTAGLSEDGAIIVNSKRSPEDVRAQLGYEGKVCTVDAGTISREALGRNFPNTPMLAAAVKVSNVIEKDRFLKDMEESFRHKFKPQVVEGNMKALKMSMDQVKVA. 192
78 6.000e-83gi|1012046965|gb|KYO66099.1| Pyruvate synthase subunit PorC [Thermovenabulum gondwanense]  clstr ali  53  1...MAKVLEIRWHARGGQGAKTAALMLAESVAEMGKYVQGFPEYGPERMGAPILAFNRISDEPIFVHSNVTNPNIVIVLDPTLLGKKITDGVPEDGIYIINTSKTPQEIRKILGTTGKIFTIDATQISIETIGRPIPNTPMMGAFIRATGIIPFETFMEHMKEQLGKKFKSKVIEGNLKAIERAYMEVKSE. 192
79 8.000e-83gi|242265753|gb|ACS90435.1| pyruvate:ferredoxin oxidoreductase (POR) and 2-ketoisovalerate:ferredoxin oxidoreductase (VOR) subunit gamma [Thermococcu  clstr ali  45  2......MIEIRFHGRGGQGAVTAANILAEGAFLEGKYVQAFPFFGVERRGAPVTAFTRIDEKPIRIKTQIYEPDVVVVLDPSLLDVDVTAGLKEGGLVIVNTEKTKEEVEKLKKKPAKLALVDATTIALEILGLPITNTSILGAVAKATGIVKIESVEEAIKEAFSG----ELGEKNAKAAREAFEKTVVYE 185
80 8.000e-83 GL0030712 [Complete] locus=scaffold40327_1:6741:7379:+  ali  48  20...MDNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGAERMGAPITAYNRISTAPIRIHCNIYNPDYVVVVDDTLLNVDVTSGLKESGAIIINTTKDGETLKRLLGYKGHIYTIDARTVSVEALGKYFPNTPMLAAVVKVTGIIPEEDFLKDMEGSFKHKFKPEVIEGNMKALEIALQKV.... 208
81 8.000e-83gi|503042057|ref|WP_013277033.1| pyruvate synthase [Acetohalobium arabaticum]  clstr ali  48  1...MANLTEIRWHGRGGQGAKTASILLGKVASKTGKNIQAFPEYGPERMGAPVLAFNRISDEELTVHCQVTEPSIVTVLDPTLLEVDVTEGIPADGKIIINTTKSPTDVKKELDFEGEVYTVDADGISTDEIGAAFPNTPMLGALVKVTDLLEFDNFKEQVEKEFKKKFKPEVIDGNMKSIERAYQEVKSE. 191
82 8.000e-83gi|505138643|ref|WP_015325745.1| 2-oxoacid:acceptor oxidoreductase subunit gamma [Methanomethylovorans hollandica]  clstr ali  42  1......MKEIRIHGRGGQGSVTAAELLAVAAFADGKFSQAFPAFGVERRGAPVQAFTRMDDTPIRLRSQVYEPDYVIVQDPTLIEVDVASGLKEDGIIIINSEFDPSTFK--LNTKAKVVTVNATKIALEIIGRPIVNTVLLGAFAGATGNIRPESIKEAVKERFPGK----VGERNAEAIQQAYDMMKEA. 180
83 9.000e-83gi|939572394|gb|KPV62311.1| Pyruvate/ketoisovalerate oxidoreductases common subunit gamma [Candidatus Bathyarchaeota archaeon BA1]  clstr ali  44  1.MMPNDVKEIKWHGRGGQGAVTAAEVIAISAIDEGKYAQAFPSFGPERRGAPVEAFTRISNEHIYLKCQVYHPDIVVVLDPTLLEVNVIEGLKDEGMLIINTEKPPKQVKQELNAKIRIATVDATKIALKEIGRPITNTAILGAFIKATNLVGLDSTAKVLM----SRFKGETAEMNVRAMKRAYEET.... 184
84 1.000e-82gi|553306669|ref|WP_023052085.1| 2-oxoacid:acceptor oxidoreductase subunit gamma [Cetobacterium somerae]  clstr ali  45  1...MSKMVEIRWHGRGGQGAKTASLLLADVAFSSGMYVQGFPEYGPERMGAPITAYNRIGNEPIRVHSNIYEPNFVVVVDETLIKIEVEKGLKEGGAIIVNSERSPEELRAELRYTGRLYTCNARKISEECLGKYFPNTPMLGAVVKVSELIPEAEFIKNMEESFKHKFKPQVLEGNMCALKRSMDEVE... 190
85 1.000e-82gi|648287783|ref|WP_026068932.1| pyruvate synthase [Methanomassiliicoccus luminyensis]  clstr ali  46  2.....RTLEIRWHGRGGQGVVTANEILAGAALQEGKYMKAFPEFGPERMGAPIRAFARVSDEPIKVHSQVYFPDYVIVLDPTLINVNVLEGMKADGGLIVNYPDGKDHLRKALATDLEVHVVDGTKIALETVGRPLANTAMLGALVKVSGIVELDSVKDELRAKLGGKLPQKVVEKNVLSVERAYQEV.... 185
86 1.000e-82gi|506213460|ref|WP_015733235.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanocaldococcus vulcanius]  clstr ali  41  1......MIEVRFHGRGGQGAVTAAQILAKASFYDGKFCQAFPFFGVERRGAPVMAFTRIDDKKITLRCQIYEPDYVIVQDPTLLEVNVVDGLKENGAVIINT------VKEDLDLGYKTYTIDATGIALDVLGVPIVNTAMVGAFAGVTKLVSIESVKKAILDTF----KGKLGEKNAKAAELAYNEIKKY. 177
87 1.000e-82gi|493348553|ref|WP_006305281.1| 2-oxoglutarate oxidoreductase gamma subunit [Caldisalinibacter kiritimatiensis]  clstr ali  27  1......MQEIIMAGFGGQGVMSMGQLLTYAGMIENKNVSWLPSYGPEMRGGTANCNVMVSDTPVGSP-IVTEATAAIVMNRPSLDK-FEKDVVKDGNLLINSSLID---KKAERDDINVYYIPANEIAVELGNAKVANMVMLGAYLELTKVVKSESVLEALKKVFGE-SKKHLIPLNEKALQRGAEEVRK.. 179
88 2.000e-82gi|550908677|ref|WP_022661777.1| pyruvate ferredoxin oxidoreductase subunit gamma [Desulfovibrio longus]  clstr ali  46  1......MIEIRLHGRGGQGGVTSAELLARAAIAEGKFAQAFPSFGPERRGAPVMAFVRVDDKKIRIREKVYNPDVVLVLDPTLLDVDVSEGLKEGGTVVVNTGQSPDELKKKYGFP-KVACVDANKVALEELGVPITNTTMLGALLRATGIVEVDHMEAVIADRFG----PKLGPKNYNALKRAHGETRAA. 181
89 2.000e-82JGI.Meta 7058552834 SRS011529_WUGC_scaffold_22421__gene_43009 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate f  ali  44  7...MDNMIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTAPIRIHSNIYEPDYVVVVDDSLLEVPVTAGLKETGAIIINTTKDVNALKLLNGYKGNVYTIDARKVSIEALGKYFPNTPMLAAIVKVSNIMSEEEFLNDMEGSFKHKFKPEVIEGNMKALTLALKEVK... 196
90 2.000e-82gi|551036943|ref|WP_022780690.1| pyruvate synthase [Lachnospiraceae bacterium NK4A136]  clstr ali  45  1...MSKLTEIRWHGRGGQGAKTAALLLADVCFKIGKNVQGFPEYGPERMGAPITAFDRISDNPIRVHSNIYEPDFVVVVDETLLHIDVTKGLKKDGAILINTDRKAEDLIPQLGYKGKVFTIDAREVCMKTLGKYFPNTPMLAAVVKITGLMEPERFLTEMEESLKHKFKPEVLEGNMKALKLALEEV.... 189
91 2.000e-82 GL0524513 unmapped_[Complete]_[mRNA]_locus=scaffold331974_1:35:625:-  ali  45  3.KRLNEAVEIRWHGRGGQGAKTACLLLADVAFSSGKHVQGFPEYGPERMGAPITAYNRITDEHCKVHSNIYKPDYVVVVDETLLKVDVTKGLKEKGALIINSKKSPEEIRPLLGYKGKVCTIDAEKISMDALGKNFPNTPMLGAVVKVSHVIDQERFIQDMKESFQHKFRGKLIEGNMSALKKSMEEVKV.. 195
92 2.000e-82gi|933756060|ref|WP_054331263.1| pyruvate synthase [Clostridia bacterium UC5.1-2F7]  clstr ali  46  1...MKKLTEIRWHGRGGQGAKTASLLLADVAFSTGLYIQGFPEYGPERMGAPITAYNRLSNEPIRVHSNIYEPDYVVVVDETLLDVDVTAGLKPEGGIVINSAKDPAELRKLKGYTGKVYTIDAKKISIECIGRNMPNTPMLAAAVKASGFMDEKLFLENMEASFKHKFKPEVIAGNMKALEVSLKEVQ... 190
93 4.000e-82gi|645065613|ref|WP_025436744.1| pyruvate synthase [Eubacterium acidaminophilum]  clstr ali  48  1......MLEIRWHGRGGQGAKTASLLLADVAFNTGKYVQGFPEYGPERMGAPITAYNRISDEKITIHSNIYEPDFVVVVDESLLEVDVTKGIKEGGAILINTDKNAEEIKNSLGFNGTIYTIDARAISEKCLGRYFPNTPMLAAAVKICGIMEDEAFLREMQGSFEHKFKPEVIEGNMNALKMAIAEV.... 186
94 4.000e-82 GL0048677 unmapped_[Complete]_[mRNA]_locus=scaffold18464_1:2342:2920:+  ali  42  1...MKDLIEIRWHGRGGQGAKTAALLLADVAFNNGLYVQGFPEYGPERMGAPITAYNRLSRNPIRVHSNIYEPDYVVVVDESLIEVDVTAGIKEGGAIIINSHKSSNELKPEKGYHGHIYTIDARKISIETLGKYFPNSPMLAAVVKITGVMEEKAFLEDMRKSYAHKFKPSVIDGNMKALEIALKEV.... 191
95 4.000e-82gi|500836055|ref|WP_012003807.1| MULTISPECIES: pyruvate synthase [Pseudothermotoga]  clstr ali  67  1..MPAKYYEIRWHSRAGQGAKSASQLLAEAVLDMGKYAQAFPEYGAERSGAPMRAFNRISDGKITIHSSVEKPNVVVVIDDTLLSPAVVEGITEDGVLIVNTTHPVDYIRKKTHFNGKICTLKATDIALEEIKRGIPNTVILGAVAKITNVVTLESLEQKIKNMFGKKLSEEMLEANLRALRRGYEEV.... 186
96 4.000e-82gi|974125696|gb|KUO40360.1| pyruvate ferredoxin oxidoreductase [Hadesarchaea archaeon YNP_45]  clstr ali  49  3......TIEIRFHGRGGQGAVTAARLLAEAAFLEGNYCQAFPFFGAERRGAPVVAFTRIDKRPIRTHEQVYRPNYVVVLDQTLVEVDVAAGLSPGGIVILNSKKAPENLKGK-----KIAIVDATKIAIETLGVPITNTTMLGALAKATGVVSLESIAKVIEKRFG-----KLAEKNINAAKRAFEET.... 175
97 5.000e-82gi|1016807455|emb|CVI71054.1| Pyruvate synthase subunit PorC [Eubacteriaceae bacterium CHKCI004]  clstr ali  45  1...MKDLIEIRWHGRGGQGAKTAALLLADVAFNTGMYVQGFPEYGPERMGAPITAYNRLSSDIIRVHSNIYDPDYVVVVDETLLDVHVTDGLKKDGAIVINTARPKEEILPHLGYEGKVYTIDARRISIEALGQYFPNSPMLAAIVKVSGIMEEERFLEEMRKSYAHKFKPEVIEGNMKALSLALQEVK... 190
98 5.000e-82gi|779987238|ref|WP_045426330.1| pyruvate synthase [bacterium UASB270]  clstr ali  50  1......MIEIRWHGRGGQGTVTAAKMLADASLQGGKYVQASPEYGAERMGAPLRAFNRISDEEIFLHCSITNPDIVVVVDPSLVTQAVTEGVKDSTTFVVNSPLSAQEVRKLLKFNGKVFTVDATKIALETFGRNIPNTPMLGALIQVTQILEKDTLVTQLKKSLQKKFGDKVVQQNVNAVERAFQEVTSDE 188
99 6.000e-82gi|503521538|ref|WP_013755860.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Thermodesulfobium narugense]  clstr ali  51  1...MKSYWEIRWHARGGQGAWTASQFLASAALSVNKYFQSFPEFGAEREGAPIVAYTKISDMPIKNYSQIEEPDAVVVLDPTLFSVNFLNGLKSDGYLIVNYPGDPKQLREELKPGIKVFTVDATKIALETLKRPITNTTMAGALVKATGILNFEDVVNEMIRSFSGKFKQEIIDANVNAIRRAYEEVKQ.. 190
100 6.000e-82gi|939572163|gb|KPV62087.1| Pyruvate/ketoisovalerate oxidoreductases common subunit gamma [Candidatus Bathyarchaeota archaeon BA2]  clstr ali  47  1...MKKMLEVRWHGRGGQGVWTASELLARAAISEGKYIQSFPEFGPERMGAPIRAFTRIGNEPIQMHCAVYNPDVVVVIDPSLLKVPVTEGLNDEGILIVNSKEPPAEIREMLKVERKIWTVPATEIAIKILNSPITNTAMLGAVARITGIVSLESVEKAVSELFSG----SIVEKNIGVIKEAYKEVKSE. 186
101 7.000e-82gi|825294449|ref|WP_047134940.1| pyruvate synthase [bacterium JGI-5]  clstr ali  54  1......MIEIRWHGRGGQGAKTAAMLFAETAIEEGKFAQGFPEYGPERMGAPVKGFTRIDDKPIRIHSGIENPRVVVVLDQTLLEIDVTEGMPEDGILIINTEKSPEQIRKQFGKKGKIYTVNATKIALDTIGRPIPNTVMLGALIKVTGVLDLDTLLKNIVKKFSKKFSDKVVEGNVQAIKKAFEEVKGE. 187
102 8.000e-82gi|502960259|ref|WP_013195235.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanohalobium evestigatum]  clstr ali  41  1......MKEIRVHGRGGQGSVTAAELLAIAAFSDGKFSQAFPSFGVERRGAPVQAFTRIGDKPIRLRSQIYEPDYVIVQDPTLIDVDVAHGMDENGIVIINSDFNPEDFN--IDTDAKIMTVDATKIALDIIGRPIVNTILLGAFAGATDEINPESIKEAVKERFPGK----IGDKNAEAVQKAYDMIRE.. 179
103 9.000e-82gi|1008853235|gb|KYK35932.1| pyruvate synthase [Thermoplasmatales archaeon DG-70-1]  clstr ali  54  3.......VEVRWHGRGGQGVVTASELLAGAALAEGKYLQAFPEFGPERMGAPIRAFTRISDEPIEIHSHVYTPDVVVVLDPTLLNPMITDGLSDEGKLIVNYPGTADEVRKTTKFMGRIYVVDATKIAVETIGRPIANTCCVGALVKVTGLVTMDQVEAQIRKMLQTKIGEKATEANIQASKRAHEEV.... 184
104 1.000e-81gi|618852160|gb|KAJ51395.1| pyruvate synthase subunit porC [Clostridium tetanomorphum DSM 665]  clstr ali  49  1..MKKKLIEIRWHGRGGQGAKTASLLLAEVAFNTGMYIQGFPEYGPERMGAPITAYNRIANYPLRVHSNIYEPDYVVVVDETLLKVDCTAGLKGDGAIVINTKKSPEGIRKELRYEGKVYTIDARTISEQTLGANFPNTPMLAAIVKILGIMDKEEFIKDMEKSFKHKFKPNVIAKNIEALKRGLQEVKGLE 194
105 1.000e-81gi|497238876|ref|WP_009553135.1| 2-oxoacid:acceptor oxidoreductase subunit gamma [Burkholderiales bacterium JOSHI_001]  clstr ali  38  1......MLQIRIHGRGGQGVVTAADMLAIAAFNQGRHAQSFPSFGSERTGAPVVAFCRIDDREIRLREPILSPDVLIVQDPTLLHVDVFQGLKPDGYVLINSRKSLDELGLSERDRSHLLTVPATDIAIAHVGRPLPNAVLLGGFAALAGLISLDAVEHAIRDRFTGK----VAEGNVAAARQAFEHVRQE. 186
106 1.000e-81gi|503545168|ref|WP_013779244.1| pyruvate synthase [Tepidanaerobacter acetatoxydans]  clstr ali  51  1..MSEKVLEIRWHGRGGQGAKTAALMLAETVAQMGKYVQGFPEYGPERMGAPILAFNRISDEPIHIHSNVINPDIVIVLDATLLGEKVTAGVPEDGIYIVNTTKTPQEVRKKLNKGGKIFTVDANQISLDTIGRVIPNTPLMGAFVKATGLMSYDEFIENVKGELEKKFKPEVIAGNIKAIERAYQEVKGE. 192
107 1.000e-81gi|757147778|ref|WP_042701978.1| pyruvate ferredoxin oxidoreductase [Methanobrevibacter arboriphilus]  clstr ali  43  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKFSQAFPFFGVERRGAPVMAFTRIDDKPIQIRYQVQNPDYVVVLDDGLLDVNVFSGIKNDSSIIINTNK---EENLEKNKDKEIYNIDATGIALENLGVPIVNTIMLGSFAKKSGEVSLESIIKVIKETFPGK----LGDKNSKAAEIAYNQI.... 176
108 1.000e-81gi|524703249|emb|CDE10918.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:354]  clstr ali  46  1...MNDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGAERMGAPITAYNRISTTPIRIHCNIYNPDYVVVVDDTLLHVDVTAGLKESGAIIINTTKDGETLKRLLGYKGHIYTIDARTVSIEALGKYFPNTPMLAAVVKVTGIIPEKDFLQDMEGSFKHKFKPEVIGGNMKALEIALQKVVKVQ 193
109 1.000e-81gi|1004128684|gb|KXZ39029.1| pyruvate/ketoisovalerate oxidoreductase, gamma subunit [[Clostridium] paradoxum JW-YL-7 = DSM 7308]  clstr ali  30  6.........IICSGFGGQGIMSMGQLLAYAGMLEGKEVSWLPSYGPEMRGGTANCSVIVSDKPVGSPVVTNDCTTAIVMNLPSLLK-FEQAVVEGGNLLINSSLIDE---KAKREDIKAYYVPANEIALEIGNIKVANMVMLGAYLELTKIVKVETVIEALRKVFGP-SKEKLIPINEQALERGAACVR... 180
110 1.000e-81gi|557699355|ref|WP_023439536.1| pyruvate synthase subunit porC [Clostridium tetani]  clstr ali  48  1..MDKKLMEIRWHGRGGQGAKTASLLLAEAAFNAGMYIQGFPEYGPERMGAPITAYNRISNFPLRVHSNIYEPDYVVVVDETLLKTGVTKGLKKEGGIIVNTKKTPDEIRKELGYEGKVYTVNARKISEEALGAYFPNTPMLGSIVRVTNIIDIDKFIGDMEGSFKHKFKPHFIPKNMEALKRGIQEVSGIE 194
111 2.000e-81gi|921067374|gb|KON28146.1| hypothetical protein AC481_02600 [miscellaneous Crenarchaeota group archaeon SMTZ-80]  clstr ali  46  1MEEFRLLYEIRWHGRGGQGVVTASRLLAEAAMSEGKHVQAFPEFGPERTGAPIRGFTRISDKKIRVHSQIYEPNMVVVLDPTLLEINVADGLIKEGKMIVNTDLSPSDLEKKLGKNIKTYTIDATKIALDVLGRPITNTAMLGAVVKVESLTSLSS----ICESVSQRFPGTIGEKNVRAIKKAHEEV.... 186
112 2.000e-81gi|1007511182|gb|KYH39260.1| pyruvate/ketoisovalerate ferredoxin oxidoreductase subunit gamma [Candidatus Bathyarchaeota archaeon B25]  clstr ali  44  1......MIEVRWHGRGGQGAVTAAEILAHAAIREGKYAQAFPSFGPERRGAPVLAFNRFDDKPIWVRSDVYEPDVVAVLDPSLLAVNVLGGLKPDGVVVINARETLSEIKAHLGFQGKTALINATDIALEVLKVPIVNTAMVGAFIKATGLVKLDSAVEAVIERFGGKT----GERNAEAVKKAYE...... 177
113 2.000e-81JGI.Meta 7030175727 C7119965__gene_310485 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Supragi  ali  29  15...MK--TEIIIAGFGGQGVLSMGKILAYSGLLENKEVTWMPAYGPEQRGGTANVTVIVSDERISSP-ILSKYDVAIVLNQPSLDK-FMPKLKPGGILIYD---GFGIVNPPQRDDIRIYRVDAMDKAAEMKNAKVFNMIVLGALLKVCPIVSTDGLQKALYKTLPERH-HGLIPLNMQAVEEGMKLV.... 191
114 2.000e-81gi|500684840|ref|WP_011973989.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanococcus aeolicus]  clstr ali  45  1......MIEVRFHGRGGQGAVTAAQLLAKATFIDGNFAQAFPFFGVERRGAPVIAFTRIDDKKIRIRSQIYEPDYVVVQDPSLLDIDVKSGLKEGGKIIINTTKDI----KFEGYD--VFCVDATGIALDVLGLPIVNTSILGAFAGVTGEVSIEALKEAIMDSFPKK----LAEKNAKAAEVAYNAVKK.. 175
115 3.000e-81 GL0093698 [Complete] locus=scaffold8233_8:8447:9076:-  ali  45  9...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDTIRVHSNIYHPDYVVVVDETLLSVDVTAGLKKTGAIIINTPKSKEEVMDELGDEGRVYTVDARKISVETLGKNFPNSPMLAAAVAVSDIMPRDKFIHEMRASYEHKFKPEVIDGNMKALERAYDVVEEA. 200
116 4.000e-81gi|504218338|ref|WP_014405440.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanocella conradii]  clstr ali  42  1......MKEIRIHGRGGQGSVTAAELIAVAAFEDGKWSQAFPYFGTERRGAPVTAFARISDKKIRVRSQIYEPDYVIVQDPSLLSVDVASGIKKDGLIIVNTEKDPSELK--MDTNATVKTIDATTLAIKILGVPIVNTALLGAFAGASGQIRLESVSKAIKERFPGK----VGEKNVEAVRQAYEMMR... 178
117 4.000e-81gi|524330617|emb|CDA87852.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:230]  clstr ali  43  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDKIRVHSNIYHPDYVVVVDETLLDVDVTAGLKVNGAIIINTAKSREEIEKHLGYTGRVYTIDARKISMETLGKNFPNSPMLAATVAVSEVMPREDFFREMRASYQHKFKPEVIDGNMQALEMAFEELEE.. 191
118 4.000e-81gi|1007510767|gb|KYH38871.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Candidatus Bathyarchaeota archaeon B23]  clstr ali  43  1......MIEVRFHGRGGQGAWTASLLLAQGGLREGKYVQSFPAFGPERAGAPITSYTRISDAPIDIHSGIYEPDAVVVLDPTLLGPSVVEGLKSGGKIVVNTPNSPEAVRESLGLEVEVWTIDATSLALETLRRPITNTVMLGALIKAEEIVKLNSLFEAVRE----RFRGEVGELNVKVIETAYREVR... 180
119 4.000e-81gi|973035628|gb|KUK13427.1| Pyruvate/ketoisovalerate oxidoreductase, gamma subunit [bacterium 42_11]  clstr ali  53  1...MEKLIEVRWHGRGGQGAKTGAQILAEVFFDRGYHIQAFPEYGAERSGAPMKAFNRLSKEEILLHCQVENPDIVVVVDPTLLTVNVTEGLKDEGIILVNTPHTPAEVKKKLGLKQKVYTLDATKIALEEMKVNFPNTPMLGALAKIIGEIPLEAFEEHFKSKFEGKLPPDKVEANVRAMRRGYEEVQGE. 190
120 4.000e-81gi|931367590|gb|KPJ58970.1| pyruvate synthase [Latescibacteria bacterium DG_63]  clstr ali  50  1...MKDIVAIRWHGRGGQGAKMASFLLAECALEEGKWSQGFPDYGPERSGAPVRGFNRISDRRIDLHCPITDPDIVIVLDDTLIGKDVCGGLKKDGICLVNTQCDPASMRAQLKLNGKVFTVDATKIALSEIGRPIPNTAMFGALCKASGVLRLETVVSEIKRVFKKKFGPEVAESNIKAVERAYAEVRGE. 190
121 4.000e-81gi|974124516|gb|KUO39258.1| pyruvate ferredoxin oxidoreductase [Hadesarchaea archaeon DG-33]  clstr ali  42  1......MIEIRFHGRGGQGAVTAARLLAEAAFAEGKYSQALPFFGAERRGAPVLAFTRIDSRPIRIRTQIYEPDYVVVLDPSLLEVSVASGIKHDGLIVLNSKKNAQFSHA------KTAFVDATSIAKEMLGVPITNTAMLGAFAKATKLVSLDSLINVTK----GRFSGKLADKNIAAIKAAYEQTKV.. 175
122 5.000e-81gi|571052250|gb|AHF25916.1| pyruvate synthase subunit PorC [uncultured bacterium Contigcl_1539]  clstr ali  44  1...MNIM-EIRWHGRGGQGAKTASLLLADAAFMAGKYVQSFPEYGPERSGAPITAYNRISDERCSIHSNIYEPDYVVVVDETLLEVDVTAGLKEEGGIVINSAKSAAELKPLLGYQGKVYTVDAGTISRKHLGDYFPNTPMLAAIVAISGCVEKETFLKDMEEAYTHKFKPQVIKGNLDCLAEAMQAVRE.. 190
123 5.000e-81 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2  ali  48  1...MNNGLEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEVIRVHSNIYTPGLVVVVDETLLHVDVTAGLKEDGAIIVNTPKSADEIKPMLGYQGKVYTVDARKISVQALGKYFPNSPMLAAAVAVSGIMKKDAFISEMRASYQHKFKPEVIDGNMQALELTYEELK... 190
124 6.000e-81gi|495666227|ref|WP_008390806.1| pyruvate synthase [Clostridium sp. SS2/1]  clstr ali  48  1...MNNGLEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDKVIRVHSNIYTPGLVVVVDETLLHVDVTAGLKEDGAIIVNTPKSADEIKPILGYQGKVYTVDARKISVQALGKYFPNSPMLAAAVAVSGIMKKDAFISEMRASYQHKFKPEVIDGNMQALELTYEELK... 190
125 6.000e-81gi|503592337|ref|WP_013826413.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanobacterium paludis]  clstr ali  42  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYCQAFPFFGVERRGAPVMAFSRIDDQPIRRRYQVYKPNYVIVLDDGLLEVDVFSGIKDGGKIIINTTSDVKTV-----DGAEVQKIDATGIALEILGVPIVNTVMLGAFAGLTGEISLESLIKIIKETFSGK----IGEKNAKAATIAYNKVREE. 177
