current user: public




281896
Query: TM0015 TM0015 281896 PDB-2007-09-14, from T.maritima

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# E-value Template Links and tools%idFirst MPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIGDEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKICVVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRALRRGYEEVKCSELast
1 1.000e-95gi|647308788|ref|WP_025748644.1| pyruvate synthase [Caldicoprobacter oshimai]  clstr ali  50  1...MGRMIEIRWHGRGGQGAKTASLLLAEAAFDTGKYVQGFPEYGPERMGAPITAYNRISDEPITIHSNIYEPDYVIVVDETLVSVDVTAGLKKDGAIVINSAKDPEEFRPLLGFEGKIYTIDARKISVEELGRYFPNVPMLGAIAKITKLMDEDAFIEAMERSFHHKFKPHVIEGNMRALKRAMREVK... 190
2 2.000e-95gi|496185119|ref|WP_008909626.1| pyruvate synthase [Caloramator australicus]  clstr ali  49  1...MGKLVEIRWHGRGGQGAKTASLLLAEVAFNTGKYIQGFPEYGPERMGAPITAYNRISDEPITIHSNIYEPDYVVVVDETLISVPVTAGLKEGGAVIVNTAKSPEEIKKELNFNGKVYTIDARKISEETLGAYFPNTPMLAAVVKITGVIPVDVFLNDIEASFKHKFKPHVVPKNMEAVKRALEEVKGNE 192
3 7.000e-95gi|501542475|ref|WP_012547593.1| pyruvate synthase [Dictyoglomus thermophilum]  clstr ali  56  1...MKDMLEIRWHARAGQGAKTASYLLAETAMEAGKYIQAFPEYGPERTGAPMKAYTRISDKPIRIHSQIYNPDVVVVLDKTLIKVNVLEGLPSDGIIIVNTTQPPEEIREQLGIDRKIYTVDATGIALETIGRPIPNTPMLGALIRVVPIISLDEVLNQFRKKFEGRFKPEVIEGNLQAIKRAYEEVK... 188
4 5.000e-94gi|599129199|gb|EYE88056.1| pyruvate synthase [Fervidicella metallireducens AeB]  clstr ali  47  1...MAKLVEIRWHGRGGQGAKTASLLLAEVAFKTGMYIQGFPEYGPERMGAPITAYNRISDEPLRVHSNIYEPDYVVVVDETLISVPVTAGLKKDGAIIVNTSKTPEEIRKELKYDGRVYTIDARKISEETLGANFPNTPMLAAVVKVSGVISEEVLLNNMEDSFKHKFKPQVVPKNMEALKRSLQEVK... 189
5 6.000e-94gi|503196055|ref|WP_013430716.1| pyruvate synthase [Caldicellulosiruptor kronotskyensis]  clstr ali  51  1...MGKMIEIRWHGRGGQGAKTASLLLAEAAFNTGKYVQGFPEYGPERMGAPITAYNRISDEKITIHSNIYEPDYVVVVDETLISVDVTKGLKKDGAIIVNTSKSPEEVKKMLGFDGKVYTIDARKISMECLGKYFPNIPVLGAVIKVTGIIPEEEAIKDMEGSLKHKFKPDVIEGNLKAFVRGMQEVQ... 190
6 9.000e-93gi|652832935|ref|WP_027116761.1| pyruvate synthase [Lachnospiraceae bacterium P6B14]  clstr ali  48  1..MNDDMIEIRWHGRGGQGAKTASQLLADAAFSAGQYVQSFPEYGPERSGAPITAYNRISKERCNIHSNIYDPDYVVVVDETLLEVDVTAGLSPDGAIIVNTEKDPAEIRPHLGYTGRVCTIDARKISIDCLGKYFPNTPMLAAVVAVSGCVEKDSFLKDMEASYSHKFKPQVIEGNLKCLRRSMKEVKE.. 192
7 1.000e-92gi|503547538|ref|WP_013781614.1| pyruvate synthase [Mahella australiensis]  clstr ali  53  1...MGKMIEIRWHGRGGQGAKTASLLLAEALFNTGKYIQGFPEYGPERSGAPLTAYNRISDEPIRVHSNIYEPDYVVVVDETLLSVDVTAGLKETGGIVVNTPKSPEEIRHLKDYKGKVGTVDAKKISEEELGRYFPNVPMLGAIMAMTGLVEKEQFIKSMEESFHHKFKPEVIDGNVRALKRAMEEVRIS. 192
8 3.000e-92T2D.3163546 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  44  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNTPIRIHSNIYEPDYVVVVDDSLLEVDVTAGLKPDGAIVINTTKSGNELKPLLGYTGDVYTIDARKISLETLGKYFPNTPMLAAIVKVSGVIEEKDFLADMEGSFKHKFKPEVIDGNMKALEMALKEVNKV. 192
9 4.000e-92gi|547943077|ref|WP_022344309.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:356]  clstr ali  44  1...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDKPITIHSNIYEPDYVVVVDDTLLSVPVTAGLKKEGAIVINTTKKPEELKELLGYDGSVYTIDARKVSEEALGRYFPNTPMLAAIVKVAGVMTDEELLEDMKTSFKHKFKPEVIDGNMKALEFALKEVTKIQ 193
10 5.000e-92JGI.Meta JGI_HUM.4046126 7006258450 C3059854__gene_175854 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Tongue  ali  51  31...MKDIVEIRWHGRGGQGAKTASLLLADAAFNTGKYVQGFPEYGPERMGAPITAYNRISGERSTVHSNIYEPDFVVVVDETLLTVDVTAGLKEDGAIVINSSKDPQELRALKGYKGKVCTIDARKISEEELGKNFPNTPMLAAIVKVSGVVPQEEFIKDMQASFEHKFKPAVIEGNMKALKRSMEEVK... 220
11 6.000e-92METAHIT MH0011 GL0136813 [Complete] locus=scaffold56170_2:845:1423:+  ali  47  1...MENLIEIRWHGRGGQGTKTASLLLADAAFNTGKYIQGFPEYGQERRGAPITAYNRISDDPITVHSNIYEPDYVVVVDDTLLEVDVTAGLKTNGAIVINTTKSEDYLKSVLGYKGKVYTIDARKVSTQALGRYFPNTPMLAAIVKVTGIMNDEDFLKDMEGSFKHKFKPEVIDGNMKALEMALKEVKEI. 192
12 6.000e-92T2D.193631 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  47  1...MENLIEIRWHGRGGQGTKTASLLLADAAFNTGKYIQGFPEYGQERRGAPITAYNRISDDPITVHSNIYEPDYVVVVDDTLLEVDVTAGLKTNGAIVINTTKSEDYLKSVLGYKGKVYTIDARKVSTQALGRYFPNTPMLAAIVKVTGIMNDEDFLKDMEGSFKHKFKPEVIDGNMKALEMALKEVKEI. 192
13 6.000e-92gi|2052278|emb|CAA59455.1| gamma subunit of pyruvate ferredoxin oxidoreductase [Thermotoga maritima MSB8]  clstr ali  99  22MPVAKKYFEIRWHGRAGQGAKSVSQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIGDEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKICVVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRALRRGYEEVKCSE 213
14 8.000e-92METAHIT MH0075 GL0054011 [Complete] locus=scaffold56418_1:3183:3764:+  ali  46  1...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSNIYEPDYVVVVDDTLLEVEVTDGLKEDGAIIINTTKNYDYLKNVLGYNGKVYTIDAREISMEALGKYFPNTPMLAAVVKVTGIMTDEEFLNDMQGSFKHKFKPEVIDGNMKALQLALNQV.... 189
15 1.000e-91JGI.Meta JGI_HUM.4401869 7046083067 C2010430__gene_139776 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  43  1...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDKPITIHSNIYEPDYVVVVDDTLLTVPVTAGLKKEGAIVINTTKKPEELKELLGYDGSVYTIDARKVSEEALGRYFPNTPMLAAIVKVAGVMTDEELLEDMKTSFKHKFKPEVIDGNMKALEFALKEVTKIQ 193