126 6.000e-81gi|996040959|gb|KXG75074.1| Pyruvate synthase subunit PorC [Thermotalea metallivorans]  clstr ali  27  5........QVICAGFGGQGVMSMGQLLTYAGMLEGKNVSWLPSYGPEMRGGTANCSVIVSDSPVGSP-IVTDATAAIVMNLPSLLK-FEKDLVKDGILLINSSLID---KKASRNDIRAYYVPANEIANEIGNSKVANMVMLGAFIELTKTVEVDSVIAALKKVFGP-SKEHLIPMNQEALERGAAAVRA.. 180
127 6.000e-81 GL0087878 [Complete] locus=scaffold89761_1:690:1271:-  ali  48  1...MNNGLEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEVIRVHSNIYTPGLVVVVDETLLHVDVTAGLKEDGAIIVNTPKSADEIKPMLGYQGKVYTVDARKISIQALGKYFPNSPMLAAAVAVSGVMKKDAFISEMRASYQHKFKPEVIDGNMQALELTYEELK... 190
128 6.000e-81JGI.Meta 7019946776 SRS048870_WUGC_scaffold_19168__gene_31810 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate f  ali  45  1...MNDLVEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPIVIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTVRDADYLKSVLGYNGGIYCIDARKISEEALGKYFPNTPMLAAIVKVAGIMNDEDFLADMQGSFKHKFKPEVIEGNVKALEMALQEVKK.. 191
129 7.000e-81gi|524569755|emb|CDC94781.1| pyruvate/2-ketoisovalerate family acceptor oxidoreductase [Roseburia sp. CAG:380]  clstr ali  44  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDKIRVHSNIYHPDYVVVVDETLLSVDVTAGLKKTGAIIINTPKSREEVMDELGYEGRVYTVDARKISVETLGKNFPNSPMLAAAVAVSDIMPREKFIHEMRASYQHKFKPEVIEGNMKALECAYDVVEAA. 192
130 7.000e-81gi|524170296|emb|CCZ42575.1| pyruvate ferredoxin oxidoreductase gamma subunit [Clostridium sp. CAG:122]  clstr ali  43  1...MNNGIEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAYNRISEDKIRIHSNIYTPDYVVVVDETLLDVDVTAGLKKDGAIIINTPKSRDEIKKLNGYEGKVYTVDARHISVKTLGKNFPNSPMLAAVVAVSNVMPRDTFIREMRASYQHKFKPEVIDGNMEALEMTFD...... 187
131 7.000e-81gi|503698998|ref|WP_013933074.1| pyruvate synthase [Pseudothermotoga thermarum]  clstr ali  70  1..MPAKYFEVRWHSRAGQGAKSAAQLLAEAVLDMGKYAQAFPEYGAERSGAPMRAFNRISDEKITVHSAVENPDVVVVIDDTLLSPAVVVGLKKEGVLIVNTAHPIEFVRKKTGFEGKICIVRATDIALEELKRGIPNTVMLGTIARVTGLITLETAAQRIREMFERKLPEEMIQANLRALKRGYEEV.... 186
132 8.000e-81 GL0289442 [Complete] locus=scaffold151113_1:654:1235:-  ali  46  1...MNDLIEIRWHGRGGQGAKTACLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSAIYEPNYVVVVDDTLLDVDVTAGLKEDGAIVINTTNDAETLKKKLGYKGGIYTIDARSISIDALGKYFPNTPMLAAIVKVSGVIPEDQFLADMEGSFKHKFKPEVIDGNMKALKNTLEKVNKIQ 193
133 8.000e-81gi|655457643|ref|WP_028840687.1| pyruvate synthase [Thermodesulfobacterium hveragerdense]  clstr ali  45  1......MVEIRLHGRGGQGAVTSAELIAVAAISQGDYAQAFPSFGPERRGAPVQAFARIDKNPIRSREKIYEPDVILVLDPTLPKVNITQGLKPSGIAILNSNLPEPELRKLLNFQGKIAVVDATKIAIEELGLPITNTTMLGAFLKATGLVSLEAIEQAITARFG-----RLAEKNIKALKRAIDETKIY. 182
134 8.000e-81gi|517171709|ref|WP_018360527.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas macacae]  clstr ali  30  2......TYEIVIAGFGGQGVLSMGKILAYSGLMEGKNVSWMPSYGPEQRGGTSNVTVIVSDEPVSSP-VVNEYDVVIVLNQPSLDK-FESKVKPGGLLLFDSNGI---HRLPKRKDIKVCQVDATEEALHMGNQKVFNMLVLGGMLKEAPVVKIEGIEKGLMKSLPERH-HKLIPMNIEAIQRGMEIVKE.. 179
135 9.000e-81gi|524291304|emb|CDA51458.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:138]  clstr ali  24  6..........IFAGFGGQGVLLIGQLLAYAGMYEGKNVSWLPSYGPEMRGGTANCSVVVSDEPVASP-VINKCDCVIAMNRPSLDK-FEQNVLPGGKLFINSSIID---KKATRTDIDVYYVPCNEIADKLNNPKVANMAMLGAYLEATKAVQTKSVLDALLYKLGEK-KAALIPLNEEAIEAGAASIRK.. 179
136 9.000e-81gi|490169788|ref|WP_004068429.1| 2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase subunit gamma [Clostridium sp. ASF502]  clstr ali  44  1...MRNLTEIRWHGRGGQGAKTAALLLADVAFQTGKYVQGFPEYGPERMGAPITAYNRISDQPIRVHSNIYDPQYVVVVDESLLEVDVTAGLKKDGAILINTRRTKEEILPHLGYEGEVYIIDAHKVSMATMGKYFPNTPMLAAIVKVAGIMEEETFLREMQASFSHKFKPEVIEGNMAALKMALQEVR... 190
137 9.000e-81gi|524145115|emb|CCZ18864.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:780]  clstr ali  45  1...MNDLVEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPIVIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTVRDADYLKSVLGYNGGIYCIDARKISEEALGKYFPNTPMLAAIVKVAGIMNDEDFLADMQGSFKHKFKPEVIEGNMKALEMALQEIKK.. 191
138 9.000e-81 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2  ali  43  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDKIRVHSNIYHPDYVVVVDETLLDVDVTAGLKANGAIIINTAKSRAEIEKHLGYTGRVYTIDARKISMDTLGKNFPNSPMLAATVAVSEVMPREDFFREMRASYQHKFKPEVIDGNMQALEMAFEELEE.. 191
139 9.000e-81JGI.Meta 7027075670 SRS016335_WUGC_scaffold_45747__gene_97624 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate f  ali  46  1...MNDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGAERMGAPITAYNRISTTPIRIHCNIYNPDYVVVVDDTLLNVDVTAGLKESGAIIINTTKDGETLKRLLGYKGHIYTIDARTVSIEALGKYFPNTPMLAAVVKVTGIIPEKEFLQDMEGSFKHKFKPEVIGGNMKALEIALQRVVEIQ 193
140 1.000e-80gi|490508195|ref|WP_004374226.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella oris]  clstr ali  28  1...MK--TEIIIAGFGGQGVLSMGKILAYSGMLEGKEVTWMPAYGPEQRGGTANVTVIVSDERISSP-ILSKYDVAIVLNQPSLDK-FMPKLKPGGMLIYD---GFGIINPPTRDDITVYRIDAMDKAAEMKNAKVFNMIILGALLKACPIVSTEGLQKALFKTLPERH-HHLIPLNMQAVEEGRKMVK... 178
141 1.000e-80JGI.Meta 7016948985 SRS052697_LANL_scaffold_73088__gene_156732 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate  ali  43  1...MNNGIEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAYNRISEDKIRIHSNIYTPDYVVVVDETLLDVDVTAGLKKDGAIVINTPKSRDEIKKLKGYEGRVYTVDARHISVKTLGKNFPNSPMLAAVVAVSNVMPRDTFIREMRASYQHKFKPEVIDGNMEALEMTFD...... 187
142 1.000e-80gi|647307497|ref|WP_025747581.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Caldicoprobacter oshimai]  clstr ali  29  2......THQIIIAGFGGQGIMLMGQLLAYAGMLEGKNVSWLPSYGPEMRGGTANCNVIISDEPVASP-IVTEATAVMVMNRPSLDR-FEGAVMKGGLLLVNSSLID---KKASRDDIEVCYIPANEIADQLGNSRVANMVVLGSYIAKTGVVSPASVIESLRKALGP-SKEHLIPLNEEALKRGAECVKEC. 180
143 1.000e-80gi|114337836|gb|ABI68684.1| pyruvate ferredoxin oxidoreductase, gamma subunit [Syntrophomonas wolfei subsp. wolfei str. Goettingen G311]  clstr ali  43  1.MASNNMVEIRWHGRGGQGAKMACLLLADVAGLEGKFVQGFPEYGPERMGAPITAYNRISEKRCTIHSNIYYPDYVVVVDETLLDVDVTGGLKDGGAIIINTPSSPQEIRPLQGWTGKVCTVDARRISEDVLGTNFPNTPMLAAAVKVSGVLETERFLANIEESFKHKFKPQLIEGNMATLKKSMEEVQ... 192
144 1.000e-80gi|503146430|ref|WP_013381091.1| pyruvate synthase [Eubacterium limosum]  clstr ali  44  1...MKDNLEIRWHGRGGQGAKTAALLLADVAFSTGMYVQGFPEYGPERMGAPITAYNRLSQSKIRVHSNIYEPDYVVVVDETLLEVDVTKGVSPEGAVIINTSKDKSEIKHLKGYTGRVFTIDARKVSIEALGKYFPNTPMLASIVKVSGVMENEAFLSEMRHSFEHKFKPEVIEGNMKALSLALQEVK... 190
145 1.000e-80gi|503025017|ref|WP_013259993.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Desulfarculus baarsii]  clstr ali  48  1......MIEVRFHGRGGQGAVTSAELMAQAAIAEGKYAQAFPSFGPERRGAPLQAFLRISDEQIRLREKIYEPDVVVVLDPSLLATNVNAGLKPDGVLVVNSAKNVEAVRGECQFNGRTAIVDASKIAEEELGVPITNTTMLGALLKAAGHVDL----KAIEKPLAARF-GRIAEKNLRALKRAYEETVIEE 182
146 1.000e-80gi|1010960103|ref|WP_061919195.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Bellilinea caldifistulae]  clstr ali  31  3.......TEIIIAGFGGQGILFAGQLLAYAAMDNGLETTWIPSYGPEMRGGTANCTVIIADEEIGSP-VVRNPQVAIVMNRPSLDK-YEPLVKPGGLLVVNSSIID---RTPERKDIQAALVPANDIAEQLGDRRMANMVMLGAFLANLPVLSIEAIEKALQEHLPERH-HKLLPKNYQALREGARY..... 176
147 1.000e-80 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2  ali  45  14...MKKNIEIRWHGRGGQGAKTAALLLADVAFNTGMHVQGFPEYGPERMGAPITAYNRIGESEIRVHSNIYHPDYVVVVDETLLHVDVTNGLKEDGAIVINTPRPKEEILPLLGYKGSVYTIDAHKVSMETLGKYFPNSPMLAAIVKVADIMDKDVFLSQMQASYEHKFKPEVIDGNMRALKMAFEEVK... 203
148 2.000e-80gi|501003491|ref|WP_012056571.1| pyruvate synthase [Thermosipho melanesiensis]  clstr ali  67  1..MPAKYFEIRWHARAGQGAKSASQMLAEAALEMGKYVQSFPEYGAERTGAPMKAFNRVSDEPILIHSSVDYPDVVVIIDDTMLQPALTDGTDENTVFIVNTVKDVEYVREKLGVKGKICTIAATDIALEELKRGIPNTVMLGAIAKVTGVITLESAEQRIRKAFSKKFPEELVEANVRALRRGFEEVK... 188
149 2.000e-80 GL0029471 [Complete] locus=scaffold29499_17:520:1092:-  ali  46  1...MQNCVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISPAPIRVHSNIYHPDYVVVVDEGLLDVHVTEGLSEDGAILINTSRDKSELTEKLGYKGAVYTIDAKKVSKACLGKYFPNTPMLAGIVKVSGVMDWDEFYNEMRASFLHKFKPEVIDGNMNALKMAFDEVK... 190
150 2.000e-80gi|1011523575|ref|WP_062417547.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Levilinea saccharolytica]  clstr ali  32  3.......TDIIISGFGGQGVLFAGQLLSYAAMDEGKNVTWIPSYGPEMRGGTANCTVVVSDEEIGSP-MVRFPDAVIVMNLPSLDK-YESLVKPGGLLVINTSIID---RKATRTDIRVVEVPANEIAEEIGDRRLTNMVLLGCLVSNLPILPLAAISKALKEHLPARH-QKLIPANMQAIEKGA....... 174
151 3.000e-80gi|931361988|gb|KPJ53881.1| pyruvate synthase [Dehalococcoidia bacterium DG_18]  clstr ali  48  1..MAKETIELRWEARGGQGAVTASKLLAEAALEDGKYFQGMPDYGAERMGAPIRSYTRISSEPILAYCQVTEPDVVVVLDTTLIGVNLTEGLKEDGMMVVNSTASPDEVRSQLGYKGKVYTLDATGISMDLLGRNLPNTPMLGALARVTGIVNTDSVAQQITSRLGATMKKEVVAANIRAFEKGYNSVR... 188
152 3.000e-80gi|762180334|dbj|GAN32376.1| pyruvate ferredoxin oxidoreductase gamma subunit [Candidatus Brocadia sinica JPN1]  clstr ali  43  1...MYPLIEIRVHGRGGQGSVTAAELLGFAAHSDGKYAQAFPSFGSERMGAPVQAFVRISDKPIRIRSQVYKPNYVIVQDPTLLDVNVLDGLREDGLLLINSKKKATDLG--INTKVKVKTIPAMEIALEVIGRPIMNTTLLGAFAAATGEISLEGIRKAIH----HKFPGSVGEKNIAAVLRAFDFIKKE. 183
153 3.000e-80gi|511048272|ref|WP_016302159.1| 2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase subunit gamma [Lachnospiraceae bacterium COE1]  clstr ali  44  1...MKDTVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISSEPITVHSNIYEPDYVVVVDESLLEIDVTKGLSKNGAVIINSEHTKEELAPMLGYEGAVYTVDAKEISIKALGKNYPNSPMLAATVAVSGIMDKDAFLGEMRALFEHKFKPEVIDGNMQALEMAFQEA.... 189
154 3.000e-80gi|652836142|ref|WP_027118816.1| pyruvate synthase [Lachnospiraceae bacterium YSB2008]  clstr ali  47  1...MRKHIEIRWHGRGGQGAKTAALLLADVAWSTGMYVQGFPEYGPERMGAPITAYNRIGDTEIRAHSNIYYPDYVVVVDETLLHVDVTKGLSKDGGILINTEKSKEEISLLNGYEGKVYTIDARKISMETLGKYFPNSPMLAGIVKVANIMEKDEFLSQMEASYQHKFKPEVIEGNMQALRRAFEEVQ... 190
155 3.000e-80gi|757133276|ref|WP_042687534.1| pyruvate ferredoxin oxidoreductase [Methermicoccus shengliensis]  clstr ali  41  1......MKEIRIHGRGGQGSVTAAELLAQAAFEDGWYSQAFPSFGVERRGAPVTAFVRLDEKPIRLRGQIYTPDYVIIQDPTLVTENVLEGLKDDGLILINSAKSPEEM--ALGTKAQVRTVNATQIAVEELGRPIVNTLLLGAFAGATGLVSVDSIKRAVLRRFSGK----VGEMNAKAIDRAYELM.... 177
156 3.000e-80gi|653208452|ref|WP_027424948.1| pyruvate synthase [Lachnospiraceae bacterium NC2004]  clstr ali  42  1...MKDTVEIRWHGRGGQGAKTAALLLADVCFKHGKNVQGFPEYGPERMGAPITAYNRISDKKLRVHSNIYDPDYVVVVDETLLEIDVTAGLNPEGAIVINTTRPKEEIIPHLGYEGKVYTLDARKISEEALGKYFPNSPMLAAIVAVSKVMEKDEFMTQMRDSYQHKFKPEVIDGNMKALEMAFTEV.... 189
157 3.000e-80gi|524267356|emb|CDA31131.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:492]  clstr ali  46  1...MNDLIEIRWHGRGGQGAKTACLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSAIYEPNYVVVVDDTLLDVDVTAGLKEDGAIVINTTNDAKTLKKKLGYKGGIYTIDARSISIDALGKYFPNTPMLAAIVKVSGVIPEEQFLADMEGSFKHKFKPEVIDGNMKALKNTLEKVNKIQ 193
158 4.000e-80gi|503665205|ref|WP_013899281.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanosalsum zhilinae]  clstr ali  40  1......MKEIRIHGRGGQGSVTAAELLAVAAFADGKYSQAFPAFGVERRGAPVQAFTRLSDRPIRLRSQVYQPDYVIVQDPTLIEVDVANGIKDNGTIIINSEFEPEQFSFSTG--AKVMTVDATRIALDVIGRPIVNTILLGAFAAATGEIQPGSIADAVKQRFSGK----IGEKNAEAIDRAYNMTMEAK 181
159 4.000e-80gi|312183625|gb|ADQ42382.1| pyruvate:ferredoxin oxidoreductase subunit C [Methanosaeta harundinacea 6Ac]  clstr ali  44  40....SRLKEIRFHGRGGQGAVTAAELIAIAAFEDKKYSQAFPAFGVERRGAPVMAFARIASEPIRIRSQIYEPDYVIVQDVTLLEVDVASGLKPEGKIIINTDRDPKDLKLKTG--AEVVTIDATRIALEKLGRPIVNTTMLGAFCGATGEVSLESVNKAIL----SRFSGSLGEKNLAAIKTAYEGV.... 218
160 4.000e-80gi|505224647|ref|WP_015411749.1| MULTISPECIES: pyruvate:ferredoxin oxidoreductase gamma subunit [Methanosarcina]  clstr ali  41  1......MKEIRIHGRGGQGSVTAAEMLSVAAFEDGKFSQAFPAFGVERRGAPVQAFTRISDSPIRLRSQIYAPDYVIVQDATLLEVDVASGIKDDGIIIVNTTEKPESLK--LNTKAKVMTVDATKVAMDVMGIPIVNTVLLGAFAGATGEINVESIQKAIRARFSGK----IGEKNAKAIQKAYQLIRGEK 181
161 4.000e-80gi|524671684|emb|CDD81573.1| 2-oxoglutarate ferredoxin oxidoreductase gamma subunit [Bacteroides sp. CAG:462]  clstr ali  25  2.....KTEEIIISGFGGQGVLSMGKILAYSALMEGKEVTWMPAYGPEQRGGTANVTVIISDERISSP-ILSTYDTAIILNQPSMAK-FESKVKPGGTIIYDGYGIS---QPPTRKDIKVYRIDAMDAAAEMNNMKAFNMIVLGGLLKLRPMVSIESVLKGLRKTLPERH-HHLIPMNEEAIRKGMEIIREHE 182
162 4.000e-80gi|503484508|ref|WP_013719169.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanosaeta concilii]  clstr ali  42  1......MKEIRLHGRGGQGSVTAAEIIAVAAFEDKRFSQAFPAFGVERRGAPVMAFARIADKPIRVRSQIYEPDYVIVQDVTLLDVDVASGLKPDGKIIINTDRSGEQLK--LDTKAEVITIDATKIAMEVLGRPIVNTTMLGAFCGASGEVGLESLNKAI----SERFRGELGKKNLLAIKTAYERV.... 177
163 4.000e-80gi|504063031|ref|WP_014297025.1| pyruvate synthase [Marinitoga piezophila]  clstr ali  67  1..MPEKYFEIRWHGRAGQGAKSASQFLTEAAVEAGKYSTAFPEYGAERSGAPMKAFNRIADVPIRIRSGIENPDVVVVFDDTMLGPDITAGLGEDKIMLVNTVMSPEEVREKTGFKGKIYTIPATDIALEEIKRGIPNTVMIGALVKLTNVVPMEVVKEKVRKTFEKKFSEEVVQANLRAVDRGYQEVK... 188
164 5.000e-80gi|492690206|ref|WP_005923688.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Bacteroides salyersiae]  clstr ali  27  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEKISSP-ILSKYDTAIILNQPSLEK-FESRIKPGGILIYDGYGI---INPPTRKDIKVYRIDAMDAANEMKNAKAFNMIVLGGLLKLRPIVTLENVIKGLKKTLPERH-HHLIPMNEEAIKKGMELIKELK 181
165 5.000e-80gi|504866582|ref|WP_015053684.1| pyruvate synthase gamma subunit [Methanolobus psychrophilus]  clstr ali  43  1......MKEIRIHGRGGQGSVTAAELLAVAAFADSKFSQAFPAFGVERRGAPVQAFTRINDTPIRLRSQIYKPDYVIVQDPTLLEVDVASGLKDDGILIINSDFDPE--KFKLDTKAKIMTVNATKIALDIIGMPIVNTVLLGAFAGATGEIRPESIMEAVRERFPGK----VGDRNAQAIMEAYKMMEGQK 181
166 5.000e-80gi|973019789|gb|KUK00428.1| Pyruvate synthase subunit PorC [Methanobacteriaceae archaeon 41_258]  clstr ali  42  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYSQAFPFFGVERRGAPVMAFTRLDEKPIRRRHQIYNPDYVVVLDDGLLEVDVFAGLKTNGAVIINTREKPQTPPGAKK-----YTIDATGIALEILGRPIVNTTMLGAFAGATREVTIDAIIRIIKETFPGK----IGEKNAEAAKKAYENMK... 175
167 5.000e-80gi|504641101|ref|WP_014828203.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfosporosinus acidiphilus]  clstr ali  26  4........EIILAGFGGQGVMSMGQLLAYAGLEENKFVSWIPSYGPEMRGGTANCSVTISDAEVSSP-IITEPNTLIVLNRPSLEK-FEKDVRPGGWVLLNSSLIDIE---PSRQDLKVLKIPADEIANEFNNSRVANMIILGAYIHLTGAVSLESVVGALKKVLPE-YRYHLIPLNRQALELGIELAQNA. 181
168 6.000e-80gi|496343635|ref|WP_009052813.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Thermoanaerobacter]  clstr ali  29  1......MEEIIFAGFGGQGVLSMGLIITYAGMFEGKNVSWTPSYGPEMRGGTAYCNVTVSDEEVGSP-VITEATSVIVMNRPSLDK-YESYVIPGGKLFINTLLVD---RKAERKDIEVYEIPANDIANELGNLKIANMVMLGAFIEATKVVKLETVLKALPEVFG-KGKEHLIPINEKALNKGAELVK... 178
169 6.000e-80gi|158447932|gb|EDP24927.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Coprococcus eutactus ATCC 27759]  clstr ali  45  15....KDTIEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISSEPIRVHSNIYEPQYVVVVDESLIEVHVTAGLAEDGAIIINTPKTPDEVRPLLGYKGRVYTLDAKEISLKTLGKNFPNSPMLAAIVAVSGIMEEGPFLEDMRQSYQHKFKPEVIEGNMEALKLAFREV.... 202
170 6.000e-80gi|503448828|ref|WP_013683489.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Archaeoglobus veneficus]  clstr ali  44  1......MLEVRFHGRGGQGSVTAAEVLAIAAFKDGKYSQAFPIFGVERRGAPVQAFCRIDEKPIKQRCQVYEPDLVVVQDATLMDVDVTAGLKEGGILLINSAKSPEEFGINSNTTVK--TIDATRLALETLGRPIVNTVMLGALAKL-GIVSLNSIVEAV----GEKFGCKLAEKNILAVKKAFEE..... 175
171 6.000e-80gi|780915236|gb|KJS82742.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Peptococcaceae bacterium BICA1-8]  clstr ali  29  4........EIIIAGFGGQGVMSMGQLLAYAGMLEDKQVAWIPSYGPEMRGGTANCAVTISDTEISSP-LVTEPSVCIVMNKPSLDK-FEPTIKTGGLLFVNTSLIDA---KPKREDISVYEIPANAIANKIGNSKVANMVMLGAVLEIIKAVEPESILESLRKVLPP-QRHNLIPLNAQALQKGAEIV.... 177
172 6.000e-80gi|516754396|ref|WP_018085110.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfurispora thermophila]  clstr ali  28  1......MFEILIAGFGGQGVLSMGQLLAYAGMTDGRHVAWIPSYGPEMRGGTANCGVTISDKPISSP-VVSEPTVLIAMNRPSLEK-FEKAVVPGGLILVNSSLIDIQVQ---RRDVKAFYIPANELAEEIGNSKVANNTILGALLKLTGAVSIPAVEESLKKVLPAR-RHNLIPVNLQALQVGMDFI.... 177
173 7.000e-80 GL0033049 [Complete] locus=scaffold58000_2:258:803:+  ali  25  4........EIIIAGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDDPVSSP-ILSSYDIAIVLNQPSLEK-FEPKVKPGGIIIYDGYGINE---PPTRKDIKVYRIDAMDAAAEMNLIKTFNMIVLGGLLKIRPVVKIESVLAALRKTLPERH-HHLIPKNEEAIRKGMEIIKEVQ 181
174 7.000e-80gi|769964933|ref|WP_045087487.1| pyruvate synthase [Defluviitoga tunisiensis]  clstr ali  65  1..MPEKYFEIRWHGRAGQGAKSASQFLTEAAEESGKYSTSFPEYGAERTGAPMKAFNRIADVPIRLRSDIENPDVVCVIDDTLLNPEITSGLSEDKLLLVNTTRSIEEVRKLTKFKGKIGVVPATEIALEEIGRPIPNTTMIGALIRATDVVPMDAVKQKIRAAFARKFSESVVQANIRALERGYQEVKFSE 191
175 7.000e-80gi|652814460|ref|WP_027105853.1| pyruvate synthase [Lachnospiraceae bacterium V9D3004]  clstr ali  46  1...MEKTVEIRWHGRGGQGAKTAALLLADVSFKAGKYVQGFPEYGPERMGAPITAYNRISDNKITVHSNIYDPDYVVVVDEGLLDIDVTAGLSPEGAIVINSAKKPEELASKLRYTGKIYTVDARKISVEALGKYFPNSPMLAAIVAVSGVMDRDQFLNEMEASYRHKFKPEVIEGNMNALRMTFEEV.... 189
176 7.000e-80gi|696592531|ref|WP_033118463.1| pyruvate synthase [Intestinimonas butyriciproducens]  clstr ali  43  1..MSKQMTEIRWHGRGGQGAKTACLLLADAAFSSGKYVQGFPEYGPERMGAPITAYNRISDVPCTIHSNIYQPDYVVVVDESLLSVNVTAGLSPEGAVLINSPKAPGALRPLLRYSGGVYTVDARRLSEQYLGGYFPNTPMLAAIVQVSRVLEPDQFAADMEASFRHKFKPQVIEGNMKCLLQSMKEVRA.. 192
177 8.000e-80gi|1001925927|gb|KXS46272.1| pyruvate ferredoxin oxidoreductase, gamma subunit, partial [Halanaerobium sp. T82-1]  clstr ali  51  7....RDMMQIRWHGRGGQGAKTASLLLADAAFSTGKYVQGFPEYGPERMGAPITAYNRISDDKIRVHSNIYKPDYVVVVDETLLEVDVTAGLKEEGAIVVNTAKDGEKIRKKLGYQGELFTVDAREISMATIGRYFPNTPMLSALVKVANIMDEQDFVTEMENLFKKKFKPEVIDGNVAAVKKALKEVNAH. 197
178 8.000e-80gi|780850398|gb|KJS49835.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Peptococcaceae bacterium BRH_c23]  clstr ali  26  4........EIILAGFGGQGVMSMGQLLAYAGLVEEKHVSWIPSYGPEMRGGTANCSVTISDDEVSSP-IITEPDTLIVLNRPSLEK-FEQDVKPGGRLLINSSLIDIE---SQRQDLQVLKISASELANELGNTRVSNMIILGAFVELTRTVTIESVIGALKKVLPE-HRHNLIPLNRQALETGVELAKRAK 182
179 9.000e-80 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and rela  ali  25  26...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPAYGPEQRGGTANVTVIVSDEKISSP-ILSKYDAAIILNQPSLEK-FESKVKTGGILIYD---GYGIINPPTRKDIKVYRIDAMDAANEMNNAKAFNMIVLGGLLKLKPMVTLDSVLRGLKKTLPERH-HHLIPMNEEAIKKGMELIKE.. 204
180 9.000e-80gi|503608932|ref|WP_013843008.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfotomaculum ruminis]  clstr ali  28  4........EILIAGFGGQGVLSTGQLLAYAGMLEGKQVAWIPSYGPEMRGGTANCGITISDEPISSP-LVTEPTTLIIMNRPSLDK-FENTVVPGGLILVNSSLVE---QKVKRTDVKVMEIPANRIAEELGNGKVANNVILGVLIELTKIVSIEAVVESLKKVLPSRH-HRLIPVNQLALEKGAQLAKTA. 180
181 9.000e-80gi|974209330|gb|KUO51131.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Desulfitibacter sp. BRH_c19]  clstr ali  30  3.......HEIIIAGFGGQGVMSMGQLLTYAGMLEGKHVSYIPSYGPEMRGGTANCTVVISDDEIGSP-IVTEPNCVIVMNLPSLTK-FEPALVPKGVLLVNSSMIKEEY---LRRDIKGYQVAANELAGELGNDKVANMVMLGAFLKATAAVSPKAVIESLKKVLSKR-RHNLIPLNKKALELGASIV.... 177
182 1.000e-79gi|493568431|ref|WP_006521719.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfotomaculum gibsoniae]  clstr ali  28  1......MFEILIAGFGGQGVLSTGQLLAYAGMMEDKHVAWIPSYGPEMRGGTANCGVTISSEPISSP-VVSEPTVLIAMNRPSLEK-FEPAVAPGGLILVNSSLINI---KTKRTDVRTVYVPANDMAEELGNGKVANNIILGALLELTGVVSNDAVLESLKKVLPPK-RHNLIPINGEALEKGRQLARGQ. 180
183 1.000e-79gi|503676298|ref|WP_013910374.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Thermodesulfobacterium geofontis]  clstr ali  42  1......MIEIRIHGRGGQGAVTSAELIAVAAINEGKFAQAFPSFGPERRGAPVQAFARIGEERIRTREKIYHPDIILVLDPSLPKIKVTEGLKENGVAILNSHLSEEEVRKILGDKGKLALVNATKIAIEEIGVPITNTTMLGALLKATGLIEVKSMEEALKERFG-----KLAEKNIKALHRALEETQIYK 183
184 1.000e-79gi|931377787|gb|KPJ68416.1| pyruvate synthase [candidate division WOR_1 bacterium DG_54_3]  clstr ali  45  1...MEKIIEIRWHGRGGQGAKTAALLFADAAMELGKYIQAFPEYGPERMGAPVQSFNRLSDDPITVHCGITDPQIVIVLDPTLMTVDVTQGLPSDGSLIVNTSKSPGEIRKEVGLKGKVYTVNASAIAMDKIGRNIPNTPMLGALVKVSELLDFDKMLKNTEAKLNKKHKPEIVKGNVEAIRAAHDSVRGEK 193
185 1.000e-79gi|116666388|gb|ABK15415.1| pyruvate ferredoxin oxidoreductase, gamma subunit [Methanosaeta thermophila PT]  clstr ali  44  1......MKEIRFHGRGGQGAVTAAEMIAIAAFEDGRFSQAFPAFGVERRGAPVMAFARINDKPIRMRSQVYEPDYVIVQDVTLLDVDVTGGLKSDGKIIINTDRDASALK--LNTEAEVVTIDATRIAIDTLGRPIVNTTMLGAFCGATKEVKLESLEKSIL----TRFSGSLGEKNIQAVRTAYERV.... 177
186 1.000e-79gi|496146203|ref|WP_008870710.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Desulfonatronospira thiodismutans]  clstr ali  42  1......MWEIRLHGRGGQGAVTSAELLARAAISREKFAQAFPSFGPERRGAPVQAFVRVDDKKIRKREKIYQPDMVLVLDPSLLDVNVAEGLKEDGIVVVNSPQDSAELKQKHNWPG-AYTVDATKIAMDILSVPITNTTMLGALLKASGILEPQDMEEVIMDRFG----PKLGPKNFEALKKAYELA.... 178
187 1.000e-79gi|516840489|ref|WP_018125372.1| hypothetical protein [Desulfovibrio oxyclinae]  clstr ali  44  1......MIEIRLHGRGGQGGVTSAELLAKAAIAEGKYAQAFPSFGPERRGAPVMAFVRVDDEQIRLREKIYSPDIVLVLDPSLLDVDVAEGLSENGTVVVNSAMTPEELKEKYGFP-KVATVDANKVAMEELGVPITNTTMLGALLKASGIIGVQEMEEPI----GERFGGKLGPKNFKALERAYGET.... 178
188 1.000e-79gi|671531333|ref|WP_031515145.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Desulfotomaculum alkaliphilum]  clstr ali  27  4........EVLIAGFGGQGVLSTGQLLAYAGMVEGKHVAWIPSYGPEMRGGTANCGITLSDEPISSP-LVTEPTTLIVMNRPSLDK-FENAVVPGGRILINSSIVKQDV---SRDDVLVMKIPANEIAEEIGNARIANNVILGALIKLTGVVTIDSVVESLKVVLPPR-RHNLIPANQQALERGAQLAEEY. 180
189 2.000e-79gi|490130345|ref|WP_004030731.1| pyruvate ferredoxin oxidoreductase subunit gamma/delta [Methanobacterium formicicum]  clstr ali  45  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYCQAFPFFGAERKGAPVMAFSRINDKPIRRRYQVYNPDHVLVLDETLIEVDVLSGLKDGGKVIVNTKED------LKLGDADVHTIDATGIALDILGVPIVNTVMLGAFAKIIGGVSLDSIIKITKETFPGK----IGEKNAEAAKIAFEQAK... 174
190 2.000e-79gi|503673950|ref|WP_013908026.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Thermodesulfatator indicus]  clstr ali  44  1......MIEVRLHGRGGQGAVTSAELIAISAINQGNYAQAFPSFGPERRGAPVMAFVRISDQRIRTREKVYNPDIVVVLDPSLPTVNVTDGLKKDGWVVLNSAKDEKTLREILGFKGKLAVVDATKIAIEELGLPITNTTMLGAFLKATGLVDQEYLEEALEHRFG-----RLAEKNKAAMARAIKETKIY. 182
191 2.000e-79JGI.Meta 7014779701 SRS050422_LANL_scaffold_30517__gene_44381 ketoisovalerate ferredoxin oxidoreductase [Human Stool microbiome from visit n  ali  27  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEKISSP-ILSKYDTAIILNQPSLEK-FESRIKPGGILIYD---GYGIINPPTRKDIKVYRIDAMDAANEMKNAKAFNMIVLGGLLKLRPIVTLENVIKGLKKTLPERH-HHLIPMNEEAIKKGMELI.... 177
192 2.000e-79gi|524197492|emb|CCZ63961.1| pyruvate ferredoxin oxidoreductase gamma subunit [Roseburia sp. CAG:50]  clstr ali  43  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYNRISSDVIRVHSNIYDPDFVAVVDETLLHVDVTAGLKKEGAIIVNTAKSKEEIMPQLGYEGRVVTIDARTISEEALGKYFPNSPMLAAVVATTGVMPKETFLHEMRASYKHKFKPEVIDGNMKALEMAFAAVEEA. 192
193 2.000e-79gi|495688070|ref|WP_008412649.1| Pyruvate/ketoisovalerate oxidoreductase [Desulfotomaculum hydrothermale]  clstr ali  27  4........EILIAGFGGQGVLSTGQLLAYAGMLENKQVAWIPSYGPEMRGGTANCGVTISDEPISSP-LVTEPTTLIVMNRPSLEK-FEPAVVPGGLILINASLVD---RQVKRNDVQVMEIHANQIAEELGNVKVANNVILGALIELTGIVSVESVVESLKKVLPAR-RHNMIPVNRQALEKGAQLAREMK 181
194 2.000e-79gi|973176145|gb|KUL15341.1| Pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase, gamma subunit [Proteiniphilum sp. 51_7]  clstr ali  25  4........EIVISGFGGQGVLSMGKILAYSGIMENKEVSWFPAYGPEQRGGTANVTVIISDQPISSP-VVNQYDIAIVLNQPSLDK-FEERVKPGGVLIYD---GYGIHRKVQRKDIHVYRINAMDESIKMDNPKVFNMIILGGLLRISPLVKMENVMKGLKESLPERH-HKLLPMNEQAILRGMEIVEQEQ 181
195 2.000e-79gi|739610053|ref|WP_037467091.1| pyruvate synthase [Smithella sp. F21]  clstr ali  47  1......MIEVRWHGRGGQGAVTSVELLAVAAIAAGKYAQGFPSFGPERRGAPVAAFTRIDDKKINVRSGIYEPDVVLVLDSSLIGINVTDGLKPDGKLVVNTLKTPEEIRKELNFNGTVATVDGTGIARKEMGVPIANTTMIGALLKVTGIMQLDAMKESIEHRFG-----RIAQKNLNAMKRAYDEIQIIK 182
196 2.000e-79gi|524088517|emb|CCY67851.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:678]  clstr ali  45  1...MQNCVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISTDPIRVHSNIYDPDFVVVVDEGLLDVHVTDGLSENGAILINTAKDKSEISEKLGYKGAVYTIDAKKVSKACLGRYFPNTPMLAGIVKVSGVMEWDDFYNEMRASFMHKFKPEVIDGNMNALKMAFDEVR... 190
197 2.000e-79JGI.Meta 7039710596 C5394291__gene_271595 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Supragi  ali  29  2......TYEIIIAGFGGQGVLSMGKILAYSGLMEEKEVSWMPSYGPEQRGGTSNVTVIVSDEQVSSP-VVNDYDIVVALNQPSLDK-FASRVKPGGVLLYDSNGVHYE---NPRTDIDIYEVDATNEATRMGNSKVFNMLILGALLKTRTILHLDSIKKGLEKSLPERH-HKLIPMNMEALQRGAELLKKH. 180
198 2.000e-79 GL0028706 [Lack 5`-end] locus=scaffold106782_2:1132:1731:-  ali  45  8....ENLVEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPIVIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTVKDADYLKKALGYKGGIYCIDARKVSEEALGRYFPNTPMLAAIVKVANIMDEKDFLNDMKGSFKHKFKPEVIEGNMKALEMALNEVKK.. 197
199 2.000e-79gi|288337819|gb|EFC76171.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit [Prevotella buccae D17]  clstr ali  25  22...MK--TEIIIAGFGGQGVLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTANVTVIVSDERISSP-ILSKYDVAIVLNQPSLDK-FEPKLKPGGILIYD---GFGVFNPPTREDISVYRINAMDKATEMKNSKVFNMIVLGGLLKVCAVVSTDGLKKALKKSLPERH-HNLIPLNMQAVEEGMSIITKE. 201
200 2.000e-79gi|82617390|emb|CAI64301.1| pyruvate synthase, gamma subunit [uncultured archaeon]  clstr ali  40  1......MKEIRIHGRGGQGSVTAAELLAVAAFADGKFSQAFPAFGVERRGAPVQAFTRISDSTIRLRSQIYEPDYVIVQDPTLLEVDVASGAKDDGIIIINSEFGPETFK--LDTKATIMTVDATRIALDIIGRPIVNTVLLGAFAGATGEIDPTSIQDAVKERFPGK----VGKKNAEAIQKAYDMMMEAK 181
201 3.000e-79gi|518983647|ref|WP_020139522.1| 2-oxoacid:acceptor oxidoreductase subunit gamma [Streptomyces sp. 351MFTsu5.1]  clstr ali  40  1......MFQVRIHGRGGQGAVTAAELLSVAAFVEGRYAQAFPSFGSERTGAPVMAFCRIDDRPIRVREPVMRPDALVVQDPTLLHVDVFDGLHPGGAVLVNSPLTAAELGLAELVVARVLTVPATALALRHFGRPVPNAVLLGGLAALTGCVAIDSLTAAVRERFPG----SLGTANADAAREAYEHVK... 181
202 3.000e-79gi|491472799|ref|WP_005330552.1| pyruvate synthase [Dorea formicigenerans]  clstr ali  46  1...MSNHTEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEVIRVHSNIYDPEFVVVVDESLLEVDVTAGLKKEGAILVNTARPKEEIIPHLGYEGKLYTIDAHKVSMEAMGRYFPNTPLLAAIVKVANIMDEETFLREMQASFKHKFKPEVIDGNMKALEMALKEVK... 190
203 3.000e-79gi|654856369|ref|WP_028308711.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Desulfitibacter alkalitolerans]  clstr ali  28  4........EIIIAGFGGQGVMSMGQLLAYAGMLEGKNVSWIPSYGPEMRGGTANCSVIISDTEIGSP-IVSEPNTIIVLNLPSLKK-FEPVLIPGGLLLLSTLKADQTY---TRKDINGYEIPAVEIADGIGNTKVANMVMLGAYLEATEAVSVDAVIESLKKVLPQRH-HGLIPLNRKALELGASEIQKAK 181
204 3.000e-79gi|524043903|emb|CCY27288.1| pyruvate ferredoxin oxidoreductase gamma subunit [Firmicutes bacterium CAG:114]  clstr ali  44  1.MKENGLVEFRWHGRGGQGAKTACLLLADAAFSSGKFVQGFPEYGPERMGAPITAYNRISDTRCSIHCNIDCPDYVVVVDETLLDVDVTKGLSPTGAVIVNTAKSPGEIRGKLRWTGPVCTIDARRISEETLGRNFPNTPMLSAAVRVSGVLEEERFKQDMEESFHHKFKPQVVAGNMAALMQAWEEVQV.. 193
205 4.000e-79gi|544696280|ref|WP_021127424.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [[Clostridium] sordellii]  clstr ali  26  6.........VICAGFGGQGVMSMGQLLTYAGMLEEKEVSWLPSYGPEMRGGTANCSVTISDIPVGSPVITDDATCAIVMNLPSLDK-FEKDVVPGGKILVNNSLID---KKVERTDVKSYYIPANELALELGNPRVANMIMLGAYLELNKCVEVESVLEAFKKVFGP-SKEKFVPLNKEALMKGAEAVKSQE 183
206 4.000e-79 GL0050276 [Complete] locus=scaffold925_3:2239:2811:-  ali  25  4........EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERISSP-ILSHYDVAIVLNQPSLDK-FEPKVKPGGILIYD---GFGIINPPTRKDINVYRIDAMDKAAELKNSKVFNMIVLGGLLKVCPIVSTDGLNKALFKTLPERH-HGLIPLNMQAVEEGMKIMTKMQ 181
207 4.000e-79gi|857574566|emb|CRK83627.1| pyruvate/ketoisovalerate oxidoreductase [Bacillus sp. LF1]  clstr ali  29  4........EIIIAGFGGQGVMSMGQLIAYAGMIEGKGVSWLPSYGPEQRGGTANCAVVISDEPVGSP-LVTSPTTAIVLNNPSFDK-FEPRIRPGGLLIINSSMV---VRLSERTDIKIIEINATDLANDLGNSRVANIILLGSFLEYTKIVSIDSIVESLKKVLGA-DKHHLIDINKLALEKGASLVQFQ. 180
208 4.000e-79gi|973090736|gb|KUK50648.1| Pyruvate:ferredoxin oxidoreductase gamma subunit [candidate division TA06 bacterium 32_111]  clstr ali  49  1...MKDFFEIRWHGRGGQGAKTVALLFADSALATGKYIQAFPEYGPERMGAPVQSFNRLSDNKITIHSPIKNPDVVVVLDQSLMDVDTTSGMEKGGIIIINTVKKPSEIREKYKDSIKIFTVDASKISIEEIGVNKPNTPMFGALVKVTKILDFERMLKDTEEKMKKKFKPEVVEGNIKAIKRAYEEV.... 190
209 5.000e-79gi|502645577|ref|WP_012881934.1| MULTISPECIES: 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Dehalococcoides]  clstr ali  43  1...MKHFIEIRWHGRGGQGAVTSAELIAQAAIGKGKYAQAFPSFGPERRGAPVQSFNRISDNPIRERSGISQPDIVVVLDPSLVIINVVSGLKEGGTLIINTTKPLEYFASQYGDRWKVATVDATAIAKEVLGVNIVNTTMLGALIKATALADMEAFEEPLKHRFG-----KLAAKNMAAMKKAFEETAVKE 186
210 5.000e-79gi|737328790|ref|WP_035311342.1| pyruvate synthase [Clostridium sp. HMP27]  clstr ali  45  1..MNNKLVEIRWHGRGGQGAKTASLLLAEAAFNVGMYVQGFPEYGPERMGAPITAYNRIANFELRVHSNIYEPDYVVVVDETLLKVPCTKGLKKEGAIIINSKKKPEELRELKGYEGRVYTIDAKGISEEILGANFPNTPMLAAVVKVSGVLEEKQFVEDMENSFKHKFKPHVIPKNIEALKRSLQEV.... 190
211 5.000e-79gi|524663660|emb|CDD75359.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:62]  clstr ali  44  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDVIRVHSNIYHPDYVVVVDETLLDVDVTAGLKETGAIIINTPKKREDIPKLNGYKGRVYAIDARHISVETLGKNFPNSPMLAATVAVSEVMEKETFIHEMRASYEHKFKPEVIDGNMEALERAFDVV.... 189
212 6.000e-79gi|780812798|gb|KJS17457.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Peptococcaceae bacterium BRH_c4b]  clstr ali  29  1......MFEILIAGFGGQGVLSTGQLLAYAGMLENRHVAWIPSYGPEMRGGTANCGISISDKLISSP-VVSEPTVLIAMNRPSLEK-FEKTVEPGGIIFVNSSLIEI---KATRKDVSVFYIPANNIAEELGNAKVANNIILGALLELTGVVTPDTVEESLRKVLPPHY-HKLIPINRKALETGAELVK... 178
213 6.000e-79gi|973107002|gb|KUK64289.1| Pyruvate ferredoxin oxidoreductase, gamma subunit [Desulfotomaculum sp. 46_80]  clstr ali  44  1......MIEIRFHGRGGQGAVTSAELLALAAISEGKYAQAFPSFGPERRGAPVVAFCRVDDHPIRLRTNIYSPDLVVVLDPSLLRINVAAGLKENGVLITNTKYTSGEIREKLGIKQALATINATKIALEEMGLPITNTTMLGSLLNARQVVHPDSLIGPLEKRFG-----RIADKNIRAFRRAYEET.... 178
214 7.000e-79gi|566067538|gb|ETI66499.1| pyruvate/ketoisovalerate oxidoreductase [Bacillus vireti LMG 21834]  clstr ali  26  1...MNMLEEIIIAGFGGQGVMSMGQLIAYAGMLEGKGVSWLPSYGPEQRGGTANCAVVVSDEPVGSP-LVTRPSTAIVLNNPSFDK-FEPRVRHEGLLIINSSLV---VGTSERKDIKVLEIPATDIANDLGNSRVANMILLGAFLELTKLVSTDSIIESLKKVLSS-EKHHLIEVNKQALIKGAALV.... 179
215 7.000e-79gi|995930558|gb|KXG43314.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Tepidibacillus sp. Z9]  clstr ali  26  3.......HEIIIAGFGGQGVMSMGQLLAYAGMIENKHVSWLPSYGPEQRGGTANVSVIISDEPVGSP-VISHPTTAIVLNKPSFDK-FEPLVIPGGVLIVNSSLIDV---KSTRQDITIIEVSASEIANELGEPKVANSIILGAFLEISKAVSPESVIESLKKVLPER-RHNLIPVNQLALQKGAQIV.... 177
216 7.000e-79JGI.Meta 7004858999 C3838891__gene_227259 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Tongue  ali  24  6.........VICAGFGGQGVMSMGQLMTYAGMLENKEVSWLPSYGPEMRGGTANCAVTISDQPVGSPIITDDATAAVIMNSPSLTK-FEGDVVPGGVILINSSLVHE---KCSRDDIEAYYIDANELSNELGGPKFANMVMLGAFLAVDDSVNIESVLEAFKKVFGKR-KEKFIPVNRQALEAGYNAVMSQK 183
217 7.000e-79gi|665941951|ref|WP_031307997.1| MULTISPECIES: 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Bacillus]  clstr ali  26  2......MEEILIAGFGGQGVMSMGQLIAYAGMTEGRYVSWLPSYGPEQRGGTANCAVVVSEEQVGSP-IVSRPTTVIVLNNPSYEK-FEPMVRAGGLLVVNSSLIS---KVSARTDIRVLTIDATDKANELGNPKVANMVLLGAFLEETGILSDESILEALKKVLSP-EKHSLLEINRRALELGRSLTKE.. 179
218 8.000e-79 GL0001325 [Complete] locus=scaffold3459_9:9049:9612:+  ali  26  6.KTMKE--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDDRISSP-ILSQYDTAIILNQPSLEK-FENRIKPGGILIYD---GYGIINPPTRKDIKVYRIDAMDAANEMKNAKAFNMIVLGGLLKLRPIVTLENIIKGLKKTLPERH-HHLIPMNEEAIKKGMELIREA. 187
219 8.000e-79JGI.Meta 7029940069 SRS023595_Baylor_scaffold_74716__gene_74827 putative 2-oxoglutarate oxidoreductase gamma subunit [Human Supragingival pl  ali  28  4........ELVIAGFGGQGVLSMGKILAYSGLMEDKNVSWMPSYGPEQRGGTANVTVIISDESVSSP-LVNEYDVVIALNQPSVDK-FTPRVKPGGILIYDTNGVTHI---PERTDIQIYEVPATDEANHMGNAKVFNMLVLGATLSVHPMLPLDSIRKGLEKSLPERH-HKLIPMNMKALERGGEIIRRH. 180
220 9.000e-79gi|764395076|ref|WP_044348134.1| pyruvate synthase [Dethiosulfatarculus sandiegensis]  clstr ali  41  1......MIEVRFHGRGGQGAVTSCELMAQAAIAEGRYAQAFPSFGPERRGAPLQAYLRISDEPIRLREKIYEPDIVVVLDPALVGGNVKDGLKEGGTLVANSPKSADDVKKDSGFNGRTAVVNATKIAEEEMGVPITNTTMLGALLKAASLVDKESVVEPLKNRFG-----KIAEKNQKSLERAFAETVIEE 182
221 1.000e-78gi|494500979|ref|WP_007290442.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Thermosinus carboxydivorans]  clstr ali  31  2......THEIIMAGFGGQGVMLMGQLVTYAGMIEGKQVSWIPSYGPEMRGGTANCSVIVSDEAIGAP-IVTEPTAVVAMNLPSLDK-FESALLPGGVLIINSSLIE---RSSKRDDITVYRVPANDIAAELGNSKVANMVVLGALIAATGAVATTSVLKAFQKMFAKK--PELLAINEQAIHRGAECIKK.. 178
222 1.000e-78gi|490720913|ref|WP_004583473.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas gingivalis]  clstr ali  27  2......TYEIVIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPSYGPEQRGGTSNVTVIVSDEQVSSP-VLNEYDIVIVLNQPSLDK-FEARVKKGGILVYD---PDSIVLKNKRDDIQIYEVDATQESLRMGNQKAFNMIVLGGVLKVAPMVKIESVIKGLKKTLPERH-HKLIPMNEQAIQRGMEIIKQ.. 179