16 2.000e-91gi|653188041|ref|WP_027424363.1| pyruvate synthase [Lachnospiraceae bacterium AC3007]  clstr ali  45  1......MIEIRWHGRGGQGAKTASQLLADAAFMSGKYVQSFPEYGPERSGAPITAYNRISDERCLIHSNIYEPDFVVVVDETLIEVDVTSGLKEEGAVIINSSRSPDELRSLKGYRGRVCAIDARKISMDCLGSYFPNTPMLAAVVAVSGCVDREQFLSDMETSYRHKFKPQVIEGNLKCLKAAMEEVR... 187
17 2.000e-91gi|547923086|ref|WP_022325305.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:798]  clstr ali  44  1...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDAPITIHSNIYEPDYVVVVDDTLLEVDVTAGLKEEGAIVINTTKNYDYLKNVLGYKGKVYTIDARAISMEALGKYFPNTPMLAAIVKVSGIMTDEEFLNDMQGSFKHKFKPEVIEGNMKALQLALNQV.... 189
18 2.000e-91METAHIT V1 GL0003926 [Complete] locus=scaffold66995_3:253:834:-  ali  48  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPMTAYNRISVNPIRVHSNVYEPDYVVVVDDTLLSVPVTDGLKEEGAIIINTTKGIDEIKPLLGYNGNVYTIDAKKISEEALGKYFPNTPMLAAIVKVTEIMEDEAFIKDMEGSFKHKFKPEVIDGNMQAIKEALKQVKKVQ 193
19 2.000e-91T2D.2239501 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  48  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPMTAYNRISVNPIRVHSNVYEPDYVVVVDDTLLSVPVTDGLKEEGAIIINTTKGIDEIKPLLGYNGNVYTIDAKKISEEALGKYFPNTPMLAAIVKVTEIMEDEAFIKDMEGSFKHKFKPEVIDGNMQAIKEALKQVKKVQ 193
20 4.000e-91METAHIT MH0076 GL0105975 [Complete] locus=scaffold8640_2:30:611:-  ali  46  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTSPIRVHSNIYEPDYVVVVDDTLLKVDVASGLKEDGAIVINTTKGIDEIAPLLGYKGSVYTIDARKVSEEALGKYFPNTPMLAAIVKVAGIMPEDDFIKDMQDSFKHKFKPEVIDGNMKALKLALEQVKKIQ 193
21 4.000e-91T2D.1290647 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  46  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTSPIRVHSNIYEPDYVVVVDDTLLKVDVASGLKEDGAIVINTTKGIDEIAPLLGYKGSVYTIDARKVSEEALGKYFPNTPMLAAIVKVAGIMPEDDFIKDMQDSFKHKFKPEVIDGNMKALKLALEQVKKIQ 193
22 4.000e-91JGI.Meta JGI_HUM.1535648 7056716425 SRS019161_WUGC_scaffold_61208__gene_113001 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate  ali  46  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTSPIRVHSNIYEPDYVVVVDDTLLKVDVASGLKEDGAIVINTTKGIDEIAPLLGYKGSVYTIDARKVSEEALGKYFPNTPMLAAIVKVAGIMPEDDFIKDMQDSFKHKFKPEVIDGNMKALKLALEQVKKIQ 193
23 5.000e-91gi|547941664|ref|WP_022342958.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Roseburia sp. CAG:309]  clstr ali  45  1...MSELTEFRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYDRISDTEIRVHSNIYDPDYVVVVDETLLHVHVTEGLKEDGAILVNTAKTSDEIRPLLGYKGRVYTIDAREVCMKTLGKYFPNTPMLAAIVKISKIMEEENFIKEMEASLSHKFKPEVLEGNMQALRLAMQEVRGDE 193