223 2.000e-78gi|511025661|ref|WP_016279924.1| 2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase subunit gamma [Lachnospiraceae bacterium A4]  clstr ali  43  1...MKDTVEIRWHGRGGQGAKTAALLLADVAFQTGKYVQGFPEYGPERMGAPITAYNRISASPITVHSNIYEPDYVVVVDESLLDIDVTKGLSPKGAVIINSTRSKEEIEAHLGYQGAVYTVDAKEISMRALGKNYPNSPMLAAVVAVSKIMEKEEFLAEMKASFQHKFKPEVIDGNMMALELAFEAA.... 189
224 2.000e-78gi|493297876|ref|WP_006255506.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Alloprevotella tannerae]  clstr ali  25  4........EIIISGFGGQGVLSMGKILAYAGLMEGKEVSWMPAYGPEQRGGTANVTVIVSDNPISSP-ILSEYDTAILLNQPSLEK-FESKIKPGGTIIYDS---FGIIKKPTRTDINIYCIDAMNTAAELKMMKTFNMIVLGGLLKIHPIVQLEGVMKALKKTLPERHWH-LLPTNEQAILKGMEIIKPQ. 180
225 2.000e-78gi|19886358|gb|AAM01297.1| Pyruvate:ferredoxin oxidoreductase, gamma subunit [Methanopyrus kandleri AV19]  clstr ali  44  1......MIEIRIHGRGGQGAVTAAEILAIAAKEDGKYSQAFPFFGVERRGAPVTAFARIDDEFIKIRSQIYEPDHVIVLDSSLLAVDVTEGLPEDGLIVINAREEELDKIMEKFEDSDVYTVDATQIALDELGVPIVNTAMVGAYLKASDILTLDAVKKAIH----ARFSGEIAEKNVRAVERAYREVKA.. 181
226 2.000e-78gi|740214052|ref|WP_038055903.1| pyruvate synthase [Thermodesulfobacterium hydrogeniphilum]  clstr ali  41  1......MIEIRLHGRGGQGAVTSAELIAIAAINQGKFAQAFPSFGPERRGAPVQAFARIDDIPVRTREKVYNPDIILVLDPSLPKVKVTSGLKENGIAILNSHYSEKEVREILGDKGNLALVDATKIAIEEIGLPITNTTMLGAFLKVTGLIEPSYMEEALKARFG-----KLAEKNIKALQRAMKEIKIYK 183
227 2.000e-78gi|972621746|dbj|BAU22416.1| pyruvate synthase [Caldimicrobium thiodismutans]  clstr ali  41  1......MIEIRLHGRGGQGGVTSAELIAIAAINQGKYAQAFPSFGPERRGAPVQAFARISDSRIRTREKIYHPDVVLVLDASLPKVNVTAGLKDGGIAILNSSHSEGEVRKMLGYKGRLAIVDANKIALEEIGVPITNTTMLGAFIAATGLVDPAYMEAALKERFG-----KLAEKNIKAFQRAIKETKIY. 182
228 2.000e-78gi|524080368|emb|CCY57670.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:632]  clstr ali  44  1...MSHTIEIRWHGRGGQGAKTAALLLADVAFKTGMHVQGFPEYGPERMGAPITAYNRISDAPIRVHSNIYTPQYVAVVDETLLEVDVTAGLREDGAIIVNTSRPKSEILPHLGYKGSVYTVDAHKISMATLGKYYPNSPMLAAVVAITKVMEPEAFLREMELSFQHKFKPEVIAGNMEALRMTFKEVQ... 190
229 2.000e-78gi|851160666|ref|WP_048091468.1| pyruvate ferredoxin oxidoreductase [Candidatus Methanoperedens nitroreducens]  clstr ali  39  1......MKEIRIHGRGGQGSVTAAELLAVAAFEDGKYSQAFPAFGVERRGAPVTAFVRLSDKPIRLRSQIYEPDYVIVQDATLVDVDVEKGAKCDGIILINTEKNPSSFKFDTKASIK--TLDATKLAMDFIGKPIVNTTLIGAFAGVSGLIRPESIINAVMERFPG----PIGEKNAKAIQAAYDLMETQ. 180
230 2.000e-78gi|553311831|ref|WP_023056794.1| MULTISPECIES: 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Prevotella]  clstr ali  25  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDERISSP-ILSKYDVAIVLNQPSLDK-FQPKIKPGGILIYDGNGI---VSPPSRTDIQVYRIDAVEQAAEMKNAKVFNMIVLGGLLKVCPVVSTDGLQKALYKSLPERH-HHMIPLNMQAVDIGMKLITKQ. 180
231 2.000e-78gi|524019935|emb|CCY02594.1| 2-oxoglutarate oxidoreductase gamma subunit [Prevotella sp. CAG:924]  clstr ali  24  1...MK--TELIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDQRISSP-ILSRYDVAIVLNQPSLDK-FESKVKPGGTLIYDGYGV---LNPPTRKDINVYRIDAMDKAAEMKNSKVFNMIVLGGLLKVYPVVSTEGLQKALYKSLPERY-HHLIPLNMQALEEGMKIISKVE 181
232 2.000e-78gi|502259056|ref|WP_012744891.1| pyruvate synthase [Kosmotoga olearia]  clstr ali  64  1..MPEKYFEVRWHGRAGQGAKSASQLLAEAALEAGMYAQSFPEYGAERSGAPMKAFNRISDVPIRVHHTVENPDIIVIVDDTLLGSAITEGVKEDTVMIVNTVRGSNFVREKTGFKGKIFTIPATDIALEEIGRGIPNTVMIGALLKASNDIPLDAVLNRVKKMFSGKLTEEKIEANLRAVRRGYEEVK... 189
233 2.000e-78gi|931381618|gb|KPJ71913.1| pyruvate synthase [candidate division TA06 bacterium DG_78]  clstr ali  47  4.......LEIRWHGRGGQGAKTAALLFGDAAVETGKYIQAFPEYGPERMGAPVFAFNRISDEPILQHCGIKTPQIVVVLDTTLMEVDVTEGLPKDGVVLVNTQKNAGEIKQELKTTQKVYVVDASKISKDILKRDLPNTPMLGALIKASKLLDFKAMLESVKHRLEHKFPPDVVDGNIKAIKRAYEEV.... 188
234 2.000e-78gi|500041927|ref|WP_011722645.1| pyruvate synthase [Clostridium novyi]  clstr ali  46  1..MDKKLIEIRWHGRGGQGAKTASLLLAEVAFNTGMYIQGFPEYGPERMGAPITAYNRIANFPLRVHSNIYEPDFVVVVDESLLKVNCVAGLKKEGAIIINTKKSIDEIRKELGYEGKVYTIDARTISEETLGAYFPNTPMLAAIVKVLGIMDLDEFIEDMKDSFKHKFKPQVISKNMNALKRSLQEVNGIE 194
235 3.000e-78gi|962029642|gb|KTB48501.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Dehalogenimonas alkenigignens]  clstr ali  40  8....SELTEIRWHGRGGQGAVTSAELIAQAAINEGKYAQGFPSFGPERRGAPVMAFNRVNQRPIRNRAGITKPDVMVILDPSLLSINLTSGLKDGGTIIINTSKPSDAYPELVK-KFNLAVIDATRIAREELGVPIVNTTMLGALIKATGVVSVDSMIEPLKERFG-----RLAEKNIKALSRAYSETQVKE 191
236 3.000e-78gi|502885563|ref|WP_013120539.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Thermincola potens]  clstr ali  25  4........ELIIAGFGGQGVMSMGQLLTYAGMIEDKHVAYIPSYGPEMRGGTANCSVTISDREISSP-VFTEPSSVIIMNQPSLAK-FEPMLKPGGLMLINSSLVS---QKATRQDIRVLEIPGNEMAEKLGNGKVANIVLLGAYIEMTKVVTIDSIIESLKKVLPER-RHNLIPLNRQALELGAEIVQK.. 179
237 3.000e-78gi|491611263|ref|WP_005468821.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Porphyromonas catoniae]  clstr ali  29  4........EIVIAGFGGQGVLSMGKILAYSGLMEDKNVSWMPSYGPEQRGGTANVTVIISDDAVSSP-LVQDYDVVIALNQPSVDK-FTPRVKPGGTLIYDTNGVSHI---PERSDIEIYEVPATDEATNMGNAKVFNMLILGAMLAVRPILPLDSIRKGLEKSLPERH-HKLIPMNMQALERG........ 173
238 3.000e-78gi|521284011|ref|WP_020448279.1| 2-oxoacid:acceptor oxidoreductase subunit gamma [Candidatus Methanomassiliicoccus intestinalis]  clstr ali  45  3......TLEVRWHGRGGQGIVTANEILAGAALYEGKFMKAFPEFGPERMGAPIRAFARVSDEPIKVHSQVYFPDYVAVLDPTLININVLEGLKETGSLIVNNTASVSELKKTLDTDMDVHVVDASKIALETIGKPLANTAMLGALVKISGIVGLDSIIAEMQIKLGGKLPAPVVEKNVLSVKRAYEEVQ... 186
239 3.000e-78gi|820748071|ref|WP_046736965.1| pyruvate synthase [Dehalogenimonas sp. WBC-2]  clstr ali  39  1..MRSELTELRWHGRGGQGAVTSAELVAQAAIAEGKYAQGFPSFGPERRGAPVMAFNRVSSHPIRNRAGILEPDVVVVLDPSLVEINVTSGLKNGGIIIINTTKAIDSFSHLS-EKWQVAVIDANRIAREELGVPIVNTTMLGALIKATGIIELESMNEPLKARFG-----RLAEKNLKALKRAFGETQVKE 186
240 3.000e-78gi|931437337|gb|KPK22535.1| pyruvate synthase [Dehalococcoidia bacterium SG8_51_3]  clstr ali  43  1.MTNSKLIEIRWHGRGGQGAVTSAELVAQAAISEGKYAQAFPSFTPERRGAPVLAFNRINDEPIRSRAEVDQPDVVLIMDPSLLSIDATSGLKKGGTVIINTKKTAEQVKKDFGINARLAIVDADTIAQETLGVNIVNTTMIGAMIKATGVISPESVKEPLEKRFG-----RLAERNIKAMERAVKETKIGE 188
241 3.000e-78JGI.Meta 7026104706 SRS063999_LANL_scaffold_41716__gene_47251 ketoisovalerate oxidoreductase subunit vorA [Human Supragingival plaque microb  ali  25  16.......HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPSYGPEQRGGTANVTVILNDERISSP-ILNSYDIAIVLNQPSLDK-FEPKVKPGGVLIYDGYGIQ---RPATRTDINVYRIDAMDAATELNMQKTFNMIVLGGLLKVVPMVQLESVLRGLKKTLPERH-HKLIPVNEEAIRKGMELIRK.. 192
242 3.000e-78gi|488933092|ref|WP_002844167.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Peptostreptococcus anaerobius]  clstr ali  24  6.........VICAGFGGQGVMSMGQLMTYAGMLENKEVSWLPSYGPEMRGGTANCAVTISDEPVGSPIITDDATAAVIMNSPSLTK-FEGDVVPGGTILINSSLVHE---KCERDDIEAYYINANELSNELGGSKFANMVMLGAFLAVDSSVDIESVLEAFKKVFGKR-KEKFIPVNRQALQAGYDAVMDQK 183
243 3.000e-78gi|517275715|ref|WP_018464533.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella paludivivens]  clstr ali  25  1...MKK--EIIISGFGGQGVLSMGKILAYSGLLEDKEVTWMPAYGPEQRGGTANVTVIISDERISSP-ILSKFDIAIVLNQPSMDK-FLSKVKPGGILIYD---GFGIINPPARKDITVYRIDAMDKAAEMKNAKVFNMIVLGGLLKVCKIVSTDGLNKALYKTLPERH-HKLIPLNMQAVEEGMNLIEEVK 181
244 4.000e-78gi|503041887|ref|WP_013276863.1| pyruvate synthase [Thermosediminibacter oceani]  clstr ali  52  1...MAKVMEIRWHARGGQGAKTAALMLAESVAAMGKYVQGFPEYGPERMGAPMLAFNRISDEPIYIHSNVINPNVVIVLDPTLIGKKITEGVPEDGIYIINTTKTPAEVREMLDKGGKIYTLDANQISLDTIGRAIPNTPMMGAFIRATGIIPFDQFMSHIKELLSKKFKPEVVEGNLKAIERAYREVKEE. 192
245 4.000e-78gi|652920830|ref|WP_027174704.1| pyruvate synthase [Desulfovibrio aminophilus]  clstr ali  39  1......MIEIRIHGRGGQGGVTSAELLARAAIADGRFAQAFPSFGPERRGAPVQAFVRVDGKKIRLREKIYEPDLVLVLDPTLLDVDVAEGLKEGGMVVVNSAQPAEELKRKYGWP-KAACVDAGKVALEELGVPITNTTMLGALLKASGLLDVD----GMREVIDERFGPKLGPKNYKALERAFRET.... 178
246 4.000e-78gi|751614338|ref|WP_041082270.1| pyruvate synthase [Thermotoga profunda]  clstr ali  68  1..MPAKYYEIRWHSRAGQGAKSASQLFAEAILDMGKYAQAFPEYGAERSGAPMRAFNRISDEKITVHSSVERPNVVVVIDDTLLSPGIVEGLDEKGVLIVNTAHPIEYIRKKTGFNGKICTIKATDIALEEIKRGIPNTVMLGTIAKVTGLITLQAAEQKIRGMFEKKLSADMLQANIRALKRGYEEV.... 186
247 4.000e-78gi|503178680|ref|WP_013413341.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanothermus fervidus]  clstr ali  42  1......MIEIRFHGRGGQGAVTAAEILAKAAFYDGKYSQAFPFFGVERRGAPVLAFVRIDNKPIRIRYQVYKPNYVIVLDDKLVEVDVFKGLHEPAVVVINSK------NEIKKEGVKIYSVDATNIALETLGSPIVNTAMLGAFVGATKIIKLDSLIKAIKNSF----KDKIGEKNAKAAVKGYESV.... 173
248 5.000e-78 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and rela  ali  26  53...MKQ--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERISSP-ILSQYDTAIILNQPSLEK-FEGKIKPGGILIYDGYGIIE---PPTRRDIQIYRIDAMDAANEKGMAKTFNMIVLGGLLKLRPVVSIESVIKALRKTLPERH-HHLIPMNEEAIRIGMEIIKPQ. 232
249 5.000e-78gi|496182881|ref|WP_008907388.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Caloramator australicus]  clstr ali  30  5........EIIFAGFGGQGILSMGKFLAHAGLEENLNVSWFPSYGPEMRGGTSNCSVIVSDEPIGAP-LVTDATAVVVMNRPSLDK-FERYVVKGGLLIMDSDLVN---REPERTDIEVIKIPAQRIAEEVGSKKIANMVLLGALVEKTKIVSMESLLKALKE----HGKEQFYELNKKALERGAEFAK... 176
250 5.000e-78gi|931367286|gb|KPJ58700.1| pyruvate synthase [Deltaproteobacteria bacterium DG_8]  clstr ali  41  1......MIEVRFHGRGGQGAVTSAELVALAAISEGKYAQSFPSFGPERRGAPVQSFTRVSDQPIRLRSGIKEPDVVVVLDPALIVVGVLSGLKENGILVVNTRKSLAALKKEFSITHRTAVVDATAIARQILGLPITNTTMIGALVKATGVVTMESLIEPLHHRFG-----RIAEKNIKVCQKAFEETLVEE 182
251 5.000e-78gi|503633021|ref|WP_013867097.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanothermococcus okinawensis]  clstr ali  45  1......MIEIRFHGRGGQGAVTAAQILAKAAFYDGKFSQAFPFFGVERRGAPVMAFTRIDDKKIRLRSQIYEPDYVIVQDPTLLDIDIKGGLKKGGKIVVNTH------NNLQFSDCEVYTIDATGIALEVLGLPIVNTAMLGAFTGVTGEVTIESLKKAIMDTFPKK----LGEKNAKVAEVAYNMVK... 174
252 5.000e-78JGI.Meta 7019594635 C3022825__gene_183178 hypothetical protein [Human Stool microbiome from visit number 2 of subject 158337416]  ali  25  1...MKE--EIVIAGFGGQGVLSMGKILAYAGLMDNLEVTWMPSYGPEQRGGTANVTVIVSDKPISSP-VLDKYDTAVVLNQQSLDK-FESRVKSGGTLIYD---PSGIHHLPSRTDIRVVPVDAMEAAIELQNSKTYNMILLGALLKCRPIVEIDAVLRGLKKTLPERH-HHLIPLNEKALRKGMTLV.... 177
253 6.000e-78gi|921069069|gb|KON29700.1| hypothetical protein AC482_05810 [miscellaneous Crenarchaeota group-15 archaeon DG-45]  clstr ali  43  1..MKGRLVEVRFHGRGGQGAWTASLLLARAGLKEERYIQSFPTFGPERAGAPITAYTRISDEPIRLHSGVYEPDVVVALDPTLLGPAVVEGVKPGTKLVVNTDQSPAEVRERLGLDAEMWALDATSLALKVLGRPITNTAMLGACVRATGIIKLESLLDVVRERFSGR----VMEMNLEVVETAYKEA.... 183
254 7.000e-78gi|938508536|gb|KPQ41699.1| pyruvate ferredoxin oxidoreductase, gamma subunit [Candidatus Methanoperedens sp. BLZ1]  clstr ali  43  1......MYEVRFHGRGGQGAVMAAQTLAEAAVNEGNYAVAFPFFGAERRGAPVLAFTRIDSKKIFSKTQVYNPDCVVVLDDSLLDIDVVSGLKPEGIAVINSKERPEDID--LGKIINTATVNAISIALEILKAPITNTAILGAFAKATGVVKIESLEESIKRKFGEKLGEKTGERNALAARTAYE...... 179
255 8.000e-78JGI.Meta 7068140767 SRS015782_WUGC_scaffold_34082__gene_76237 2-oxoglutarate oxidoreductase, gamma subunit [Human Stool microbiome from visi  ali  26  1...MK--TEIIISGFGGQGCLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTASVTVIVSDERISSP-ILSKYDVAIVLNQPSLDK-FESKVKPGGILIYDGNGI---INPPTRKDITVYQIDATDKAAEMKNSKVFNMIVLGGLLKVCPVVSTEGLNKALFKSLPERH-HKLIPLNMEAVSEGMKIIEKKE 181
256 9.000e-78gi|499507719|ref|WP_011194359.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Symbiobacterium thermophilum]  clstr ali  30  3......THEILIAGFGGQGVLTAGQLLAYAGNLEGQHVSWVPAYGPEQRGGTANCSVVISDQPVACP-MVSEPTACIVLNQPSLEK-FTPAVQPGGTLVVNTSLCT---GRATRTDITVVPVPATDLAVELGNVRFANMIALGALLAVVPVVKVESILEVLPKVMGE-DKARYIPINREALSRGMEEAR... 179
257 9.000e-78gi|652500340|ref|WP_026894740.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Clostridiisalibacter paucivorans]  clstr ali  26  1......MDEIIIAGFGGQGVMAMGQLLTYSGMIEDKNVAWLPSYGPEMRGGTANCNVLISDEPIGAP-VVTEATAAVVMNLPSLDK-FEKDVVPGGKLFINSSLID---KKCSRDDIDVYYVPVNDLANDLGNAKVANMVMLGAFLELTNAVKVDSILEAFKKVFGE-NKSHLLPINEKALEKGASVVK... 178
258 9.000e-78gi|494109016|ref|WP_007049800.1| pyruvate synthase [Anaerofustis stercorihominis]  clstr ali  43  1...MNDCVEIRWHGRGGQGAKTAALLLADVAFQTGKYVQGFPEYGPERMGAPITAYNRISDKPVRVHSNIYTPQFVVVVDESLLSVDVTKGLREDGAIVINTTKEKEDIKHLLNYKGDIYTIDAKKVSIACLGKYFPNSPMLAAIVKVSNIMDEKLFLSEMKSSFEHKFKPEVVNGNMKALKMALKEVR... 190
259 9.000e-78JGI.Meta 7021039456 C785596__gene_59310 hypothetical protein [Human Posterior fornix microbiome from visit number 2 of subject 159005010] :_  ali  26  1MMEDKAMKELIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPSYGPEQRGGTANVTVILSDERISSP-VLNAFDTVIVLNQQSLDR-FESKVKPGGILIYDSYGI---HTPPKRTDIKIYKIDATEASIEMQNAKSFNMIVLGAYLKVKPTVSMESVIKGLKKSLPERHW-NLIPMNEEALKKGASLV.... 183
260 1.000e-77gi|740168775|ref|WP_038011688.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Tannerella sp. oral taxon BU063]  clstr ali  25  3.......HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPSYGPEQRGGTANVTVILNDERISSP-ILNSYDIAIVLNQPSLDK-FEPKVKPGGVLIYDGYGIQ---RPATRTDINVYRIDAMDAATELNMQKTFNMIVLGGLLKVVPMVQMESVLRGLKKTLPERH-HKLIPVNEEAIRKGMELIRK.. 179
261 1.000e-77 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2  ali  40  1......MIEVRWHGRGGQGAFTAARLLGQAAIHEHKYVQAFPSFGPERRGAPVLAFTRIDDKKITDRSEVETCDYVVVLDDTLYGENVTKGLKDGGVLVINTTK--EASAFPKVGDYQVITIDATALALDILGRPITNVPMLAALAAASGNVSVDSVLAAIDDQLAPRIR----EKNKKLFVAAYNAVKGDK 181
262 1.000e-77gi|503126051|ref|WP_013360712.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [[Clostridium] sticklandii]  clstr ali  22  6.........IICAGFGGQGVMSMGQLITYAGMLESKEVSWLPSYGPEMRGGTANCSVIVSETPIGSPVITNDATSAIIMNLPSLTK-FEKDVAPGGSIFINRSLIE---KKVERTDVDVYYIDANEIALELGNPRVANMVMLGALIEINKTVSIDSVLEAFKKVFGP-SKEKFVPLNKEAIEKGMQAVRE.. 181
263 1.000e-77JGI.Meta 7058221908 SRS049959_WUGC_scaffold_38415__gene_72859 ketoisovalerate ferredoxin oxidoreductase [Human Stool microbiome from visit n  ali  25  4........EIIIAGFGGQGVLSMGKILAYAGLMENKEVTWMPAYGPEQRGGTANVTVIVSDDPVSSP-ILSSFDIAIVLNQPSLEK-FEPKVKPGGIIIYDGYGISE---PPTRKDIKVYRIDAMDAAAEMNLIKTFNMIVLGGLLKIRPVVKIESVLAALRKTLPARH-HNLIPQNEEAIRKGMEIIKEVQ 181
264 1.000e-77gi|965596772|dbj|BAT70827.1| pyruvate ferredoxin oxidoreductase, gamma subunit [Thermosulfidibacter takaii ABI70S6]  clstr ali  48  1......MVEIRFHGRGGQGAVTSAELLAKAAIAEGRYAQAFPAFGAERRGAPVQAFTRISDEPIKIRIGIYEPDIVVVLDPTLLRIPVLDGLKEGGILVLNAKWDVKEVRERLGWKGKLAVVDATKIALEELGVPITNVVMLGALLKARGLASLEDVEKEIADRFP-----KIKDMEIKAFRRAYEEAVIDE 183
265 1.000e-77gi|501423447|ref|WP_012448117.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Natranaerobius thermophilus]  clstr ali  29  1......MQEVIMAGFGGQGVMSMGQLLTYAGMLESKGVAWMPSYGPEMRGGTANCTVVITDEEVGSP-IVSNPDTLIAMNYPSL-VKFKDSIKAGGVLLYNSSLIEEEVESI--DDVDIYPIPANEIANELGESRIANMVMLGAFIEKTHAVSIDSVLESLKKVLPEK-RHNLIPVNEKALRKGAEMVK... 179
266 1.000e-77gi|491750135|ref|WP_005583268.1| hypothetical protein [[Clostridium] ultunense]  clstr ali  28  1......MEEITIAGFGGQGVMAIGQLLTYAGMIEGKHVSWLPSYGPEMRGGTANCSVIVSSEPVGSPVVVNS-TTAIVMNKPSLDK-FESTVNPEGRLFINSSLIE---QKSGREDIEVYYIPANEIADELGNMRVANMVMLGAYLEVTKIVDLESILEGFTKVFGE-NRAHLIPINKDALERGAETARRQ. 180
267 1.000e-77gi|973053281|gb|KUK26887.1| Pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Acetothermia bacterium 64_32]  clstr ali  51  1......MKEIRWHGRGGQGAKTVSQILAQINLREGKHVQSFPEYGPERSGAPVRAYNRISDEEILIHSGVYHPDISVVIDETLLDENPTEGLSPKGALLVNTKRSPEEVRKLTGYSGEIICLDADKIAQEA-GTGFPNVPMLGATVAVLGT-DPKLAEEELKETLSHRLPPEVVEKNLQAFRAGYEAAKGA. 184
268 1.000e-77JGI.Meta 7075615254 C4871385__gene_143149 putative 2-oxoglutarate synthase subunit [Human Stool microbiome from visit number 1 of subject 15  ali  24  4........EIIIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPSYGPEQRGGTANVTVILSDNRISSP-ILNAFDAAIILNQPSLDK-FESKIKPGGVLIYDSYGI---HHAPTRTDINIYCIDAMDAAVEMNNTKAFNMIILGGLLKIKPMVTLENVLKGLKKSLPERH-HKLIPMNEQAILKGMELIRK.. 179
269 1.000e-77gi|738997310|ref|WP_036879487.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas sp. COT-239 OH1446]  clstr ali  26  2......TYEIVIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPSYGPEQRGGTSNVTVIVSDDAVSSP-VVNDYDIVVALNQPSLDK-FAPRVKPGGVLIYDTNGIHHV---PGRTDIEIYEVDATEEANRMGNQKVFNMLILGALLSARPMLSINSVQKGLMKSLPERH-HKLIPMNMEALAKGAELLKRHE 181
270 2.000e-77gi|309389600|gb|ADO77480.1| Pyruvate/ketoisovalerate oxidoreductase, catalytic domain protein [Halanaerobium praevalens DSM 2228]  clstr ali  24  1..MMKE--EVIMAGFGGQGVMSIGKLLSYAGMKESKEVSWMPSYGPEMRGGTANCTVIVSDKKIPSPLS-SKPDSIIVMNLPSLDK-FAPKVKSGGTIFVNSSLISKEV---ERDDVEVVKIPANKIANELGNNKAANMAMLGAYIAKKEIVSLDTVKNSLENVLPER-RHGLIPINEKALAKGNEI..... 177