24 5.000e-91METAHIT MH0086 GL0001288 [Complete] locus=scaffold11368_8:9017:9598:+  ali  45  1...MSELTEFRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYDRISDTEIRVHSNIYDPDYVVVVDETLLHVHVTEGLKEDGAILVNTAKTSDEIRPLLGYKGRVYTIDAREVCMKTLGKYFPNTPMLAAIVKISKIMEEENFIKEMEASLSHKFKPEVLEGNMQALRLAMQEVRGDE 193
25 6.000e-91gi|547295872|ref|WP_022028456.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:1219]  clstr ali  47  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDTPIRIHSNIYEPDYVVVVDDTLLHVDVTKGLKSDGAILINTQKSPDEIKKLSDYKGHIYTIDATKISEDCLKANFPNTAMLSAIVKITSIMTKEDLIKNMEESFKHKFKPEVIAPNIEVIKRAYDEI.... 186
26 6.000e-91gi|503151903|ref|WP_013386564.1| pyruvate synthase [Ilyobacter polytropus]  clstr ali  47  1...MSNLVEIRWHGRGGQGAKTASLLLADAAFTIGKFVQGFPEYGPERMGAPITAYNRISGEKIRVHSNIYEPDYVVVVDDTLLSVDVTKGLKKEGAIIINTSIPKEILSKLKKYDGNVFLCDARKISEESLGKNFPNTPMLGAVVKVSGIMSEEEFLGSMEESFKHKFKPEVIKGNMKALKVSMGEVKICE 193
27 7.000e-91gi|548299033|ref|WP_022490340.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:567]  clstr ali  45  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRIGNTPIRIHSNIYEPDYVVVVDDSLLEVDVTAGLKPDGAIVINTTKSGNELKPLLGYTGDVYTIDARKISLETLGKYFPNTPMLAAIVKVSGVIEEKDFLADMEGSFKHKFKPEVIDGNMKALEMALKEVNKV. 192
28 7.000e-91JGI.Meta JGI_HUM.0673568 7044924609 SRS012273_Baylor_scaffold_21408__gene_50706 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate  ali  45  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRIGNTPIRIHSNIYEPDYVVVVDDSLLEVDVTAGLKPDGAIVINTTKSGNELKPLLGYTGDVYTIDARKISLETLGKYFPNTPMLAAIVKVSGVIEEKDFLADMEGSFKHKFKPEVIDGNMKALEMALKEVNKV. 192
29 1.000e-90METAHIT unmapped GL0069822 unmapped_[Complete]_[mRNA]_locus=scaffold134630_1:619:1197:-  ali  41  1..MMKDMTEIRWHGRGGQGAKTACLLLADAAFTAGKYVQGFPEYGPERMGAPITAYNRISEERCSIHSNIYEPDYVVVVDETLLEVDVTKGLNPEGAIVINSERSAAELRPMLRYEGRVYTIDARKVSEECLGKYFPNTPMLAAIVEVSRVLEPEQFIADMEASFRHKFKPQVVEGNMQCLKRAMKEVR... 191
30 1.000e-90T2D.2303771 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  41  1..MMKDMTEIRWHGRGGQGAKTACLLLADAAFTAGKYVQGFPEYGPERMGAPITAYNRISEERCSIHSNIYEPDYVVVVDETLLEVDVTKGLNPEGAIVINSERSAAELRPMLRYEGRVYTIDARKVSEECLGKYFPNTPMLAAIVEVSRVLEPEQFIADMEASFRHKFKPQVVEGNMQCLKRAMKEVR... 191
31 1.000e-90gi|306490885|gb|ADM95003.1| hypothetical protein [uncultured candidate division JS1 bacterium]  clstr ali  53  1...MKKIIEVRWHGRGGQGAVTASKLLATSALAEDKYIQAFPEYGPERMGAPIQSFTRISDEPIKIHCHVTNPDMVVVLDPTLITVDITEGLSEDGIIVVNTSESPAQIRKKLNLKGKIFTVDASKIALEELGRSLPNTPMIGALIRATGLLKLENVINDIKDKFSGKFSQKIVDGNVNAIKRAYQEVK... 188
32 1.000e-90METAHIT MH0006 GL0129383 [Lack 5`-end] locus=scaffold223479_1:38:667:-  ali  43  17..LMNDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTKPITIHSNIYEPDYVVVVDDTLIEVDVTAGLKKTGAVVINTTKDGEYLKKHLGYEGEIYKIDARKISMETLGKYFPNTPMLAAIVKVSKVMTDEEFLNDMQGSFKHKFKPEVIEGNMKALEMALKEVERV. 209
33 1.000e-90T2D.101295 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  43  17..LMNDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTKPITIHSNIYEPDYVVVVDDTLIEVDVTAGLKKTGAVVINTTKDGEYLKKHLGYEGEIYKIDARKISMETLGKYFPNTPMLAAIVKVSKVMTDEEFLNDMQGSFKHKFKPEVIEGNMKALEMALKEVERV. 209
34 1.000e-90METAHIT V1 GL0066660 [Complete] locus=scaffold14074_1:79:696:+  ali  46  13...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDCPITIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTTKDENYLKALHGYNGNIYTIDARKVSMETLGKYFPNTPMLAAIVKVSHIMSDEELLNDMEGSFKHKFKPEVIDGNMKALKMALNEVKKI. 204
35 1.000e-90T2D.2658490 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  46  13...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDCPITIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTTKDENYLKALHGYNGNIYTIDARKVSMETLGKYFPNTPMLAAIVKVSHIMSDEELLNDMEGSFKHKFKPEVIDGNMKALKMALNEVKKI. 204
36 1.000e-90JGI.Meta JGI_HUM.1274846 7068336955 C3457421__gene_272425 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  46  13...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDCPITIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTTKDENYLKALHGYNGNIYTIDARKVSMETLGKYFPNTPMLAAIVKVSHIMSDEELLNDMEGSFKHKFKPEVIDGNMKALKMALNEVKKI. 204
37 1.000e-90METAHIT MH0064 GL0095983 [Complete] locus=scaffold5611_1:8785:9366:+  ali  47  1...MSNLIEIRWHGRGGQGAKTASLLLADAAFNTGKFIQGFPEYGPERMGAPITAYNRISDEPITVHSNIYNPDYVVVVDDTLLEVDVTAGLKETGAIVINTTKDINYLSSVLGYKGKIYTIDARKVSMETLGRYFPNTPMLAAIVKVSNVMPEDAFIQDMEGSFKHKFKPEVIEGNMNALKLALKEIKV.. 191
38 1.000e-90T2D.1076465 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  47  1...MSNLIEIRWHGRGGQGAKTASLLLADAAFNTGKFIQGFPEYGPERMGAPITAYNRISDEPITVHSNIYNPDYVVVVDDTLLEVDVTAGLKETGAIVINTTKDINYLSSVLGYKGKIYTIDARKVSMETLGRYFPNTPMLAAIVKVSNVMPEDAFIQDMEGSFKHKFKPEVIEGNMNALKLALKEIKV.. 191
39 2.000e-90T2D.184081 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  44  1...MSELTEFRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYDRISDTEIRVHSNIYDPDYVVVVDETLLHVHVTEGLKEDGAILVNTAKTSDEIRPLLGYKGRVYTIDAREVCMKTLGKYFPNTPMLAAIVKISKIMEEEKFIQEMEASLSHKFKPEVLEGNMQALRLAMQEVRGDE 193