271 2.000e-77gi|816616841|gb|KKM12932.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Clostridiales bacterium PH28_bin88]  clstr ali  25  3.......HEVVVAGFGGQGVLLTGQLLAYAGMLEDKQVAWIPSYGPEMRGGTANCTVTVSEQEISSP-VVEEPSAALIFNLPSLAK-FESRVRPGGILLINSSLVD---RKSNRKDLHVYEIPANEIADTLGNGRVANMVMLGAYLELTGAVSVASVMKALEKVLPE-HRHNLLPLNQKAMEMGAKAVRK.. 179
272 2.000e-77gi|490462644|ref|WP_004333203.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas endodontalis]  clstr ali  26  2......THEIVIAGFGGQGVLSLGKILAYSGLMENKEVSWMPSYGPEQRGGTSNVTVIVSDEKVSSP-VVNQYDIVIALNQPSLDK-FAPRVKKGGILIY---EPNGIHTKTTRDDIRIYSVDATEEALKLGNDKAFNMIILGGLLKIVPVVKLDSVVAGLKKSLPERH-HKLIPMNEEAIKIGMTAIKQE. 180
273 2.000e-77 GL0006131 [Complete] locus=scaffold14237_8:292:915:-  ali  42  15...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISQDVIRVHSNIYHPDYVVVVDETLLEVDVTAGLKKEGAIIVNTPKSKEEIMEHLGYEGDVYTVDGRKISVDALGKNFPNSPMLAAIVAVSKVMPRDKFITEMRASYEHKFKPEVIDGNMKALEMAFDAVEA.. 205
274 2.000e-77gi|503743892|ref|WP_013977968.1| pyruvate synthase [Clostridium sp. SY8519]  clstr ali  46  1...MSKGIEIRWHGRGGQGAKTAALLLADVAFKTGKQVQGFPEYGPERMGAPITAYNRISEEEIRVHSNIYDPDYVAVVDETLLHVDVTAGLSEQGAIIVNSPRSAREVAELPDYHGKVVTIDARKISEETLGKNFPNSPMLAAVVAVTQVMNREEFLREMRASYGHKFKPEVIEGNMRALER......... 184
275 2.000e-77gi|973034511|gb|KUK12669.1| hypothetical protein XD51_0426 [Moorella sp. 60_41]  clstr ali  44  1...MAKMVEIRWHARGGQGAVLASRYLAASAIRENLYFQAFPQFGTERMGAPIVAYTRISDAPINLRCAIERPDMVVVLDPTLLKVKVTANLKEGGAVIANYPGTVADLARELEVDGKVYAVDAYKISSEELGRPIPNTPMVGALARVMGLIKLENILAEFEEQFSHRFKPEIVQKNLQAVRRAYEEVQ... 189
276 2.000e-77gi|652505602|ref|WP_026899911.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Peptostreptococcaceae bacterium VA2]  clstr ali  24  6.........VICAGFGGQGVMSMGQLLTYAGMLEGKEVSWLPSYGPEMRGGTANCAVTVSDSPVGSPLITGDATCAIVMNLPSLEK-FESEVKPGGKIIVNSSLIE---QKVQRDDIEVYYIPANDIASDLGNPKVANMIMLGAYLETEPAVEVDSVLEAFKKVFGP-SKEKFVPLNKDALLKGGAAIK... 180
277 2.000e-77 GL0032157 [Complete] locus=scaffold52916_1:152:694:+  ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPSYGPEQRGGTANVTVILSDERISSP-VLNAFDVAVILNQPSLEK-FESKVKPGGILIYD---GYGIHHPPTRTDINVYCINAMEAAIEMNNTKAFNMIVLGGLLKLRPMVSMENVLKGLKKSLPERH-HHLIPMNEQAILKGMEIIRK.. 179
278 2.000e-77gi|503324221|ref|WP_013558882.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Anaerolinea thermophila]  clstr ali  31  3.......TEIIVSGFGGQGVLFAGQLLSYAAMDAGKEVTWIPSYGPEMRGGTANCTVVISDEEIGSP-LVKHPQAVIAMNLPSLDK-YEPLVKSGGVLIVNASMVN---RQPARTDIHWVMVPGNEIAEELGDRRMTNMVMLGALLANLPILSLEALVRTLEAHMPARH-QRLLPLNIEAIKRGAEY..... 176
279 3.000e-77 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and rela  ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIISDDPISSP-ILNQYDVAVVLNQQSLDK-FESKVKPGGILIYD---NYGIHRAPERTDIRVYNVEAMEASFDMQNAKTYNMIVLGALLKVCPMVKMESVLAGLRKSLPERH-HKLIPMNEEAIRKGMALIKE.. 179
280 3.000e-77gi|671518494|ref|WP_031503916.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Pseudothermotoga hypogea]  clstr ali  31  6..........VLAGFGGQGVMLMGQILAQAGMQEGKNVTWFPSYGPEMRGGTANCTVVISDEPVASP-IVDNPDVVVAMNIPSLLK-FEPRLKKSGFLFLNSSVID---RRPNRNDIKIVEVPANEIADKIGNLRVANMVMLGAIIAVTNCVRKDSIVSALQYKLGEKGS-SLLKLNIEAIEAGIKHV.... 177
281 3.000e-77gi|565856343|ref|WP_023938641.1| 2-oxoglutarate oxidoreductase gamma subunit [Porphyromonas crevioricanis]  clstr ali  25  2......TYEIVIAGFGGQGVLSMGKILAYSGLMENKEVSWMPSYGPEQRGGTSNVTVIVSDDAVSSP-VVNEYDIVIVLNQPSMDK-FEPKVKKGGILIYD---PNGIHRKPSRTDVSIYEVDATDESMAMGNQKAFNMIVLGGMLKVAPMVTIESVVAGLRKSLPERH-HKLIPMNEDAIKRGMDIIRK.. 179
282 3.000e-77gi|506404069|ref|WP_015923788.1| pyruvate synthase [Halothermothrix orenii]  clstr ali  43  1......MLEIRWHGRGGQGSKTASILLAKIASATGKHIQAFPEYGPERMGAPVLAYTRISDGPIHLHCQVETPDLVVVLDPTLITVDITQNLKKGGNLIINSDYEPDKIRDKLGADVNTYTIDANTISEEEIGRIFPNTPMLGAINRVVNLMDQDSFLNQAREELKKKHKPEVIEGNMRSIDMAYREVK... 188
283 3.000e-77gi|973129053|gb|KUK81615.1| Uncharacterized protein XD96_1105 [Petrotoga mobilis]  clstr ali  65  556....EKYFEIRWHARAGQGAKSASQFLTEAAEEAGKYSSSFPEYGAERSGAPMKAFNRIADVPIRIKSNIETPDVVVVIDDTLLNPEVTSGLAEDKLLLVNTSRSIEEVRKLSGYKGRIGVIPATEIALEEIKRGIPNTVMIGALIRATDIVPLDAVKEKIKAAFSKKFSDEVVRANIRALERGYQEVKLSE 744
284 4.000e-77JGI.Meta 7016111453 C3306628__gene_248629 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  47  2....KNTVEIRWHGRGGQGAKTAALLLADVAFKAGKYVQGFPEYGPERMGAPITAYNRISDEKITVHSNIYDPDYVVVVDEGLLDIDVTAGLNPEGAIVVNSAKPASEIIPKLGYTGKVYTVDAHKISVAALGKYFPNSPMLAAIVAVSKVMDKEQFLTEMEGSYKHKFKPEVIDGNMKALRMTLEEV.... 189
285 4.000e-77gi|154153486|gb|ABS60718.1| pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Fervidobacterium nodosum Rt17-B1]  clstr ali  68  30.....NIFEIRWHGRAGQGAKSASQMLAEAALDMGKYVQAFPEYGAERTGAPMKAFNRISDEPILLHSSVETPNLVVVIDDTLLNPDILAGTNEETVLIVNTVRSIEWVRQKSGFKGKICVVKATDIALEELGRGTPNTVMLGAIARVTGVIELKYVEDKIRDMFLKKFGEEVVNKNIRALHRGYEEV.... 213
286 4.000e-77gi|973014226|gb|KUJ96316.1| Pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Desulfonauticus sp. 38_4375]  clstr ali  43  2......MLEIRIHGRGGQGGVTSAELLAKAAIDKGKYAQAFPSFGPERRGAPVEAFVRVSDEPIKIREKIYEPDVVLVLDPTLLDVKVDAGLKEKGLVVVNTPEQAESVKKKYNYP-RLAQVDALKIALDTLGVPITNTTMLGALLKATNLLSPADMEEVLMERFGAK----LGPKNFAALQKAFE...... 177
287 4.000e-77gi|985672029|gb|KXB02787.1| pyruvate ferredoxin oxidoreductase [candidate divison MSBL1 archaeon SCGC-AAA261G05]  clstr ali  42  1......MKEIRIHGRGGQGSVTMAQMLAQAAFEDGKWAQGFPSFGVERLGAPVQAFTRIDDEKITDRSQIDTPDYVIVQDPTLIGVNVLEGLREDGMVLLNSTSSPEELGLE--TEAEVLTVDATNIALEHLGKPIMNTALMGAFSSATGLIKKDSIIKVVKE----KFSGEIGEKNASAINAAFERVK... 178
288 4.000e-77gi|835183955|ref|WP_047383818.1| MULTISPECIES: 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Cetobacterium]  clstr ali  28  5.........IICSGFGGQGVMSMGQILAYSGMIENKEVSWLPSYGPEMRGGTANCSVILSDEPIGSPVITNNATVLIAMNLPSLKK-FQDSLLENGTLLVNSSLVKEE---SDREDIKIYKIPANDLAHECANLKVANMVMLGAYLEISKSLKDESVLHGFLKIFGER-KADLLPINEKALQVGREYIK... 180
289 5.000e-77gi|493767545|ref|WP_006716113.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfitobacterium metallireducens]  clstr ali  27  4........EIILAGFGGQGVMSMGQLLAYAGMFEGEHVSWIPSYGPEMRGGTANCSVTLSDLPISSP-VISEPNTLIVLNRPSLEK-FEKGLKTGGLLLMNSSLIDIS---PQRDDIQVVKIPSDDLANKFGNSRVANMILLGAFLELTHAVSLESVEKALKKVLPE-YRYNLISMNRDALELGVSIVK... 179
290 5.000e-77gi|851169332|ref|WP_048095688.1| pyruvate ferredoxin oxidoreductase [Geoglobus ahangari]  clstr ali  38  1...MGILIEVRFHGRGGQGAVTAADLLAVAGFKDGYYTLSFPMFGAEKRGTPVVSFLRVSDEPIVIRDEVKNPDYVVVMDPSLIDVDVLAGIKENGMLIVNYPKGADELREKLNTDVKVYTINATKMATEILGRPITNTAMVGALVGATEIIRIESVEEAIMEFFENK---EIAEKNVQLVRKAYEYMKE.. 185
291 5.000e-77gi|494607266|ref|WP_007365513.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas uenonis]  clstr ali  25  3.......YEIVISGFGGQGVLSMGKIIAYSGIMENKEVSWMPSYGPEQRGGTSNVTVIVSDEPVSSP-VVNEYDVVIVLNQPSLDK-FGPRVKKGGILIYDPALIQH---KSDRKDINIYEVPATEQSMEMGNDKIFNMIILGGMLKAAPMLKLESIIAGLKKSLPERH-HKLIPLNEEAIKRGMN...... 175
292 5.000e-77gi|524757950|emb|CDE57149.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase gamma subunit [Prevotella sp. CAG:873]  clstr ali  28  1...MKE--EIIIAGFGGQGVLSMGKILAYAALMDNLETTWMPAYGPEQRGGTANVTVIISDSAISSP-IVDSYDTAVILNQQSLDK-FESKVKPGGTLIYD---PYGIHRAPTRTDIRVIPVDATDAAIEMGNSKTYNMILLGALLKARPLVPDDAVVRGLRKTLPERH-HHLIPLNEEAIARGKALVK... 178
293 6.000e-77gi|531656239|gb|EQJ34011.1| pyruvate ferredoxin/flavodoxin oxidoreductase family protein [Clostridium difficile P19]  clstr ali  22  6.........VICAGFGGQGVMSMGQLLTYAGMLEGKEVSWLPSYGPEMRGGTANCAVTVSNEPVGSPLITDDATAAILLNIPAFEK-FKDDVIPGGKIIVNSSLIKE---KVDRTDVDVYYIPANELAAELGNDKVANMIMLGAYLKVSDTVDIESVLEAFKKVFGPR-KEKFVPLNREALQKGMDAT.... 179
294 6.000e-77gi|496676860|ref|WP_009319350.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonadaceae]  clstr ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPSYGPEQRGGTANVTVILSDERISSP-VLNTFDVAIILNQPSLEK-FENKVKPGGILIYD---GYGIHHAPTRKDIDIYRIDAMDTAIEMENSKAFNMIVLGGLLKVKPMVSLENVLKGLKKSLPERH-HKLIPMNEQAILKGMEIIRK.. 179
295 7.000e-77gi|751384748|gb|AJF59828.1| pyruvate/ketoisovalerate ferredoxin oxidoreductase subunit gamma [archaeon GW2011_AR10]  clstr ali  41  1......MKEIRFHGRAGQGMVTAAVIVANAVSLEGKYSQAFPFFGSEKRGPPVTSYCRIDDKPINIHEEIDRPDIVVVADATLKEVDVCAGLKENGIVIINTNRKPEQLKLKAK---RVFTIDGTGIALKHLGKPITNTVMLGALLKVTGIAKLENALKALEKQFGSKLSKEMVEKNKKVVVECYDLVQLQE 184
296 7.000e-77gi|511626578|emb|CCX43282.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Prevotella sp. CAG:1031]  clstr ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMDDLEVTWMPSYGPEQRGGTANVTVILSDKPISSP-VLDEYDCVVALNQQSLDK-FEPKVKKGGTLLYD---PYGIHRAPTRPDINAVAVPAMEATFEMGNSKTFNMIVLGGLLGVRPMVPVESVLKGLKKVLPERH-HHLIPLNEEALRKGISLTKK.. 179
297 8.000e-77gi|504619564|ref|WP_014806666.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Anaerobaculum mobile]  clstr ali  29  1...MSFYREMIAAGFGGQGIMLMGQIIAHAAMYDGKNVIWIPSYGPEMRGGTANCSVVVSDGEIASP-LISSPDILVVMNQPSLAK-FVNRLKKGGILVYNTDLVTYD---NPRDDINIVGVNANSIALELGNERVANIVVLGALAEVTDMASVESLKEALKELLGAK-KASLLEINLKAFEKGQEIGKQY. 182
298 9.000e-77gi|737400024|ref|WP_035381352.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Fervidicella metallireducens]  clstr ali  29  5........EIIFAGFGGQGILSMGKFLAYAGLDEGLNVSWFPSYGPEMRGGTSNCSVIIDEDPIGSPLVV-DASTVVVMNRPSLDK-FESHVVPGGLLIIDSDLVN---REPERTDIDIIKIPAQTAAEEVGSKKIANMVLLGALVERTKIVPMEALLHALK----AHGKEQFYELNKKALEKGAEYARK.. 177
299 9.000e-77gi|493484106|ref|WP_006438929.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [[Clostridium] hiranonis]  clstr ali  23  6.........VICAGFGGQGVMSMGQLLTYAGMLENKEVAWLPSYGPEMRGGTANCAVTVSDHEVGSPLITDDATAAVLMNLPAFHK-FQNDVIPGGKILVNSSLIKE---KVARDDVDVYYIPANELAVELGNPKVANMIMLGAYLGVSGTVSVDSVLEAFKKVFGER-KAKFIPLNRAALEKGIEATQK.. 181
300 9.000e-77gi|655064733|ref|WP_028513024.1| hypothetical protein [Ruminococcaceae bacterium AE2021]  clstr ali  29  6.........IILAGFGGQGILSAGKMAAEAALYEGKEVSWFPSYGPEMRGGTANCSVVISDEPIGSP-VVNDADVVICLNQPSMEK-FEPCIKPGGILIIDSSLI---HIKPTRTDIKFIPMNASEIASELGNMAFATISMLGCLSAATGCFKRESFESALYEVLPER-RHKLIPGNVAAFDKGAKFAE... 179
301 9.000e-77JGI.Meta 7053805477 C2705071__gene_138870 2-oxoglutarate oxidoreductase, gamma subunit [Human Tongue dorsum microbiome from visit number 2 o  ali  25  8.KAMKK--EFIIAGFGGQGVLSMGKMLAYTGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDSRISSP-ILSKYDVAVVLNQPSLDK-FEPKVKEGGILIYDGNGI---INPPKRKDIQVYRIDAMKKAIELKNAKVFNMIVLGGMLKVCPIVSVQGLEKALFKSLPERH-HHLIPLNMKAVNVGLESIEQQ. 189
302 9.000e-77 GL0034999 [Complete] locus=scaffold93051_1:5374:5952:-  ali  43  10.......TEICWHGRGGQGVVTANEILAESAIYSGKYVKAFPEFGPERMGAPIRAFSRISDGPVRVHTQVYEPDIVIVIDPTLIGKDVAKGLKKGGFILANYEGTPAELQKAIGTTAECHSVNASKIALEEIGKPLVNTAMLGALIKIRPIITYSEMEDNITDKFTGKLSDKLIVKNLSALKRAYEEVE... 192
303 1.000e-76gi|780795538|gb|KJS01872.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Peptococcaceae bacterium BRH_c4a]  clstr ali  26  1......MYEILIAGFGGQGVLSTGQLLAYSGMVEGKHVAWIPSYGPEMRGGTANCGVTISQQPISSP-LVSEPTVLIAMNRPSLEK-FENSVVKGGLIFVNSSLIDI---RASRKDVGVYYIPANDMAEDIGSSKVANNIILGALIELTGVVTPEAIEKSLKDVLPPHH-HKMIPLNLKAMEAGASLVR... 178
304 1.000e-76gi|655513095|ref|WP_028894158.1| pyruvate synthase [Syntrophorhabdus aromaticivorans]  clstr ali  42  1......MIEVRFHGRGGQGAVTSAELIAQAAIGMGLYAQAFPSFGPERRGAPVQAFLRVSDKPIRLRSKVYQPDHVIILDPTLLTVNCTEGLKPDGFVIINSNKSLEELKKIF-PDRNIACVDASTIAKEELGVPITNTTMLGCLIKVTSVVDLASLEEPVKHRFGA-----VAYKNVNAYARAHKET.... 177
305 1.000e-76gi|503303483|ref|WP_013538144.1| pyruvate synthase [Thermovibrio ammonificans]  clstr ali  52  1......MIEIRWHARGGQGAVTASKILASAVIREGKYAQSNPDYGAERSGAPLRAYNRVSEEPITLHCMVLNPDIVVVVDPTLLKVPFLEGTSEDAVLVINTNKTPQEVREKYNIQGKIYTVDATKIAMEELKRPLMNVPMLGALVKVLGLVDIKTVEEDIKKTFGKKISENALAANVRALYRAYEEVKGE. 188
306 1.000e-76gi|652798684|ref|WP_027096536.1| pyruvate synthase [[Clostridium] viride]  clstr ali  46  1.MANKTMVEIRWHGRGGQGAKMACLLLAEVAGQVGKFVQGFPEYGPERMGAPITAYNRISDTRCPVHSNIYTPDYVVVLDETLLDVDVTHGLRDGGAIIVNTPSSGEVIRPKLRYTGALYTLDARHLSEEILGRNFPNTALLAAVVKVSGVLELEAFLEHIEASFRKKFKPQVIAGNLEILRKASEEV.... 191
307 1.000e-76gi|524337777|emb|CDA95069.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Bacteroides sp. CAG:709]  clstr ali  24  4........EIIIAGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDAPVSSP-ILSSFDIAIVLNQPSLEK-FEPKVKPGGIIIYDGYGISE---PPTRKDIKVYRIDAMDAAAEMNLIKTFNMIVLGGLLAIRPVVKIDSVIAALRKTLPERH-HNLIPKNEESIRKGMELIKEVK 181
308 1.000e-76 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and relat  ali  26  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTCNVTVIVSDERVSSP-IVSEYDVAIVLNQPSLDK-FEPKVKKGGFLIYDTSGI---INPPKRTDITVCPIAALDKAVEMKNSKVFNMIVLGGLLKVCPVVSDKGVEKALYKTLPERH-HGLIPLNMEAIKAGREIIK... 178
309 1.000e-76gi|968565320|gb|ALT68209.1| pyruvate ferredoxin oxidoreductase gamma subunit PorC [Methanobrevibacter millerae]  clstr ali  39  8.MEENLMIEIRFHGRGGQGSVTAAEILAKAAFKDGKYSQAFPFFGVERRGAPVMAFTRIDDEPIEIRYQIYNPDYVLVLDDGLMNVDVFSGIKDNTEVMIN---IPEEFKGS--GEHKVYSIDATGIALELLGRNIVNTIILGYFAKKTGIVTIDSLIEVILETFPGK----IGELNAEATRKAYE...... 184
310 1.000e-76 GL0029609 [Complete] locus=C4559709_1:1404:1946:-  ali  25  1...MKQ--EIIAAGFGGQGVLSMGKILAYAGLIDDLEVTWMPSYGPEQRGGTANVTVVLSDSPISSP-VLDSYDTAVILNQQSLDK-FESKVKPGGTLIYD---PYGIHHAPTRTDINIYPVNAMDVALELKNAKSYNMIILGALLKINPIVSVDSVMTGLKKTLPERH-HHLLPANREAIMRGMDLVEV.. 179
311 2.000e-76gi|780790962|gb|KJR97564.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Desulfobulbaceae bacterium BRH_c16a]  clstr ali  27  6.........ILCAGFGGQGVMSLGQLLTYAGMIENKHVTWLPSYGPEMRGGTAYCSVVVSDTPVGSPIVTRNATCVIVMNLPSLLK-FEQSVAPGGVLLVNSSLID---KPVDRQDIRVFAIAANDLAAECGNARAANMIMLGAYLALSKVVSVESVALAFKKVFGEKA-HRLLDRNILALHRGAEAV.... 179
312 2.000e-76gi|500169126|ref|WP_011843551.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Methanoculleus marisnigri]  clstr ali  39  1......MRELRIHGRGGQGSVTAAELIAYAAFEGGVFSQAFPAFGVERRGAPVQAFVRFSDEKVRLRSQIYEPDYIIVQDPTLIDVDVFNGMKAGGIAIINTEKSDFDSGVPEG--VKVYTIDATTIALEELGVPITNTTLMGAFAAATGEIGLEPLEHALR----SRFSGSMADKNVRAAERAYNLI.... 177
313 2.000e-76gi|502801850|ref|WP_013036826.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanohalophilus mahii]  clstr ali  39  1......MKEIRIHGRGGQGSVTAAELLAGAAFEDSQFSQAFPAFGVERRGAPVQAFTRISDAPIRLRSQIYEPDYVIVQDPTLIEVDVESGAKDDGIILINSDFAPED--FDLDTNARIMTVNATKVALDIIGRPIVNTVLLGAFAGATGEVRASSIVNAVK----GRFSGKIGEKNAEAVQKAYDLMAEEK 181
314 2.000e-76gi|500974169|ref|WP_012036589.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanocella arvoryzae]  clstr ali  42  1......MKEIRIHGRGGQGSVTAAELIAVAAFEDGKWSQAFPYFGTERRGAPVTAFARIADRQIRVRSQIYEPDYVIVQDPSLISVDVAGGVRENGLLLINSEKKPSELK--INTKARVRTFDATKLALEVIGLPIVNTALLGAFAGATGEIRLESVNKAIR----GRFAGKVADKNIAAVKKAYELM.... 177
315 2.000e-76gi|973116173|gb|KUK71941.1| 2-oxoglutarate oxidoreductase, gamma subunit [Clostridiales bacterium 38_11]  clstr ali  27  1......MIEVIMAGFGGQGVMAIGKLLAYAGMVEDKQVSWLPSYGPEMRGGTANCDVIVSDKLIGSPVLTDDATAAIVMNLPSMDK-FESHLAKDGKLIVNKSLIS---KKAIRDDIGVYYIDANEIAAEIGNPKASNMVMLGAFLELTGIVSPDSVLKAFTKVFGE-DKARFIPLNAKALEKGAEAVK... 179
316 2.000e-76gi|1001957685|gb|KXS56396.1| pyruvate synthase [Candidatus Adiutrix intracellularis]  clstr ali  39  1......MIEIRFHGRGGQGAVTSAELMARTAIGSGKYAQAFPSFGPERRGAPVTSFLRISDIPIRIREKVYTPNVVVVLDPSIMGVKVDAGLKDNGLLIINSAKPVEELRRQYGFKQKIATIDALHIALEELKVPITNTVMIGSLSKALGVATPDEV----RCHLEERFGPSLASRNQKAFERAYNETKVE. 182
317 2.000e-76gi|921234883|ref|WP_053179364.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Sunxiuqinia dokdonensis]  clstr ali  26  4........EIIIAGFGGQGVLSMGKILAYSGVMQDQEVTWFPSYGPEMRGGTANVSVIISDTRISSP-ILHEFDTAIILNQQSMDK-FEKTVKPGGVLLYD---PNGIVNPPTRTDINIYKIEGTKIAADLGNVKTFNMVVLGAYLKAKPIVKMESIRKGLEKSLPERH-HKLIPLNLEAIEAGQE...... 175
318 2.000e-76gi|992543485|gb|AMH94150.1| pyruvate ferredoxin oxidoreductase gamma subunit PorC [methanogenic archaeon ISO4-H5]  clstr ali  43  13.......TEICWHGRGGQGVVTANEILAESAIYSGKYVKAFPEFGPERMGAPIRAFARIQDTPIRVHTQVYEPDIVIVIDPTLIGKDVAKGLKKGGFILANYEGTPAELQKALGTTAECHAVKASKIAIEEIGKPLVNTAMLGALIKIRPIISYNEMEDHITDKFTGKLSDKLIVKNLSALKRAYDEVE... 195
319 2.000e-76gi|948249053|ref|WP_056906636.1| 2-oxoacid:acceptor oxidoreductase [Nocardioides sp. Root122]  clstr ali  39  1......MFAVRIHGRGGQGAVTAAELLSVAAFDEGRHAQAFPTFGSERTGAPVVAFCRIDDRPIRLREPITDPDALIVQDATLLHVDLFAGLRPDGYLVLNTSATLESLGLAELVDGHVLTVPATEIARQQVGRPLPNVPLLGAFAALTGQVSLAAVLDAVR----ARFPGDLGERNVRAAETAHDLVR... 184
320 2.000e-76gi|503699018|ref|WP_013933094.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Pseudothermotoga thermarum]  clstr ali  31  6..........IIAGFGGQGVMLMGQILAQAAMIEGKNVTWFPSYGPEMRGGTANCTVVISDEPVASP-VVENPLELVVMNIPSLLK-FEPKVKPSGYLFVNSSVVD---RKPTRNDIQVFEIPVNDLAEKLGNARVANMVMLGAVVQVTKCVKLDAVVEAIKYKLSSRG-EQIVDLNIKAIYEGVRHV.... 177
321 2.000e-76gi|501770080|ref|WP_012635625.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Halothermothrix orenii]  clstr ali  23  1...MKE--EMIIAGFGGQGVMLMGKLLAYAGMKEGIEVSWMPSYGPEMRGGTANCTVIMSSNKIPSPLS-SKPDTIIVMNLPSLEK-FAPRVKPGGTIFVNSSLIEKEV---DRDDVEVIKVPANELANELGNSKVANMVMLGAYLSKKDVVDLNTVKDSLKSVLSRRH-HKLIPINEKALDTG........ 173
322 2.000e-76gi|655444080|ref|WP_028828476.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Proteocatella sphenisci]  clstr ali  26  5.........VICAGFGGQGVMSMGQLLAYAGMIEDKHVSWLPSYGPEMRGGTANCAVTVSDEEISSPVITNDADIAIVMNLPSLTK-FEKDVKPGGKIFINSSLIE---KKVERTDIQAYYIDANKLAADIGNIKAANLVMLGAVLKANQIVDVESILEAFKKVFGP-SKEKFIPQNREALIKGGESI.... 178
323 2.000e-76JGI.Meta 7017302681 C3365162__gene_207930 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  44  1...MSSGLEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAYNRISREQIRVHSNIYTPDLVVVVDETLLHVDVTAGLKENGAIIINTAKSREEVLPLLGYRGSIYTVDGRKISVEALGKNFPNSPMLAAAVAVSGVMPKKEFISEMRASYQHKFKPEVIEGNMKALTMAYDAVEE.. 191
324 2.000e-76gi|499735263|ref|WP_011415997.1| pyruvate:ferredoxin oxidoreductase subunit gamma [Syntrophus aciditrophicus]  clstr ali  47  1......MIEVRWHGRGGQGAVTSVELLALAAIGEGRYAQGFPSFGPERRGAPVEAFNRINDTRIKKRQRIYRPDVVVVLDPGLISVNVSEGLKPEGLLIINTSKSLKEIEKHIQFKGRIALVDATAIAWKELKVPITNTTMLGALVKMTDVVKLESLNEPIEHRFG-----RIANRNLAAMKLAYDEV.... 178
325 2.000e-76gi|511308260|ref|WP_016359004.1| MULTISPECIES: pyruvate ferredoxin oxidoreductase gamma subunit PorC [Methanobrevibacter]  clstr ali  43  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYSQAFPSFGVERRGAPVSAFTRIDEKPIELRYQIYNPDHILVLDDGLANVDIYSGIKENSDVVINTHKDISSDKIP------VHKIDATKIALDVLGRPIVNTIILGYFAKKSGVVSIESLEKVIKDVFPGK----VGEKNVRAVREAYE...... 171
326 3.000e-76gi|524739263|emb|CDE41222.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Prevotella sp. CAG:279]  clstr ali  28  1...MK--HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVILSDEKISSP-ILNAFDIAVVLNQQSLDK-FESKVKPGGILIYD---NYGIHRAPTRKDIKVYNVAAMDATLEMKNSKTYNMIVLGALLKVCPMVTLESVIKGLKKSLPERH-HKLIPLNEEAIRKGMSLI.... 177
327 3.000e-76gi|288893523|gb|ADC65060.1| pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Ferroglobus placidus DSM 10642]  clstr ali  38  6.......IEVRFHGRGGQGAVTAADILAIAGFKQGYYTLSFPMFGAEKRGTPVVSFLRISDKPIVVRDEVRNPDYVVVMDPSLLDVDVLAGIKKGGMLIANYPKGSEELKEKLKEDVEIYTINATKMATEILGRPITNTAMVGAFVGATNVVKLEYVEEAIREFFEDK---DIAEKNVQLVRKAYEYMRE.. 187
328 3.000e-76gi|490491298|ref|WP_004357520.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella disiens]  clstr ali  26  3.......TEIIISGFGGQGVLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTANVTVIISDERISSP-ILSKYDVAIVLNQPSLEK-FEPKVKTGGILIYD---GFGIINPPTRSDIKTYRIDAMNKAAEMKNSKVFNMIVLGGLLKVCPIVSLDGLQKALYKTLPERH-HGMIPLNIEAVEIGKNIITETK 181
329 3.000e-76gi|524035033|emb|CCY15457.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Prevotella sp. CAG:755]  clstr ali  25  1...MKE--EIIISGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEPISSP-ILSRYDTAILLNQPSLEK-FEPKVRPGGTLIYDGYGIAD---PPTRADIEAWRIDAMDAAAELKMMKCFNMFVLGALLKLHPIVSVSNVMQALRKTLPERH-HDLLPLNEQAILKGMELVRRQ. 180
330 3.000e-76JGI.Meta 7033889227 C5459614__gene_233812 putative 2-oxoglutarate synthase subunit [Human Supragingival plaque microbiome from visit number  ali  26  4........EIIIAGFGGQGVLSMGKILAYSGIMQGQEVAWMPSYGPEMRGGTANVTVILSDSRISSP-VIQEFDTVIVLNQQSLDK-FESRVKPGGTLIFD---PNGISNPPKRKDIAIYSVKATDEATAMNNSKTFNMIVLGAFLKVKPIVDMDNVVKGLQKSLPERH-HNLIPMNEQAIRRGMEIVEK.. 179
331 3.000e-76gi|757124083|ref|WP_042678455.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Anaerosalibacter sp. ND1]  clstr ali  25  1......MEEIVVAGFGGQGVMAIGQLLTYAGMIEDKHVSWLPSYGPEMRGGTANCNVIVSDDAIGAP-VIEEASAAIVMNKPSLDK-FENNIVKDGKLFINSSLIE---QKAEREDIDVYYIPANEIANELGNDKVANMVILGAYLEATKLVKQESVLEAFTKVFGE-NKAHLLPLNKEAIEKGAEAAKSQE 181
332 3.000e-76gi|524283643|emb|CDA44449.1| putative uncharacterized protein [Prevotella sp. CAG:5226]  clstr ali  25  1...MKQ--EIIISGFGGQGVLSMGKILAYAALMEGKEVTWMPAYGPEQRGGTANVTVIISDEPISSP-ILSTYDTAILLNQPSLDK-FQPKVKKGGTLIYDS---FGIIEKPSRTDITSWHIPAMESAAEMSMMKCFNMFILGGFLKVHPIVSIESVMKALRKTLPERH-HNLLPMNEQAILKGRDII.... 177
333 4.000e-76gi|517797942|ref|WP_018968150.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella loescheii]  clstr ali  26  1...MK--HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDQRISSP-VLSKYDVAIVLNQPSLDK-FEPRVKPGGILIYDGNGIAS---PPSRTDIKVYRMDAMDKAAEMKNAKVFNMIVLGGLLKVCPVVSTEGLNKALFKTLPERY-HNLIPLNMEAVEQG........ 173
334 4.000e-76gi|651641605|ref|WP_026627417.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Dysgonomonas capnocytophagoides]  clstr ali  26  4........EIIIAGFGGQGVLSMGKILAYSGLMEGKEVSWFPSYGPEQRGGTSNVTVILSDDVISSP-IVSEYDIAIILNQPSLEK-FESQVKPGGIILYD---PDGIHRPPTRTDISVYKVDAMGKASEMQNQKAFNMIVLGGLLKINPVVDLEHVMMGLKKTLPARH-HGLLPMNEKAILQGMEIVEK.. 179
335 4.000e-76gi|851217435|ref|WP_048112333.1| pyruvate synthase [Candidatus Methanoplasma termitum]  clstr ali  46  3.......TEICWHGRGGQGVVTANEILAETAIHAGKYVKAFPEFGPERMGAPIRAFARISGNPIRVHTQVYEPDIVIVIDPSLIGKDVGKGLKENGTIIANYRGSSFELQDAIGTNAECHAVDATKISVEEIGRPMVNTSMLGALVKIRPIIEYKEIEDHMKAKFEGKLKEKVILQNVAALKRAYEEVK... 185
336 4.000e-76 GL0109236 [Complete] locus=scaffold92833_2:9352:9876:+  ali  39  1......MIEIRFHGRGGQGSVTAAEILAKAAFKDGKYVQSFPFFGVERRGAPVMAFTRIDDKPIDIRYQVYNPDYVLVLDDGLMNVDVFSGIKENTEVIIN---IAEEFKGSGEHP--VHSIDATGIALDLLGRNIVNTIILGYFAKKTNVVSIESLIEVIKETFPGK----VGELNAEATKKAYD...... 172
337 5.000e-76gi|644488350|ref|WP_025323797.1| hypothetical protein [Deferrisoma camini]  clstr ali  41  1......MVEIRFHGRGGQGAVVASNILAAACFLEGRYVQAFPAFGVERRGAPVEAYIRIDHQKIHLRTNVYTPDHVVVLDPTLIEVDVTRGLKPGATLLLNTDKSPDA--FPRFASFRVATVDASRIALRHGSRPIVNTAILGAFARATGLVSVDAVCEAIREEVPSHH-----EANIAAAREAYDSV.... 180
338 5.000e-76gi|500835983|ref|WP_012003788.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Pseudothermotoga lettingae]  clstr ali  28  2......MHSIIFAGFGGQGVMLMGQVLAQAAMNEGKHTTWFPSYGPEMRGGTANCTVVVSDEPVASP-VVDTPLEVVAMNIPSLLK-FEPKLKKDGYLFINTSVID---RKPQRNDVKVIEIPANDIAEKLGNVKVANMVVLGAFVYTTKCTEVDSLIEAMKYKLSAKNS-EIIELNVKAIFEGVKHV.... 177
339 5.000e-76gi|931545286|gb|KPL20629.1| pyruvate ferredoxin oxidoreductase [Anaerolineae bacterium SM23_84]  clstr ali  39  1......MIEVRIHGRGGQGAVIASKVLADAVFREGRYVQSFPAFGVERRGAPVAAFTRIDDEPVRLRSQIYTPDHVMVLDPSLMQVDVTAGLREGGWVLINSDQPPAAFPLPSQF--RVATVDANEIAIKHLGPPIVNTAILGAFARITGIVSLETVEQAVREAVPTKP-----EDNVAATREAYHAVQPA. 183
340 6.000e-76gi|998156285|gb|AMK13498.1| pyruvate:ferredoxin oxidoreductase gamma subunit PorC [methanogenic archaeon mixed culture ISO4-G1]  clstr ali  41  3.......IEICWHGRGGQGVVTANEILAETAILAGKYVKAFPEFGPERMGAPIRAFTRISENPIRIHSQVYEPDIVVIMDGSLVGKDVTRGAKKDTIIVANYAGSPKELQDALMTDIECHTLDAQRVAIEEIGKPMVNTVMLGALIKCSPLVGYDHLEDQITTKFTGKLPDKVILKNLSALKRGYQEVQ... 185
341 6.000e-76 GL0277644 unmapped_[Complete]_[mRNA]_locus=scaffold708510_1:723:1265:-  ali  30  1......MIEVICSGFGGQGVLVAGMILADAGMEDNKQVSWYPSYGFEMRGGAANCDVKISDEEIPSPFCL-EPDIVYTLNETAIDT-YESRLKPGGVLLVNSSLVPDE--RTYRDDIQVIKVPATTIADELGNPKGTNIVMLGALACASDLYDEAAMRHAVEHYFGKK--GKVNPKNAQCFDRGADEARKQ. 179
342 6.000e-76gi|549645823|ref|WP_022545693.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Bacteroidales bacterium CF]  clstr ali  25  1...MKE--EIIIAGFGGQGVLSMGKILAYSGIMQGQQVTWMPSYGPEMRGGTANVTVILSDSKISSP-LLSKFDTAIILNQQSMDK-FENSVKPGGILIYD---PNGITRQPVRKDIKIYSIDAVDISNELGNSKAYNMVVLGAFLSKKSIVSMENVIKGLKKSIPERH-HHLIPMNEQAIRVGMEKIQE.. 179
343 6.000e-76gi|304378107|gb|ADM27946.1| pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Ignisphaera aggregans DSM 17230]  clstr ali  44  1..MSLKRIEIRWHGRGGQGAITASMILAEGAIYQGKYAQAYPEFGAERRGTPTRAYTRISDEPIYSRAPIIHPDVVVVLDPTLDKSLYMGGLKSNGILVMNTKRSAKEVRDIIREDIRIVRVDATRIALEILKTPIVNMAMIGALLKSVPVVDMHYVEEAIKENF----RPKVAEANILAMKRAFEEAEI.. 185
344 6.000e-76 GL0012835 [Complete] locus=scaffold64011_2:991:1545:-  ali  30  2.....KTERIIFAGFGGQGVMSMGQMLAYAGMIENKHVTWCPSYGPEMRGGTANCSVVVSDELVGSPLISHDATAAVIMNLPSLTK-FEKDILPGGVLLINSSLIE---KKSERDDIKVAYVEANKIAGDLGNSRAANMVMLGALLSLDNIVSFESIQQAFIKVFGER-KKEFLPGNEKALNAGAESVK... 180
345 7.000e-76JGI.Meta 7022066744 C3690145__gene_144657 ketoisovalerate ferredoxin oxidoreductase [Human Stool microbiome from visit number 1 of subject 1  ali  25  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMDDKEVTWMPSYGPEQRGGTANVTVILSDDKISSP-ILDTYDTAVILNQQSLDK-FESKVKPGGVLIYDSYGI---HKAPTREDITIYKVDAMEATFDMKNSKSYNMIVLGALLKVRPIVTLESVMNGLKKTIPERH-HHLMPLNEEALQKGMSLI.... 177
346 7.000e-76gi|505138698|ref|WP_015325800.1| 2-oxoacid:acceptor oxidoreductase subunit gamma [Halobacteroides halobius]  clstr ali  47  1...MASLTEIRWHGRGGQGAKTASILLGKVAAKTGKHIQAFPEYGPERMGAPVLAYNRISEDDITVHCQVTDPGIVTVLDPTLLNVDVTDGVPEDGTLVVNSEEDVATIKEQLEFDGDIWVLDAYGVANKEIGRPFPNTPMLGALMQATDLLPFENFVKQIKVELEKKHKPEMIDKNVAAIKRAYKEV.... 188
347 7.000e-76gi|647556686|ref|WP_025837762.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas cangingivalis]  clstr ali  25  1...MKK-YEIVIAGFGGQGVLSMGKILAYSGLMGNKEVSWMPSYGPEQRGGTANVTVIISDEKISSP-ILNSYDIAIVLNQPSLDK-FISKVKPGGMLIYDGYGIHTE---PKRDDIKLYKIDAMDASLEMNNTQVFNMIVLGGLLKLAPMVDIEHVLLGLKKSLPERH-HKLIPLNEAAILKGMEIIREKE 182
348 7.000e-76gi|740434692|ref|WP_038266870.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [[Clostridium] litorale]  clstr ali  24  6.........IISAGFGGQGVMSLGMLITYAGMLEKKEVSWLPSYGPEMRGGTANCSVIVSDQPVGSPIITNDATTAVIMNLPSL-VKFEKDVAPGGKIFINSSLIS---QKVERDDVEVYYVPCNDIAIELGNPKVANMVMLGAYLEVTGIVATDSILEAFKKVFGP-SKEKFIPLNTEAIKKGQEAIKVA. 182
349 7.000e-76gi|998177195|gb|KXH76629.1| hypothetical protein AM326_02460 [Candidatus Thorarchaeota archaeon SMTZ-45]  clstr ali  48  1......MTEFRWHGRGGQGVVTSNQMLGKAALAEGNYIQAFPEFGPERTGAPVRAFLRISKKPIQVYAQVYNPDVVVCIDPTLLDVNPSEGLKEDGTLVLNTTLSPDEVRSKYGFKGKVVTVDATSIAMEILGRPFYNMPTMAAAVKASGVVKIETVIEEVQE----RYPGKVGDLNKAAMERAIEEAKI.. 182
350 7.000e-76gi|653038368|ref|WP_027290054.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Rikenella microfusus]  clstr ali  25  1...MKE--EIIIAGFGGQGVLSMGKILAYSGVMQGQEVSWIPSYGPEMRGGTANVTVILSDRKISSP-VVQEFDTGIVLNQQSLDK-FEDSIKPGGTLLYD---PNGITHPPHRTDLDVYTIDAAVEAARSGNAKVFNMFVLGAFLKIKPLVTVENVIEGLRHSLPERA-HKMIPANEEALRKGMELVKKAE 181
351 8.000e-76 GL0101855 [Complete] locus=scaffold5334_2:7723:8262:+  ali  25  1...MKQ--EIIISGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEKISSP-ILSKYDTAIVLNQPSLDK-FQPKVKVGGDIIYDS---FGILDKPTREDIEAYHIPAMETAAEMKMMKCFNMFVLGGLLKIHPIVSLESVMKALKKTLPERH-HDLLPLNEQAILKGMEII.... 177
352 8.000e-76gi|502720366|ref|WP_012955350.1| pyruvate ferredoxin oxidoreductase gamma subunit PorC [Methanobrevibacter ruminantium]  clstr ali  41  1......MIEIRFHGRGGQGAVTAAEILAKAAFKDGKYSQAFPFFGVERRGAPVMAFTRIDTEPINLRYQVYNPDHVIVLDDGLLNVDVYSGLKENGEVIINTH------EKVESESHKVFDVDATGIALEILGVNIVNTIILGYFAKKTGEVSINSLIEVIKETFPG----PIGEKNAVAAQKAYDMA.... 173
353 8.000e-76gi|524317331|emb|CDA77574.1| putative uncharacterized protein [Bacteroides sp. CAG:530]  clstr ali  25  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDTRISSP-ILSKYDTAIILNQPSLAK-FEDKVKPGGVLIYDGYGIIE---PPTRKDIHVYRIDAMDEANERKMAKTFNMIVLGGLLKIRPIVSIESVVKALRKTLPERH-HNLIPMNEEAIRIGMDIIKK.. 179
354 8.000e-76gi|524581780|emb|CDD06330.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase gamma subunit [Prevotella sp. CAG:592]  clstr ali  25  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERISSP-VLSKFDIAIVLNQPSLDK-FESRVKPGGILIY---EGNGIISPPTRTDIDIYRIDAMDKAAELKNTKVFNMIVLGGMLKVSPVVSENGVEKALFKTLPERH-HKLIPLNMEAIKIGGDIMQKQ. 180
355 9.000e-76gi|651337688|ref|WP_026460680.1| 2-oxoacid:acceptor oxidoreductase [Actinomyces suimastitidis]  clstr ali  37  1......MVEVRIHGRGGQGVVTASDLLAMAAFTDGHHAQAFPSFGSERTGAPVVSFCRITDTEIRTREPVLEPDVVVVQDPTLLPVDVFAGLKANGYALVNSTKSLDELGQQAHPHGHVLTLPAFDIARKHLGRPVPNVVMLGGVAALTGLIRLDSMAEAIRRRFPGR----LGEANVAAATEAFDTINTQ. 186
356 9.000e-76gi|545418115|ref|WP_021657033.1| 2-oxoacid:acceptor oxidoreductase subunit gamma [Clostridiales bacterium oral taxon 876]  clstr ali  28  5........EILFAGFGGQGILSMGKFLAYAGMDAGLNVSWLPSYGPEMRGGTANCSVILAEDPVGSP-IVNEATTLVVMNRPSLDK-FEDAIKPNGLLIVDSDLVN---RLPERNDVEVISIPAQSIAEEIGSKTIANMVLLGALVAKTGIVSMEDLLKALKE----HGKEKFYEANKKALEKGAEYA.... 175
357 1.000e-75JGI.Meta 7039910113 SRS016989_Baylor_scaffold_912__gene_1810 ketoisovalerate oxidoreductase subunit vorA [Human Stool microbiome from visit  ali  26  1...MKQ--EIIIAGFGGQGVLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTANVTVIVSDERISSP-ILSQYDTAIILNQPSLAK-FENKVKPGGILIYDGYGIIE---PPTRKDIQIYRIDAMDAANERGIAKTFNMIVLGGLLKLRPVVAIESVLKALRKTLPERH-HHLIPVNEEAIHIGMEIIK... 178
358 1.000e-75gi|851348496|ref|WP_048191397.1| pyruvate ferredoxin oxidoreductase [Methanobacterium sp. SMA-27]  clstr ali  45  1......MIEVRFHGRGGQGAVTAAEILAKAAFEDGKYCQAFPFFGVERRGAPVMAFTRIDDQPIRRRYQVYNPDYVVVLDDGLLEVDVFSGLKDGGKIIINTNNGVETIN-----GAEIHKVDATGIALDILGVPIVNTILLGAFAGVTGAVSIESIIKIIKETFSG----EIGEKNAKAAKLAYDAAKE.. 176
359 1.000e-75gi|494007467|ref|WP_006949929.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella marshii]  clstr ali  27  1...MKK--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDDRISSP-ILSSYDVAIVLNQPSLDK-FESKVKTGGILIYD---GFGMLHPPTRTDIEVYRIDAMDKVAEMKNSKVFNMVVLGGFLRVCPIVTESGLEKALRKTLPERH-HRLIPLNMTAVEAGKTLIQREE 181
360 1.000e-75gi|917415499|ref|WP_052022211.1| 2-oxoacid:acceptor oxidoreductase [Actinotalea ferrariae]  clstr ali  39  1......MFRVRIHGRGGQGVVTAAELLSEAAFRQGRYAQAFPFFGSERTGAPVVSFCRIADEPIRAHDPVTTPDAVIVQDVTLLHVDVLAGLRPDGYVLLDSPRRPADLGLPPPDRTTVVPLPATAIARHHLGRPLPNTPLLGAFAAVTGLVSLDAVVAALLERFPG----AVGQRNAEAARAAY....... 179
361 1.000e-75gi|921067626|gb|KON28342.1| hypothetical protein AC480_04050 [miscellaneous Crenarchaeota group archaeon SMTZ1-55]  clstr ali  46  1......MMEIRFHGRGGQGAWTASILLARSALREGKHVQSFPEFTPERMGAPVRAYTRISDVPIDVHSGIYEPDVVVVLDPTLVKVNVLDGLAADGVLVVNERGTPSQVRTANEIVGRVWTVPATDLSVELIGRNIPNTAMLGATVKATGVVQLESLMAAVRERFTGK----VGDVNVSLIKRAYDEVTK.. 182
362 1.000e-75gi|736668490|ref|WP_034675171.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Bacillus niacini]  clstr ali  26  4........EIIIAGFGGQGVMSMGQLIAYAGMLEGKGVSWLPSYGPEQRGGTANCSVVVSDEPVGSP-LVTSPSTAIVLNNPSFEK-FEHRVRPGGLLISNSSLVT---RASKRCDIEIIEITATDMASDLGNTRVANMILLGAYLGFTKVVTCDSIIESLKKVLPE-EKHHLIEVNKQALNKGASMI.... 177
363 1.000e-75gi|740775545|ref|WP_038560829.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Draconibacterium orientale]  clstr ali  24  4........EMIIAGFGGQGVLSMGKILAYSGIMEDKEVTWFPSYGPEMRGGTANVTVIVSDTRISSP-ILQQFDTAIILNQQSMDK-FEKAVKPGGTLLYD---PNGVIHPPTRTDINIFKVEATKTAVEMGNPKVFNMIVFGSYLKVRPILSLDNVEKGLEKSLPERY-HKLIPLNLEAIKKGQEIVEDVQ 181
364 1.000e-75 GL0122822 [Complete] locus=scaffold2599_6:19897:20448:-  ali  27  1...MKK--EIIAAGFGGQGVLSMGKILAYAGLMDDLEVTWMPSYGPEQRGGTANVTVVLSDTPISSP-VLDAFDTAVILNQQSLDK-FESKVKPGGVLIYD---PYGIHRKPTREDITIVPVEAMEAAIEMKNAKTYNMIILGALLKVNPVVDIESVMKGLKKALPERH-HHLLPLNREAILRGMELVKTA. 180
365 1.000e-75gi|524098944|emb|CCY74669.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Brachyspira sp. CAG:700]  clstr ali  29  2.....KTERIIFAGFGGQGVMSMGQMLAYAGMIENKHVTWCPSYGPEMRGGTANCSVVVSDELVGSPLISHDATAAVIMNLPSFTK-FEKDILPGGVLLINSSLIE---KKSERDDIKVAYVEANKIAGDLGNSRAANMVMLGALLSLDNIVSFESIQQAFIKVFGER-KKEFLPGNEKALNAGAESVK... 180
366 1.000e-75JGI.Meta 7018926684 SRS022609_Baylor_scaffold_86040__gene_153426 hypothetical protein [Human Stool microbiome from visit number 2 of subject  ali  26  1...MKE--EILIAGFGGQGVLSMGKILAYAGLMSGLEVTWMPSYGPEQRGGTANVTVIVSDSPISSP-VLDSYDTAVLLNQQSLDK-FENKVKPGGTLIYD---PSSIHRLPARTDIAIVAIDAMTAAIEMNNAKTYNMILLGALLKRRPIVSVDAVIKGLKKTLPERH-HHLIPLNEEAINRGMSLV.... 177