40 2.000e-90JGI.Meta JGI_HUM.0935767 7067716014 C3181304__gene_264991 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  44  1...MSELTEFRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYDRISDTEIRVHSNIYDPDYVVVVDETLLHVHVTEGLKEDGAILVNTAKTSDEIRPLLGYKGRVYTIDAREVCMKTLGKYFPNTPMLAAIVKISKIMEEEKFIQEMEASLSHKFKPEVLEGNMQALRLAMQEVRGDE 193
41 2.000e-90T2D.2969742 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  46  14..FMKEIFEIRWHGRGGQGAKTASLLLADAAFSGGMYVQGFPEYGPERMGAPITAYNRISKERVTVHSNIYEPDFVVVVDETLIEVDVTKGLKEDGAIIINSSKPASEFKALLGYKGRVYTCDARTISEETLGKNFPNTPMLGAVVKVSGVMEEKAFLEAMENSFAHKFKPEVLKGNMAALVRSMNEVKE.. 205
42 3.000e-90gi|497932453|ref|WP_010246609.1| pyruvate synthase [Acetivibrio cellulolyticus]  clstr ali  47  1...MGKVVEIRWHGRGGQGAKTASLLLADAAFNTGKFIQGFPEYGPERMGAPITAYNRISDEKLTIHSNIYEPDYVVVVDDTLISVDVTAGLKEDGAIIVNTTKSPEELKPLLGYKGKVCTIDARTISIDTLGKYFPNTPMLGAVVKVSRVMNEQEFLKDMVDSFKHKFKPEVVEGNIKALERSMQEVK... 190
43 3.000e-90T2D.3909153 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  47  1...MSNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDTPITIHSNIYEPDYVVVVDDTLLEVNVTAGLKKEGAIVINTTKSPDEVRLLKGYEGKVCTIDAKTISIDTLGKYFPNTPMLAAIVKVSGIMSDEEFLNDMIGSFKHKFKPEVIDGNMAALKRSLNEI.... 189
44 3.000e-90gi|548259839|ref|WP_022477133.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:273]  clstr ali  46  1...MNDMIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNTPIRIHSNIYEPDYVVVVDDTLLGVDVTAGLKPNGAIVINTTKDIDYLRKVLGYSGAIYTIDARKVSMETLGKYFPNTPMLAAIVKVANIMEENDFLKDMEGSFKHKFKPEVIDGNMKALEVALKEVKK.. 191
45 4.000e-90gi|546691781|ref|WP_021885309.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:590]  clstr ali  47  1...MKNTVEIRWHGRGGQGAKSAALMLADAAFMTGKHVQGFPEYGPERMGAPITAYNRISEDPIRVHSNIYDPDYVVVVDETLLEVDVTNGLNPEGAIVINTTKSVEEVKPHLGYPGKVYTLDAREISEKCLGRYFPNSPMLAAIVAISKVMTKEDFFREMEGSYKHKFKPEVIEGNLKALHMAYEEVE... 190
46 5.000e-90JGI.Meta JGI_HUM.3211426 7005598743 C2537626__gene_195209 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  47  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISETPIRVHSNIYEPDFVVVVDDSLLDVDVTKGLKPEGAILINTAASIDSIRKLNGFEGKIYTINASKISKECLKANFPNTAMLSAIIKITGIMTKEELLKDMEESFKHKFKPEVIEPNMEAIKRAYDEI.... 186
47 7.000e-90JGI.Meta JGI_HUM.2274104 7052105202 C3508723__gene_217263 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  44  4...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGKNVQGFPEYGPERMGAPITAYNRISSDEIRVHSNIYHPDYVVVVDETLLHVDVTAGLKEQGAIVVNTPKSPQEIAPLNGYKGKVYTVDARKISVETLGKNFPNSPMLAAIVAVSKVMDKDTFIREMKNSYQHKFKPEVIDGNMKALEVAYDAVIAHE 196