367 1.000e-75gi|944180186|ref|WP_055668813.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Clostridiaceae bacterium mt10]  clstr ali  27  5........EIIFAGFGGQGILSMGKFLAYAGMDANMNVSWLPSYGPEMRGGTANCSVILTDDQVGSP-IVTAPDTVVVMNRPSLDK-FEKGIKANGLLILDSDLVT---REPERTDLEVIKIPAQTVATELGNKTIANMVLLGALVAKTNIVSMDVLLEALR----AHGKEKFFEINKKALEKGAEYVR... 176
368 1.000e-75gi|919586923|ref|WP_052884684.1| hypothetical protein [Thermofilum sp. 1807-2]  clstr ali  39  18.KMKEEIYEVRWHGRGGQGVVTSSELLALAALREGKHVYHAPEFGPERRGAPVRAYTRISTHPIELHSSIYTPDAVVVIDPSLQSQSVTHGLREGGLLVVNASTPHEIVEAAKKLKAGLWFVDAYSIAMEVFGRPFYNTPMLGAFVKASGLVSINTVLDVVAERFGK--ESKLAESNVQAVRKAYETVR... 206
369 1.000e-75gi|651364146|ref|WP_026476492.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Alkaliphilus transvaalensis]  clstr ali  26  1......MTEVILAGFGGQGVMSMGQLLTYAGMIENKQVSWLPSYGPEMRGGTANCAVIVSKSPVGSPIITTDATAALVLNLPSLLK-FEDSIVANGNLLINSSLIEE---KAKRSDLNAYYIPANDIANEIGNSRVANMVMLGAYLELTKVVSVDSVIEALKKVFGP-DKQHLVPLNKEALDRGAAAVK... 179
370 1.000e-75gi|851162260|ref|WP_048092258.1| pyruvate ferredoxin oxidoreductase [Geoglobus acetivorans]  clstr ali  38  1...MDILKEVRFHGRGGQGAVTAADILAVAGFKDGYYTLSFPMFGAEKRGTPVVSFLRISDEPIVIRDEVKNPDFVVVMDPSLVDVDVLAGIKDGGIAIINYPKGSEDLKQKLDTDVEIHAINATKMAMEILGRPITNTAMVGAFVGATGIVKIESVEETIMEWFGNK---DIAEKNVRLVREAYDHMKE.. 185
371 1.000e-75gi|547372807|ref|WP_022063532.1| 2-oxoglutarate ferredoxin oxidoreductase gamma subunit [Alistipes inops]  clstr ali  25  1...MKE--ELIIAGFGGQGVLSTGKILAYSGVMQDYEVSWLPSYGPEMRGGTANVTVIISDKPISSPT-LQTFDTAIILNQQSMDK-FESQVKPGGVLIYDTNGIT---RHPQRKDIKIYVIDATEEAAKRGNSRIFNTLILGGYLKVRPIVTLENVYKGLKKSLPERAWKSL-PMNEEAIRIGMDIIKEIQ 181
372 1.000e-75gi|769967337|ref|WP_045089081.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Fermentimonas caenicola]  clstr ali  26  4........EIVIAGFGGQGVLSMGKILAYSGIMEGKEVSWFPAYGPEQRGGTANVTVIISDEPISSP-VVNNYDVAIVLNQPSLDK-FQDKVKPGGILIYDGYGIN---NKVQRTDINIYRINAMDESVKMENSKVFNMIILGGLLKISSMLKIENVMKGLKETLPERH-HYLLPINEKAIIRGMEVVE... 178
373 2.000e-75gi|973101252|gb|KUK59539.1| Pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Synergistales bacterium 53_16]  clstr ali  50  1...MSKVIEIRWHGRGGQGAKTGSSILSEVLFESGKFAQAFPEYGAERQGAPMKAYNRISETPIRVRSGVLNPDVVIVIDPTLLDANPTEGGKDDTVYIINTTKKPEAIKKQLGDSARVMTVDATSITLEEFGQNRPNTPMLGVVARLFEDVSVDAFIEHFRNKMGPKLPEKVLEANLNAIRRGYEEVQE.. 190
374 2.000e-75JGI.Meta 7036419810 C2166001__gene_246668 putative 2-oxoglutarate synthase subunit [Human Stool microbiome from visit number 2 of subject 76  ali  23  17........EIIIAGFGGQGVLSMGKILAYSGIMQDQEVAWMPSYGPEMRGGTANVTVILSDERISSP-ILTKYDTAIVLNQQSMDK-FESMVKPGGTLIYDPNGITHE---PTRKDINIYKIEGTAIAAEQGNPKVFNMIVLGGFLKVKPIVKLDNVEKGLQKSLPPRH-HKMIPMNIEAIQTGMKSVEV.. 192
375 2.000e-75gi|808568053|emb|CEP66178.1| Pyruvate-flavodoxin oxidoreductase, central domain [Moorella glycerini]  clstr ali  25  2......THEVVIAGFGGQGVMLIGEILAYAGMLEGKNVSWMPSYGPEMRGGTANCSVVVSDQEVGSP-VVAEPTGIIAMNGPSLDK-FEGSVRPGGLIVANLSLIN---RKVKREDVKVIEVPANDVAVELGNFRVANMVALGALLGATRCVSKASVLEALRHMLSG-HRQDLIPLNEKALNRGIEIA.... 177
376 2.000e-75gi|501054718|ref|WP_012106215.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanoregula boonei]  clstr ali  39  1......MRELRIHGRGGQGSVTAAELIAVAAFEGGVFSQAFPAFGVERRGAPVQAFVRFDDRKIRLRSQVYEPDYIIVQDSTLIDVNVFSGVKKGGIVIVNTEKAPD---YQVPEGVKLITIDATSIALKVIGLPITNTSLMGAFAAATGEIKFDALRNALYHRFPK----ELAEKNIEAARQAFEHVKGA. 179
377 2.000e-75gi|514045793|emb|CCX48503.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Bacteroides sp. CAG:927]  clstr ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMDNLEITWMPSYGPEQRGGTANVTVILSDAKISSP-VLDTYDTAVILNQQSLDK-FESKVKPRGTLIYDSYGI---HRMPQRTDINVYRVDAMDATFEMKNAKTYNMIVLGALLKIRPIVSVDSVMAGLKKALPERH-HHLLPLNREAINRGMDLVK... 178
378 2.000e-75gi|917031285|ref|WP_051637997.1| pyruvate synthase [Lachnospiraceae bacterium AC2014]  clstr ali  43  1...MSKDLEIRWHGRGGQGAKTAALLLADVAFSTGAHVQGFPEYGPERMGAPITAYNRISRKPIRVHSNIYDPDLVMVVDETLLEVNVTAGLKQEGAIVINTPKSVEEVRPLLGYEGNVYTIDARKISVDALGKYFPNSPMLAAAVAVSGVMDQKDFIEQMRGSYKHKFKPEVIDGNMRALTLTLDAI.... 189
379 2.000e-75gi|931524853|gb|KPL02127.1| pyruvate ferredoxin oxidoreductase [candidate division Zixibacteria bacterium SM1_73]  clstr ali  40  3.......KEIRIHGRGGQGVVTAAELFAQAAFEDGKYAQAFPSFGSERMGAPVQSFVRIADHKVTSRSQIYEPDYLIIQDNTLIGIDVLSGLKPDGMVLVDTEMSPEELGLKTTAEVR--TIPATKIALEIIGRAVQNTTLMGAFSGITGLISVEAIIKSVKE----RFLGEVGEKNALAIKKAYEIMRGGK 182
380 2.000e-75gi|546379562|ref|WP_021853315.1| keto/oxoacid ferredoxin oxidoreductase subunit gamma [Prevotella sp. 109]  clstr ali  26  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTCNVTVIVSDERVSSP-IVSEYDVAIVLNQPSLDK-FEPKVKKGGFLIYDTSGI---INPPKRTDITVCPIAAMDKAVEMKNSKVFNMIVLGGLLKVCPVVSDKGVEKALYKTLPERH-HGLIPLNMEAITAGKEII.... 177
381 3.000e-75gi|502828835|ref|WP_013063811.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella]  clstr ali  27  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERISSP-ILSKYDIAVVLNQPSLEK-FEPKIKPGGILIYD---GFGIINKPTRKDITVYEINAMDKAAEMKNGKVFNMIVLGGLLKVAPVVSDKGVEKALYKTLPERH-HGLIPLNMEALKEGAKIIQEIK 181
382 3.000e-75gi|1009017718|gb|KYK98417.1| hypothetical protein A2V21_205790 [Deltaproteobacteria bacterium GWC2_55_46]  clstr ali  44  1...MENYIEVRWHGRAQQGVVTAAKVLGEACLRSGKFVQAFPEFGPERMGAPVRAYNRISSEPIRLHCQVTEPRYVLIADPTLIGMDVTDGTPENAVFIVNTHRSPEEMRKALGLDVKVFTLDAGKISLETIGRLMPNTPLLGALAKATGFVTLDALVDNFREGYSKKYSPKVIEGNVEAMNRGYGELR... 200
383 3.000e-75gi|818539512|gb|KKR91478.1| Pyruvate/ketoisovalerate oxidoreductase common subunit gamma [Candidatus Falkowbacteria bacterium GW2011_GWA2_41_14]  clstr ali  39  1......MIEIRIHGRGGQGVVTAAELIATAAFKGGREAQAFPSFGAERTGAPVESFARIDDQPIITRQQIYRPDILIIQDPTLLETPVAKGVDKKTIIIINTAKTKAELKINFPLN-NIHTIDATKIALEIIGKNIVNTVILGSFAKATGLISLKSLTEAIEEKFAGHN--ELIAKNIRAIERAYKI..... 179
384 3.000e-75gi|504626178|ref|WP_014813280.1| 2-oxoacid:acceptor oxidoreductase subunit gamma [Desulfomonile tiedjei]  clstr ali  43  1......MIEMRFHGRGGQGAVTCAELVAQAAIDTGRYATAFPSFGPERRGAPVIAFARVDEQPIRLRSKIYAPDVVVVLDPSLLDISPAVGLRDNGILIVNSPYDPETLKKHLGYQNRIAVVDAGRIAREVLGLPITNTTMVGALVKGTGIMDVESLKAPFRKRFG-----KIADRNIQAMERAFNET.... 178
385 3.000e-75gi|889542311|ref|WP_048828277.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Bacillus sp. B-jedd]  clstr ali  27  4........EIIIAGFGGQGVMSMGQLIAYAGLHEGKNVSWLPSYGPEQRGGTANCAVVVSDEPIGSP-LVSAPSAAIVLNIPSFEK-FEPKVRAGGLLLTNSSLIG---KKSQRTDLTAIEINATAMANELGNGKVANMILLGAFIKATGILSPESVLSSLQQVLSP-DKHYLLEMNRLALNKGAEIV.... 177
386 3.000e-75gi|931511360|gb|KPK89524.1| pyruvate synthase [Deltaproteobacteria bacterium SM23_61]  clstr ali  44  2......MIEVRFHGRGGQGAVTSVELLALAAIEEGKFAQGFPSFGPERRGAPVIAFSRVNDHHIRLRSKIYTPDVAVVLDPSLLKVDPSQGLKAGGLIIINTNKTLDQVRTEFGYQCRLALVDADRIAREELGVPIVNTTMLGALIRGTGIVALDSLIPPLKGRFG-----RGAERNLKALRRAYEET.... 179
387 3.000e-75gi|751614369|ref|WP_041082301.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Thermotoga profunda]  clstr ali  28  5.........IIFAGFGGQGVMLMGQVLAQAGMNENKYVTWFPSYGPEMRGGTANCTVVVSEEPVASP-VVEMPTEVVAMNIPSLLK-FESKVKKNGCLFINISVVD---RKPQRSDIEVYEVPANDIAERLGNLKVANMVMLGSFVQVTKCVSIDSLIEAVKYKLSLRNS-EIIELNIKAIFEGAKHV.... 177
388 3.000e-75gi|914766792|ref|WP_050709785.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Dysgonomonas sp. HGC4]  clstr ali  26  4........EIIIAGFGGQGVLSMGKILAYSGLMEGKEVSWFPSYGPEQRGGTANVTVILSDNTISSP-IVSEYDIAIILNQPSLDK-FESQVKPGGILLYD---PEGIPRAPKRTDILVYKIEAMATASELKNQKAFNMFVLGGLLKVCPIVTLEHVMMGLKKSLPERH-HGMLPMNEQAILKGMEIVEE.. 179
389 3.000e-75gi|985676079|gb|KXB06335.1| pyruvate ferredoxin oxidoreductase [candidate divison MSBL1 archaeon SCGC-AAA382A20]  clstr ali  39  1......MKQIRIHGRGGQGTVTMASLLARAAFETGKWSQGFPSFGVERLGAPVEAFTKIDDKEITDRSQIYEPDYVIVQDASLIRVDVLKGLKEDGMILVNSSANPEEIDLE--TDRKIMTIDATNIALEHLGKPIMNTALAGAFAGITGLINKDSLNKVVREEFPG----EVGEKNVAAINDAYERVK... 178
390 3.000e-75gi|10639793|emb|CAC11765.1| probable pyruvate ferredoxin oxidoreductase, gamma subunit [Thermoplasma acidophilum]  clstr ali  40  8.....EMYEIRFHGRGGQGAVTASRILAAAAFAEGKYVVSFPFFGTERRGAPVTAFTRIDDSEIYLKSQIYNPDIVVVLDTYVLRTNVMEGLKENGTVIINSPRDPADFNL----DANVATVDAVAIAVKHGLNPVINTSMLGAFSRVTGIVSLESVLEATRQNVPAKVKE-----NMDAVKEAYDSVKILK 190
391 4.000e-75gi|524454314|emb|CDB95922.1| pyruvate/ketoisovalerate oxidoreductase catalytic domain [Firmicutes bacterium CAG:41]  clstr ali  27  5........EMILAGFGGQGILFTGKILAFAAMLKDKKLSWLPSYGPEMRGGTANCHVIIDDEPIGSP-IVTRPNILVAMNKPSLDK-FENTVSDGGYVFINTSLID---RKSEREDVNEICVNATETAHNMGNKSLANMVMLGAVLKKTELFTIDEIEYTMKKSLPE-NKHKLIEMNIKAVKEGYNLV.... 178
392 4.000e-75gi|1015559422|gb|KYZ77172.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Anaerosporomusa subterraneum]  clstr ali  29  2......THEIIIAGFGGQGVMVMGQLLTYAGMIEGKNVSWIPSYGPEMRGGTANCSVIISDEPIGAP-IVSESTAVVAMNLPSLEK-FEPTIKPEGILLINSSLIEHDTQ---RSDIKVYKLAVNDIANELGNTKVANMVALGAIVAATKAVSPASVLKAFDKMFAKR--PELLEINRLALSAGAEKI.... 176
393 4.000e-75gi|502607998|ref|WP_012845066.1| pyruvate oxidoreductase subunit gamma [Rhodothermus marinus]  clstr ali  48  1......MLEIRWHGRGGQGAITVSKILALAALRSGKYAQAFPEYGPERSGAPVRAYNRLDDRPIVLHSGVYTPHRVAVLDETLLEEDVCEGLAPDGVLVINTTRPPEAIREQTGYPGRIVCVDAAAIAEETGSR-FANVPLLGALASTLEFIQLPTLEGALQAFLGKR-RPEVVEANLEALRRGYRETVALE 185
394 4.000e-75gi|496509701|ref|WP_009217984.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Bacteroidetes oral taxon 274]  clstr ali  26  1...MKK--EIIIAGFGGQGVLSMGKILAYSGLLEGKEVTWMPAYGPEQRGGTANVTVQISDKKISSP-ILKFYDIAIVLNQPSMDK-FEERVKPGGILIYDSN---GMTRKPNRKDISVYRIDATDKALEMGAQKTFNMIVVGGLLKADPMVKTENVMLALKKSLPERH-HKLLPANEEAMKVGMQIIEKE. 180
395 4.000e-75gi|740866844|ref|WP_038652095.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Mucinivorans hirudinis]  clstr ali  23  1...MKE--EIIIAGFGGQGVLSMGKILAYAGVMHNQEVSWYPSYGPEMRGGTANVTVILSERKISSP-VIHEFDTAIILNQQSLDK-FEEMIKSGGVLLYD---PNGITHPPKRKDIIVYTIDATAQAAEMGNVKVFNMIVLGAYLKIKPVVTIDNVIEALRKSLPERA-HKLIPDNERAIVRGMELV.... 177
396 4.000e-75 GDAKSKM01EN1P9|GDAKSKM01EN1P9|metagene|gene_1  ali  41  1...MKDLIEIRWHGRGGQGAKTAALLLADVAFNNGLYVQGFPEYGPERMGAPITAYNRLSRNPIRVHSNIYEPDYVVVVDESLIEVDVTAGTKEGGAIIINSHKSSNELKPLLGYHGHIYTIDARKISIETLGKYYPNSPMLAAVVKITGVMEEKAFLEDMRKSYAHKFASK.................... 173
397 4.000e-75JGI.Meta 7030216153 C7194894__gene_350911 2-oxoglutarate oxidoreductase [Human Supragingival plaque microbiome from visit number 2 of subjec  ali  26  1...MKK--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDDHISSP-ILSSYDVAIVLNQPSLDK-FESKVKTGGILIYD---GFGMLHPPTRTDIEVYRIDAMDKVAKMKNSKVFNMVVLGGFLKVCPIVTESGLEKALRKTLPERH-HRLIPLNMTAVEAGKTLIQREE 181
398 4.000e-75gi|492782633|ref|WP_005962661.1| pyruvic-ferredoxin oxidoreductase gamma subunit [Actinomyces cardiffensis]  clstr ali  41  1......MVEVRIHGRGGQGVVTASDLLAMAAFTDGHHAQAFPSFGSERTGAPVVAFCRIAETEIRTREPVLEPDVVVVQDPTLLSVDVFAGLKPEGYALLNSTKSFEELGLSELVKGHAITLPAFDLAREHVGRPVPNAVMLGGIAALTGLIRLQSVTDAIRHRFPGK----VGDANVSAATAAYDLV.... 183
399 4.000e-75gi|974237721|gb|KUO77309.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Clostridia bacterium BRH_c25]  clstr ali  32  2......THEIIMAGFGGQGVMAMGKILVEAALKEGKNVSWLPSYGPEMRGGTANCNVIISEEPVGAP-IVTEATAAIVMNRPSLDK-FENDVIPGGILLINSSLID---QKTSRDDINVYYVPANDIANELGAGKIANMVMLGAYLALTGATKEDTIMDIITEIFSGK-KASVIPLNKEALIRGAACVK... 178
400 5.000e-75 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and rela  ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYAAMLEGKEVSWMPSYGPEQRGGTANVTVIISDERISSP-ILSKYDTAVILNQPSLDK-FESQIKPGGTLIYDGYGITI---PPSRKDIRIYRIDAMDAAAELKLGPAYNMVVLGGLLKARPIIQTEHVTNALRKTLPARH-QHLIPVNEKALLKGMSII.... 177
401 5.000e-75gi|495797406|ref|WP_008521985.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Jonquetella]  clstr ali  29  1..MAGFYKELLAAGFGGQGVMMLGQLVAFSGIEDGRNVTWIPSYGPEMRGGTANCSCVVSDEPVGSP-MVTSGDVVVVMNQPSLTK-FESAVKPGGLLIYNSDLVNYE---KPRTDIRVLPVPANSIATELGSDKVANIVILGTLVEASGMVSLDSAMKIIREKLGKK-KPKFLPMNLEAFARGRALVKK.. 182
402 5.000e-75JGI.Meta 7075601684 C4854629__gene_129579 ketoisovalerate ferredoxin oxidoreductase [Human Stool microbiome from visit number 1 of subject 1  ali  25  1...MKK--EIVAAGFGGQGVLSMGKILAYAGLMDDLEVTWMPSYGPEQRGGTANVTVVVSDKPISSP-VLDAYDTAVILNQQSLDK-FESKIKPGGVLIYD---PYGIHRKPTRTDIDVYPVEAMEASIELKNAKVYNMIVLGALLKVNPVVDIESVMRGLKKALPERH-HHLLPANREAILKGMELVEV.. 179
403 5.000e-75gi|516660753|ref|WP_018027763.1| hypothetical protein [Porphyromonas somerae]  clstr ali  27  1...MKKSYEIVISGFGGQGVLSMGKILAYSGLMGGKEVSWMPSYGPEQRGGTANVTVIISEEGISSP-ILNEYDVAIVLNQPSMDK-FLPMVKKGGIVLYDSNGVSHV---PERDDINVFRVDAVDESVKMNNTKVFNIIVLGGLLKVAPMVDINNIEAGLKKSLPERH-HKLIPLNLDALKRGMEIVVQE. 182
404 5.000e-75gi|501110653|ref|WP_012160247.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Alkaliphilus oremlandii]  clstr ali  28  6.........VILSGFGGQGVMSAGQLLTYAGMIENKEVSWLPSYGPEMRGGAANCAVVVSDAPVGSPVITNDATAAIVMNLPSLK--FAKNVVADGVVIVNSSLVEE---KVARDDVKTYYVPANDIALEMGNSRVVNMIMLGAYLEATKAVSVDSVLEAFKKVYGP-SKEKLIPLNKEALERGAAAVR... 179
405 5.000e-75gi|493797514|ref|WP_006745506.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Bacteroides coprosuis]  clstr ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDKKISSP-ILSSYDIAVVLNQPSLNK-FESKVKPGGVLIYEESGI---INPPTRKDIQVYRIGAIDAANEMDNSKAFNMIVLGGLLKVRPMVSLESVIKGLRETLPERH-HHLIPLNEEAINLGAKIIRQ.. 179
406 6.000e-75 GL0011323 [Complete] locus=scaffold3321_7:6227:6796:+  ali  26  8.KVMKQ--EIIIAGFGGQGVLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTANVTVIVSDERISSP-ILSQYDTAIILNQPSLAK-FENKVKPGGILIYDGYGIIE---PPTRKDIQIYRIDAMDAANERGIAKTFNMIVLGGLLKLRPVVAIESVLKALRKTLPERH-HHLIPVNEEAIHIGMEIIKPQ. 189
407 6.000e-75gi|936187100|ref|WP_054521351.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Thermanaerothrix daxensis]  clstr ali  30  3.......TEIVIAGFGGQGVLFAGQLLAYAAMDNGLEVTWIPSYGPEMRGGTANCTVIISDEEIGSP-IVRNPQVALVLNRPSLDK-YEPLVKVGGLLVVNASLVD---RSVGRRDIQVVMVPANEIAEQLGDRRVANMVMLGAMLANHPVLSVEAVVKAMEAHMLSRHR-NLLPLNVAALQEGAKF..... 176
408 6.000e-75gi|502879133|ref|WP_013114109.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Brachyspira murdochii]  clstr ali  27  6.........IIFAGFGGQGVMSMGQMIAYAGMIENKHVTWCPSYGPEMRGGTANCSVVVSDELVGSPIISHDANAAVIMNLPSLTK-FEKDVLPNGILLINSSLID---KKASRDDIKVAYVEANKIAGDIGNPKSANMVMLGALLTLQNVVSFDSVQQAFLKVFGER-KKDFLPSNEKALNAGRDAVK... 180
409 6.000e-75gi|551218309|ref|WP_022846247.1| pyruvate synthase [Desulfurobacterium sp. TC5-1]  clstr ali  48  1......MIEIRWHARGGQGAVTASKILASSAIREGKYAQSAPDYGAERAGAPLRSFNRVSENPITLHCLVLHPDIVVVVDPTLLKVPILEGTSEDAVLVINTDKTPQEIRSMLNIEGKIFTVNASAIAMEEFGKPFMNVPMLGALVKVINLVSLDSVKEDIKATFGKKVSKELLEANLRALERAYKEVKGE. 188
410 7.000e-75gi|659851037|ref|WP_029898529.1| pyruvate synthase [Desulfovibrio sp. L21-Syr-AB]  clstr ali  41  1......MLEIRIHGRGGQGGVTSAELLAKAVIDQGRFAQAFPSFGPERRGAPVVAFVRVSGEQIRLREKIYKPDVVLVLDPSLLDVDVAEGLAEDGVVVVNTNRSAEELKRKYGWP-RVATVDAQKVALEELGVPITNTTMLGALLRAVDILPAE----AMEDSIAERFGPKLGPKNYKALGRAHAETVVA. 181
411 7.000e-75gi|1015805086|dbj|GAT63162.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Paludibacter jiangxiensis]  clstr ali  25  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMQGKEVSWMPSYGPEQRGGTANVTVILSDERISSP-ILYEFDTAIILNQPSLDK-FESRIKPGGTLIYDGH---GFVHPPKRTDINIYRIDALEQSIALNMAKTFNMFILGGFLKVRPIVKIEDVLLGLKKSLPERH-HHLLPQNEKALRKGMEI..... 176
412 7.000e-75gi|484591713|gb|AGK60356.1| pyruvate ferredoxin oxidoreductase, gamma subunit [Archaeoglobus sulfaticallidus PM70-1]  clstr ali  32  1..MSDILVEVRFHGRGGQGVVTAADMLAVAGFKDGYYTLSFPTFGAEKRGTPVASFLRLSDEPIVSRDEIYYPDYVVVMDPTVIGVKVDAGIKSDGKIIANYPKGPEELKESMGVDVEVYTINATRMAMEHLGRPITNTAMVGAFVGATGIIKIDSVLETVREWFSG----ELAEKNAKLITEAYNYMKE.. 185
413 7.000e-75JGI.Meta 7068837476 C2300718__gene_188973 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  43  3...MQDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNKPITIHSNIYEPDYVVVVDDTLLEVDVTAGLKATGAIVINTTKTPEYLKSKLKDKGEIYTIDARKVSMETLGRYFPNTPMLAAIVKVSKIMDEQDFINDMKGSFK.......................... 167
414 7.000e-75gi|517148338|ref|WP_018337156.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Butyricimonas synergistica]  clstr ali  23  4........EIIIAGFGGQGVLSMGKILAYSGIMQDQEVAWMPSYGPEMRGGTANVTVILSDERISSP-ILTKYDTAIVLNQQSMDK-FESMVKPGGVLIYDPNGITHE---PTRKDINIYKIEGTAIAVEQGNPKVFNMIVLGGFLKIKPIVKLENVEKGLQKSLPARH-HKMIPMNIEAIQTGMNSVEV.. 179