48 8.000e-90gi|491505842|ref|WP_005363495.1| pyruvate synthase [Eubacterium ventriosum]  clstr ali  48  20...MKDTLEIRWHGRGGQGAKTAALLLAEVAFKTGKNAQGFPEYGPERMGAPITAYDRISDQPIRVHSNIYDPQYVVVVDETLIEVDVTKGLREDGAILINTARPKEEIIPHLGYKGKVYTVDARKIAMETLGKNFPNTPMLAAIVKVTGVIDDETFLNEMEGSFKHKFKPEVIKGNMDALRIALREVK... 209
49 8.000e-90T2D.3085761 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  48  20...MKDTLEIRWHGRGGQGAKTAALLLAEVAFKTGKNAQGFPEYGPERMGAPITAYDRISDQPIRVHSNIYDPQYVVVVDETLIEVDVTKGLREDGAILINTARPKEEIIPHLGYKGKVYTVDARKIAMETLGKNFPNTPMLAAIVKVTGVIDDETFLNEMEGSFKHKFKPEVIKGNMDALRIALREVK... 209
50 8.000e-90gi|652499216|ref|WP_026893628.1| pyruvate synthase [Clostridiisalibacter paucivorans]  clstr ali  45  1..MSKEIVEIRWHGRGGQGAKTGSLLLAEAAFATGKYIQGFPEYGPERMGAPITAYNRISNEKIRLHSNIYEPDYVVVVDESLIDIDVTAGLKSEGAIVINSKKSPEEFRHLNGYKGKVYCIDAHQISMDTIGRYFPNTPMLGAIAKVINIMDGDTFLDAIEKAFQHKFKPNLIKGNMDAVKLAFEEVSRGE 194
51 8.000e-90gi|547242503|ref|WP_021978341.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:793]  clstr ali  46  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTSPIRVHSNIYEPDYVVVVDDTLLKVDVASGLKEDGAIVINTTKGIDEIAPLLGYKGSVYTIDARKVSEEALGKYFPNTPMLAAIVKVAGIMPEADFIKDMQDSFKHKFKPEVIDGNMKALKLALEQVKKIQ 193
52 8.000e-90JGI.Meta JGI_HUM.1505970 7054082021 C2709959__gene_253271 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  48  20...MKDTLEIRWHGRGGQGAKTAALLLAEVAFKTGKNAQGFPEYGPERMGAPITAYDRISDQPIRVHSNIYDPQYVVVVDETLIEVDVTKGLREDGAILINTARPKEEIPHLKGYKGKVYTVDARKIAMETLGKNFPNTPMLAAIVKVTGVIDDETFLNEMEGSFKHKFKPEVIKGNMDALRIALREVK... 209
53 9.000e-90gi|496289768|ref|WP_009001806.1| pyruvate synthase [Clostridium sp. D5]  clstr ali  44  1...MDNMIEIRWHGRGGQGAKTAAMLLAEAAFDTGKFIQGFPEYGPERMGAPVTAYNRISNERILVHSNIYEPDYVVVVDETLMDTDVTAGLKKEGALLINSPKSPAEIRKCGGYEGRIYTIDADRIAMETLGKNFPNTSMLSAVVKITKVEEEERFLESLQESFRHKFEHKMIEPNMQAAARAFREVKE.. 191
54 2.000e-89gi|548380033|ref|WP_022519295.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Roseburia sp. CAG:100]  clstr ali  45  1...MNKTVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEPITVHSNIYEPDYVVVVDESLLEIDVTKGLKKDGAVIINSERSKEELREHLGYEGAVYTVNAKQISLRTLGRNYPNSPMLAAAVAVSNVMERKEFLQEMRASFQHKFKPEVIDGNMQALELAFEEA.... 189