415 8.000e-75gi|502945486|ref|WP_013180462.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanococcus voltae]  clstr ali  45  1......MIEVRFHGRGGQGAVTAAQILAKASFYDGKFCQAFPFFGVERRGAPVMAFTRINDEKIRLRTQIYAPNFVIVQDPTLLDIDVTSGLQKGGLILINTLKDID----LNGYDVK--TIDATGISLDVLGVPIVNTTMVGAFAGLTNQVSLESLKKAIKETFPGK........................ 157
416 8.000e-75gi|1007512237|gb|KYH40211.1| pyruvate synthase [Candidatus Bathyarchaeota archaeon B26-2]  clstr ali  43  3.......VEVRWHGRGGQGIVTVSRLLAQAALIDGKYVQAFPEFGPERAGAPVTGFTRISDEPISIHSRIYNPEIIVLVDPTLLGKNIVEGLVEGGTIVANTEMGPSEIKEELNVDAKVYTVDATRIALDILGRPIYNTAMLGALLKVAPLASMDSMVKVVMDRFPG----TVGEKNVAVIKGAYEEVKGY. 184
417 8.000e-75gi|922764262|ref|WP_053365362.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Bacillus sp. FJAT-27245]  clstr ali  28  4........EIIIAGFGGQGIMSMGQLLAYAGLHEGKNVSWLPSYGPEQRGGTANCAIVISDEPVGSP-LVSSPSAAIVLNIPSFEK-FEPKVRAGGVLITNRSLVPA---KSARSDIRSIEIDATGIANGLGNGRVANMVLLGAFIEATGILSYNSLIESLKKVLSA-DKHHLIDLNRQALAKGAAIVQEA. 180
418 8.000e-75gi|1001773299|ref|WP_061315332.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella bivia]  clstr ali  25  1...MK--TEIIISGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDQRISSP-ILSKYDVAIVLNQPSLDK-FEEKVKPGGILIY---EGNGIINPPKRTDIQIYRINAVEKAAELKNSKVFNMIVLGGLLGVCPVVSNEGLQKALYKTLPERH-HGLIPLNMEAVEAGKSIMKKQ. 180
419 8.000e-75JGI.Meta 7027895214 SRS021948_Baylor_scaffold_926__gene_997 ketoisovalerate oxidoreductase subunit vorA [Human Stool microbiome from visit n  ali  28  1...MKK--EIIIAGFGGQGVLSMGKILAYAGLMDDLEVSWMPSYGPEQRGGTANVTVILSDQPISSP-VLDTYDVAVILNQQSLDK-FESRIKPGGILIYD---PYGIHHKPTRSDIKIYEVNGMDAAIDMKNSKTYNMILLGALLAIVPIVPVESVMKGLQKVLPERH-HHLLPLNRDAILRGMSLV.... 177
420 8.000e-75JGI.Meta 7025450186 SRS045004_LANL_scaffold_30381__gene_46936 hypothetical protein [Human Stool microbiome from visit number 1 of subject 60  ali  24  1...MKQ--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVSWMPSYGPEQRGGTANVTVILSDDRISSP-VLNEYDIAIILNQPSMEK-FENKVKKGGIIIYDGYGIHTPVK---RTDVSVYRVDAMDAATEMKNEKAFNMLILGGLLKIVPMVKLENVLLGLKKSLPERH-HKLIPMNEAAIKKGMEII.... 177
421 8.000e-75gi|860581600|ref|WP_048471245.1| 2-oxoacid:acceptor oxidoreductase [Mycobacterium chlorophenolicum]  clstr ali  38  1......MFEVRIHGRGGQGVVTAAGLLSVAAFLDGKYAQAFPSFGSERTGAPVAAFCRIDEKEIRSREPVVRPDALIVQDATLLHVAVFDGLAPAGYLLINSSRSLAQLGLGEFLEGRILAVPATDLAREHLGRPVPNVVLLGGFAALTGRVSPDSVVAAIRE----RFTGTVADGNVAAARSAFDFVRTE. 186
422 8.000e-75gi|501693676|ref|WP_012618636.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanosphaerula palustris]  clstr ali  38  1......MQELRIHGRGGQGSVTAAELIAVAAFEGGMFAQAFPAFGVERRGAPVQAFVRFSDSTIRLRSQVYEPDFVIVQDSTLIDVDVFKGLKKGGIAIINTEK---ALQSAVPEGVRLITIDATSIALEVLGLPITNTALMGAFAAATGIIGFETLTKALN----GRFKGPLAEKNIETARRAYLQVKGEQ 180
423 9.000e-75gi|517532994|ref|WP_018703202.1| MULTISPECIES: hypothetical protein [Veillonellaceae]  clstr ali  26  1...MSQTHEIIMSGFGGQGIMLMGQLLTYAGMLEGKEVTWIPSYGPEMRGGTAYCSVIVSEDPIGAP-MVSEPSMVVAMNLPSLTR-FEGALQKGGTLIINSSLIDKD---ATRKDINVFKVPVNEIAAELGNPKVGNMVMLGAIIAAAEPVKTESMLGAFKKMFEKKFKPDLFKINEAAIQRGADFIKK.. 184
424 9.000e-75gi|553310899|ref|WP_023055882.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Peptoniphilus sp. BV3C26]  clstr ali  28  6.........IVMAGFGGQGVMAMGQLISYAGMLEGKHVSWYPSYGPEMRGGAANCSVVVSTDPVGSP-IIAVADDVVVMNEPSLE-LFESHVKPGGNLLLNSSLVQSE---PTRKDINIYKIPVNDIAGQIGNPRVANMVMLGAYLKVTGLVEKDSIIAAFTKVYGDK-KKKLIPINEKAIGEGQNAV.... 178
425 1.000e-74gi|931375047|gb|KPJ65807.1| hypothetical protein AMJ45_04585 [Syntrophobacter sp. DG_60]  clstr ali  42  1......MKEIRFHGRGGQGAVTCVELVAKAAIAEGKYAQGFPSFGPERRGAPVMAFLRVDSAPIRLRQKIYEPDVVVILDPALLTEAVIAGLKENGLIIANSPEPAKELRKKLGYKQRLAIVDATKIALDTLRVPITNTTMLGALIKVTNIVSKEAMAEALKERFG-----RLAERNKMTMERAFSET.... 178
426 1.000e-74gi|657646877|ref|WP_029451325.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Clostridium algidicarnis]  clstr ali  29  5........EIIFAGFGGQGILSMGKFIAYAGMDANMNVSWLPSYGPEMRGGTANCSVILADEPVGSP-IVTMPDSVVVMNRPSLDK-FEKTIKKGGLVILDSDLIA---REVERDDIQVIRVPAQTIAAELGSTKIANMVLLGALVAKTGIVSMEVLLGSLKD----HGKEKFFEVNKKALEKGAEYAK... 176
427 1.000e-74gi|763048875|ref|WP_043931439.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Bacillus sp. EB01]  clstr ali  29  4........EIIIAGFGGQGVMSMGQLIAYAGMHEGKNVSWLPSYGPEQRGGTANCAVVVSDEPVGSP-LVSAPSAAIVLNIPSFEK-FEPKVRPGGLLIVNSSLVG---LKFTRNDLTIIEIDATAIANELGNGKVANMVLVGAFVEWTGIVSDEAVIASLKKVLSE-EKHSLIPVNKCALDKGALIAQE.. 179
428 1.000e-74gi|1011505758|ref|WP_062400295.1| pyruvate ferredoxin oxidoreductase [Methanogenium cariaci]  clstr ali  39  1......MRELRIHGRGGQGSVTAAELIATAAFKSGVYSQAFPAFGVERRGAPVQAFVRFSDEKVRLRSQIYEPDYIVVQDSSLIDVDVFSGLKAGGIALVNTENGNFEGVP---EGVKLITIDATSLALEILGLPITNTTLMGAFAAATGEIELESLEEALRE----RFSGSLAEKNIAAARRAYELVKE.. 179
429 1.000e-74gi|498109903|ref|WP_010424059.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Anaerophaga thermohalophila]  clstr ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYSGVIQDMEVSWMPSYGPEMRGGTANVTVVLSDHRISSP-ILHSFDTAIILNQQSLDK-FEPKVKPGGVLLYDSNGIT---RHPERDDINIYRIDATEEAARMKSTKTMNMIVLGAYLKIKPIIEMENILKGLRKSLPQRH-HHLLPMNEKAIQRGKEIV.... 177
430 1.000e-74gi|652930914|ref|WP_027184653.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Desulfovibrio inopinatus]  clstr ali  24  1...MSLYKDVIIAGFGGQGVMLIGNLLAYAGMNHGLNVTYIPVYGPEMRGGTANCTVVVSDEEIGSP-IIQSPESVIIMNRPSLDK-FGPSLKDGGVAVINSSLVDPTLAEKDRYS--VFAVPAVDIADKIGNTRMANMVALGAYIKASNVMPLDVVKDSLENVISAHYKH-LIPKNSEALQAGYDHV.... 180
431 1.000e-74gi|931422546|gb|KPK08777.1| 2-oxoacid:acceptor oxidoreductase [Betaproteobacteria bacterium SG8_39]  clstr ali  36  1......MFQIRIHGRGGQGVVTAAETLSIAAFLENRFAQAFPSFGSERTGAPVVAFCRIDEREIRLREPVLKPDALIIQDPTLLHVDVFSGLAPDGYILINTTRSFDALGVGEFVRGHLCTVPASELARKHVGRPVPNAALLGGFAAVSGRVSIDAVAEALRQ----KFSGAIAEGNVTAAREAYEHVRQE. 186
432 1.000e-74gi|490112875|ref|WP_004013520.1| 2-oxoacid:acceptor oxidoreductase subunit gamma [Mobiluncus mulieris]  clstr ali  38  1......MVEIRVHGRGGQGVVTAADLMAYAAFADGHHAQAFPSFGSERTGAPVVSYCRIEDREIRSREPILQPDVVIVQDPTLLAINPFSGLKPGGYALVNSQKSPHELGLSSLPEGHFRTMPATEIAIEILGRPMPNAVMLGGLASLTGIVKLDSVSDAIRE----RFKGKVGNLNVEAAAAAYKYLKGEE 187
433 1.000e-74gi|530785554|ref|WP_020962320.1| MULTISPECIES: hypothetical protein [Thermofilum]  clstr ali  40  1..MEREFYEVRWHGRGGQGVVTSSELLALAALKEGKHVYHAPEFGPERRGAPVRAYTRIGNVPLELHSGIYEPDIVVVID-PSMEPFIFAGLKKNGTLVINAKTPSEKVLENVKNGLNLWIVDAYKIAMEVFGRPFYNTPMLGALVKASNIVNLDSVLSAVSERFSK--DSKIAQLNVLAIKRAYEEVKKYE 190
434 1.000e-74 GL0094072 [Complete] locus=scaffold11853_1:1466:2023:+  ali  23  5........EIIIAGFGGQGVLSMGKILAYSGVMQGLEVSWMPSYGPEMRGGTANVTVILSDRQISSP-IVHDYDTAIILNQQSMDK-FEPRVKPGGVLIYD---PNGVVRPPQRKDIRVYAIPATEEAARLGNIRVFNTMILGGYLKVKPVVSLDNVFRGLAKSLPERM-ASLIPANEAAIQKGMEIIRVPE 182
435 2.000e-74gi|516896835|ref|WP_018153871.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanothermococcus thermolithotrophicus]  clstr ali  39  1......MDEIRFHGRGGQGAVTAAEILAIASLKEGKFCQAFPFFGPEKRGAPVTSYVRISDSEIKTRTQIYNPNYVMVLDPTVINVDVVQGL-DDGTIIVNTKEPIEFEGQ------NTYTIDATKLAIETLGVPITNTVMIGAFLAIYDNISLDSVISIISERFPKK----LADKNILAVKRAYDEMKK.. 176
436 2.000e-74 GL0114960 [Complete] locus=scaffold35126_3:587:1144:+  ali  24  1...MKQ--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVSWMPSYGPEQRGGTANVTVILSDDRISSP-VLNEYDIAIILNQPSMDK-FENKVKKGGIIIYDGYGIHTPVK---RTDVSVYRVDAMDAATEMKNEKAFNMLILGGLLKIVPMVKLENVLLGLKKSLPERH-HKLIPMNEAAIKKGMEIIQ... 178
437 2.000e-74gi|495359901|ref|WP_008084621.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Aciduliprofundum boonei]  clstr ali  41  1......MIEIRFHGRGGQGSVIASKILAKAFFMEGKYVSAFPYYGVERRGAPVTAFTRVDEKPIRAKYQIYEPDYVIVLDPSLLTVDVLHGLKRNGWILVNTAKKPMELRSTLNFP-HIATVDATTIALKHLGAPIVNTAILGAFSKLSGTVKIETVMDAIRQMAPVKQ-----EENAQAAKDAYESV.... 181
438 2.000e-74gi|902951994|dbj|GAP12446.1| pyruvate:ferredoxin oxidoreductase [Longilinea arvoryzae]  clstr ali  32  3.......YEFIFSGFGGQGALFAGQILAYSAMDSGKEVTWIPSYGPEMRGGTANCTVVISDEEIGSP-LVKNPTAVVAMNLPSLDK-YEPMVAPGGVLIVNSSMVD---RQPTRTDIKWVMVPGNELAEQIAEKRLTNMVLLGALLANLPVLPLEAIEAGLKAHLPARH-HRFLPANSAALHKGAEF..... 176
439 2.000e-74gi|640558784|ref|WP_024990317.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella albensis]  clstr ali  27  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTANVTVIISDNRISSP-ILSSYDIAIVLNQPSLDK-FESKVKPGGILIYD---GFGVMNPPKRKDIKVYRIDAMDKAAEMKNSKVFNMIVLGGLLQVCPILPDKALEKALYKTLPERH-HNLIPLNMEAVGEGRKIINEE. 180
440 2.000e-74gi|987323185|gb|KXB37128.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit [Bacteroidales bacterium KA00344]  clstr ali  26  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDREVTWMPAYGPEQRGGTANVTVIVSDERISSP-ILSQYDIAIVLNQPSLDK-FMPKVKPGGILIYD---GFGIVETPQRDDITIYRIDAMDKAAEMKNAKVFNMIVLGGLLKVAPVVSGDGVGKTLYKTLPERH-HDLIPLNMQALAVGMEIIRK.. 179
441 2.000e-74gi|749039743|ref|WP_040085729.1| 2-oxoacid:acceptor oxidoreductase [Corynebacterium humireducens]  clstr ali  39  1......MVEVRIHGRGGQGVVTASDLIAMAAFEEGRHAQAFPSFGSERTGAPVVAYCRISDTPIRTREPVLRPDLVVVQDRTLLPINVFSGLTEDGYVLINSSKRSAELGLSDQPAGHFMTIPATDIAREHTGRTVPNAVLLGGVAALTGLYRMESVSHAIMNRFPGR----VGEMNVAAAQAAYDLVKQEE 189
442 2.000e-74JGI.Meta 7021036349 C782953__gene_56203 hypothetical protein [Human Posterior fornix microbiome from visit number 2 of subject 159005010] :_  ali  24  2......TYEIVIAGFGGQGVLSMGKTIAYSGMMEDKEVSWMPSYGPEQRGGTSNVTVIVSDEKVSSP-VLNSYDIAITLNQPSLDK-FAPRVKKNGILIY---EPNGIHTITDRKDINIYEVDATEIANAMGNDKLFNMIILGGLLKLVPFVKYESVITGLKKSLPERH-HKLIPLNEEAIKRGMEAIK... 178
443 2.000e-74gi|493851596|ref|WP_006798524.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Dysgonomonas gadei]  clstr ali  24  4........EVIIAGFGGQGVLSMGKILAYSGLMEDKEVSWFPSYGPEQRGGTANVTVILSDNAISSP-IVNEYDIAIILNQPSLDK-FEPHVKPGGILIYD---PSGFQHPPTRKDIYIYKIEAIDTATLMQNTKAFNMIVLGGLLKVSPMVQLDNVMLGLKKSLPERH-HKLLPMNEQAILKGMEIIQEVQ 181
444 2.000e-74gi|931515504|gb|KPK93383.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Anaerolineae bacterium SM23_ 63]  clstr ali  28  3.......TEIIISGFGGQGVLFAGQLLSYAALEKDLHVTWYPSYGPEMRGGTAHCTVIISDDEIGSP-VIRNPNAAIVMNLPSLDK-YEPLLKTDGVLIINASLID---REPEREDLRIVLVPANDIAEELGDKRLANLVMLGALINQLDVLSIEDVGVSLDRHIPKHHR-DLLEGNLNALERGAALAMAEK 181
445 2.000e-74gi|503143957|ref|WP_013378618.1| pyruvate/ketoisovalerate oxidoreductase [Eubacterium limosum]  clstr ali  40  1......MIEIRWHGRGGQGAFTAARLLGDAVVCDDKSALAFPSFGPERRGAPVLAFTRIDDAPIKDRSDVVDCDCAIVLDETLLGAPVKAGLKPGAKVIINTMKPAEVFDFSDCEDCKVITVDATGLALKILGRPITNVPLLGALTAATELTSLDSIYKAIDTQLPEKVRAK----NKTLLEETYNTVKEA. 181
446 2.000e-74gi|503554319|ref|WP_013788395.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Thermoanaerobacterium xylanolyticum]  clstr ali  27  1......MNEIIFAGFGGQGIMSMGLIMSYAGMMDGKNVSWLPSYGPEMRGGTANCHVTISDEPVGSP-IINEATVVVAMNRPSLEK-YEKYVVPGGKLFINTSLIKE---KAKRKDIEVYEIAANDIANELGNLKIANMVILGALIKATNITKIESTLKALVEVLGP-SKEHLVSINEKALEKGAELI.... 177
447 2.000e-74gi|815711006|ref|WP_046443572.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Catabacter hongkongensis]  clstr ali  28  4........EIILAGFGGQGVLLAGQIIAYAGMNEGKNVSWLPSYGPEMRGGTANCNVVVSDGEVGSPVVV-DADCVLVMNRPSLEK-YEKDLKPGGLLLINSDLIEIE---PTRTDVRVIKVPANSLAEQVGSIKAANMVMLGAYNECAHVVENKTIIECLAKIMGEK-KAHLIPMNEKALEAGAQAAR... 178
448 2.000e-74gi|490200737|ref|WP_004099229.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Acetonema longum]  clstr ali  32  2......THEMIIAGFGGQGIMVMGQLLTYAGMLEEKNVSWIPSYGPEMRGGTANCSIIVADEPIGAP-IVSESSAVVAMNLPSLDK-FESTLRPGGILIINSSLID---KQAQRTDIKIFRVPANDIANELGNAKVANMVALGALVAATKAVDTESVVKAFAKMFAKK--PELLAINKTAINRGVEQI.... 176
449 2.000e-74gi|738270593|ref|WP_036225265.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Mesoaciditoga lauensis]  clstr ali  30  6.........VIAAGFGGQGVMLMGKIIAEAAMHDGKKVTWLPSYGPEMRGGTANCTVVISDEDIGSP-VVDIPDVVIAMNIPSMFK-FEKELKKDGILLLNSSVID---RDPTRKDVKVFKIDANKIADEIGNVKVLNMVTLGAFAKASGIITFDSIKKALEETMTGK-KKVFLDINIKAVQEGMNKVEEA. 181
450 3.000e-74gi|987323485|gb|KXB37412.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit [Bacteroidales bacterium KA00251]  clstr ali  22  2......TYEIVIAGFGGQGVLSMGKIMAYSGLMEGKEVSWMPSYGPEQRGGTSNVTVIVSDEKVNSP-VLNTYDIVIALNQPSIDK-FAPRVKKGGSLFFD---PNGINHVTDRTDINVYEIDANEEANKMGNAKAFNMIILGGVMKIHPFVTLESVLAGLKKSLPERH-HKLIPMNEQALKLGMEVVKQIK 181
451 3.000e-74gi|516804592|ref|WP_018109468.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Bacteroides propionicifaciens]  clstr ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMEDKEVTWMPSYGPEQRGGTANVTVIVSDERISSP-IVSTFDIVVVLNQPSLEK-FESKVKPGGLLIY---EESTIINPPTRTDIKVHSIAAIDAANEMHNSKAFNMIVLGGLLKLKPMVSTEGVLKGLFKTLPERH-HHLIPVNEQAITLGGQIIK... 178
452 3.000e-74 GL0144139 [Complete] locus=scaffold92103_1:10565:11101:-  ali  25  1...MKE--EIVIAGFGGQGVLSMGKILAYAGLMDNLEVSWMPSYGPEQRGGTANVTVILSDSRISSP-VLDTFDTAVILNQQSLDK-FESRVKPGGTLIYD---PYGIHHAPTRTDIRIVPVEAMEATFEMKNAKTYNMILLGALLACRPVVSLDAVIRGLRKTLPERH-HHLIPLNEEALRKGMALVK... 178
453 3.000e-74gi|985657921|gb|KXA90360.1| pyruvate ferredoxin oxidoreductase [candidate divison MSBL1 archaeon SCGC-AAA259D14]  clstr ali  41  1......MKEIRIHGRGGQGSVTMASMLAEAAHEGGMWAQGFPSFGVERLGAPIQAFTRLDDRKITDRSQVDRPDYVIVQDSTLLKVDVLSGLREGGMVLVNSSSSPNNLDLE--TDNEIITVDATSIALEHLGRPIMNTALAGAFSGATDLIKKDSLIKVVKREFPG----ELGEKNVAAINEAYEKVK... 178
454 3.000e-74gi|502632755|ref|WP_012869337.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Thermanaerovibrio acidaminovorans]  clstr ali  27  1..MNTRM---IFAGFGGQGVMLMGQIISYAGMLEGKHVTWMPSYGPEMRGGTANCTVVISDQEVASP-VTNDAEVVVAMNIPSL-VKFEPAVTPNGCLLINQSVID---REPQRTDLVSVKVPCNEIAEKLGNLKVANMVMLGAVAGATGVVSKESIVKALEKKLSAGGKAALIEVNKNAIERGFETAKAA. 181
455 3.000e-74gi|1001051065|gb|KXO16231.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Clostridiales bacterium KA00134] :_  clstr ali  26  1..MEKK---IIMAGFGGQGVMAMGQLTTYAGMIEGHYVSWMPSYGPEMRGGSANCSVVVSDEPVGAP-VISVATDVIAMNQPSYEKFVT-MLKKGGNLFVNSSLVHVD---NPRDDINIYEIPVNEIAMELGNPKVANMVMLGAFIKVTEIVGEESVLKAFTKVYGD-SKKKLIPLNQKALEEGQKQV.... 177
456 3.000e-74gi|653069163|ref|WP_027320351.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Bacillus sp. URHB0009]  clstr ali  28  4........EMIIAGFGGQGIMSMGQLIAYAGMLEGKNVSWLPSYGPEQRGGTANCAVVVSDTPVGSP-LVSRPSTVIVLNNPSFDK-FEPMVRPGGLLISNISLVD---RTSARKDITNIEVEATDLANELGNPKIANMILLGAYLEHCRIVQEESILESLKKVLS-KDKHHLLELNKQALRKGA....... 174
457 3.000e-74gi|503062058|ref|WP_013297034.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Thermoanaerobacterium thermosaccharolyticum]  clstr ali  30  5.........IIFAGFGGQGIMSMGLIMAYAGMMDGKNVSWLPSYGPEMRGGTANCHVTISDEPVGSP-IINEATVVVAMNRPSLER-FEKHLVKGGILLINSSLIDI---GPQRSDIEVYRIPANDIANQMGNLKIANSIMIGALMSLKNIVSEDAVINAFKKVFEGK--EKLIPINIQAYNRGKESI.... 176
458 3.000e-74gi|497437823|ref|WP_009752021.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Prevotella sp. oral taxon 473]  clstr ali  26  4........EIIIAGFGGQGVLSMGKILAYAALMEGKEVSWMPAYGPEQRGGTANVTVIISDENISSP-ILSNYDTAILLNQPSIDK-FQPKVKPGGTLIFD---GFGVMQPPSREDINVYSVAAMNTATEMKLAKCFNMFILGSYLKVHPIVKVESVMKALRKTLPERH-HHLLPANEQAILKGMDLV.... 177
459 3.000e-74gi|499766766|ref|WP_011447500.1| 2-oxoacid:acceptor oxidoreductase subunit gamma [Methanospirillum hungatei]  clstr ali  38  1......MRELRIHGRGGQGSVTAAELIAVAAFKSGVFSQAFPAFGVERRGAPVQAFVRFSDEKIRLRSQVYEPDYVIVQDSTLIDVNVFSGMKKGGIILINT---GGDIHGTIPEGVRYIPIDATKLALEVLGVPITNTTLMGAFAAASGEISLEALEEAVRE----RFSGSLADKNVAASRKAYDLIK... 177
460 4.000e-74JGI.Meta 7068880265 C2396690__gene_231762 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  27  5........EMILAGFGGQGILFTGKILAFAAMLKDKKLSWLPSYGPEMRGGTANCHVIIDDEPIGSP-IVTRPNILVAMNKPSLDK-FENTVSDGGYVFIDTSLID---RRTEREDVNEICVNATETAHNIGNKGLANMVMLGAVLKKTELFTIDEIEYTMKKSLPE-NKHKLIEMNIKAVKEGYNLV.... 178
461 4.000e-74gi|503147058|ref|WP_013381719.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Eubacterium limosum]  clstr ali  27  2.....ETKKICFAGFGGQGVLSVGKLLAYAAMIKDKEVSWCPSYGPEMRGGTANCTVIISDEPIGSPVVTKNASSAVVMNEPSFRK-FENVVAPGGAMIINANLIS---LKPERTDIRTIYVPASDIAKELGNPKLMNMVLLGALLEVDHTISEEAVLEAFTKVFGE-GKAKFIPVNRQALEKGKNYARA.. 181