55 2.000e-89JGI.Meta JGI_HUM.1920544 7068664356 SRS015065_WUGC_scaffold_5919__gene_15853 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate fa  ali  45  1...MNKTVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEPITVHSNIYEPDYVVVVDESLLEIDVTKGLKKDGAVIINSERSKEELREHLGYEGAVYTVNAKQISLRTLGRNYPNSPMLAAAVAVSNVMERKEFLQEMRASFQHKFKPEVIDGNMQALELAFEEA.... 189
56 2.000e-89gi|547325714|ref|WP_022056723.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:167]  clstr ali  44  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGKNVQGFPEYGPERMGAPITAYNRISSDEIRVHSNIYHPDYVVVVDETLLHVDVTAGLKEQGAIVVNTPKSPQEIAPLNGYKGKVYTVDARKISVETLGKNFPNSPMLAAIVAVSKVMDKDTFIREMKNSYQHKFKPEVIDGNMKALEVAYDAVIAHE 193
57 2.000e-89METAHIT V1 GL0013317 [Complete] locus=scaffold52247_2:11251:11835:+  ali  44  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGKNVQGFPEYGPERMGAPITAYNRISSDEIRVHSNIYHPDYVVVVDETLLHVDVTAGLKEQGAIVVNTPKSPQEIAPLNGYKGKVYTVDARKISVETLGKNFPNSPMLAAIVAVSKVMDKDTFIREMKNSYQHKFKPEVIDGNMKALEVAYDAVIAHE 193
58 2.000e-89T2D.2151568 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  44  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGKNVQGFPEYGPERMGAPITAYNRISSDEIRVHSNIYHPDYVVVVDETLLHVDVTAGLKEQGAIVVNTPKSPQEIAPLNGYKGKVYTVDARKISVETLGKNFPNSPMLAAIVAVSKVMDKDTFIREMKNSYQHKFKPEVIDGNMKALEVAYDAVIAHE 193
59 2.000e-89gi|492554014|ref|WP_005884346.1| pyruvate synthase [Fusobacterium mortiferum]  clstr ali  47  1...MREIFEIRWHGRGGQGAKTASLLLADAAFSGGMYVQGFPEYGPERMGAPITAYNRISKNPVRVHSNIYEPDFVVVVDETLIEVDVTKGLKEDGAIIINSSKPASEVPFLKGYKGKVFTCDARTISEETLGKNFPNTPMLGAVVKVSGVMEEKAFLEAMEESFKHKFKPEVLKGNMDALIRSMNEVKE.. 191
60 2.000e-89METAHIT unmapped GL0079814 unmapped_[Complete]_[mRNA]_locus=scaffold214059_1:49:624:+  ali  47  1...MREIFEIRWHGRGGQGAKTASLLLADAAFSGGMYVQGFPEYGPERMGAPITAYNRISKNPVRVHSNIYEPDFVVVVDETLIEVDVTKGLKEDGAIIINSSKPASEVPFLKGYKGKVFTCDARTISEETLGKNFPNTPMLGAVVKVSGVMEEKAFLEAMEESFKHKFKPEVLKGNMDALIRSMNEVKE.. 191
61 3.000e-89gi|653227415|ref|WP_027439914.1| pyruvate synthase [Lachnospiraceae bacterium AC2031]  clstr ali  46  1...MSKAVEIRWHGRGGQGAKTAALLLADVAFNTGMYVQGFPEYGPERMGAPITAYNRISEKEIRNHSNIYNPDYVVVVDETLLHVDVTSGLNKDGGIVINTARPKEEIIPLLGYEGAVYTVDARTISLETLGKYFPNSPMLAAIVKVSGIMSKQDFLEQMRGSYQHKFKPEVIDGNMAALERAFEEVQ... 190
62 3.000e-89gi|493931494|ref|WP_006876067.1| pyruvate synthase [Anaerotruncus colihominis]  clstr ali  48  1...MKDIVEIRWHGRGGQGAKTASLLLADAAFNTGKYVQGFPEYGPERMGAPITAYNRISSERSTVHSNIYEPDYVVVVDETLISVDVTAGLKKEGAIVINSGKSPAQLRPLLGYAGRVFTIDAGRISEEELGKNFPNTPMLAAIVKVSGVVEPDAFVKDMEASFHHKFKPQVIEGNMRALKRSMEEVQ... 190
63 3.000e-89METAHIT V1 GL0128425 [Complete] locus=scaffold99318_1:7533:8108:+  ali  49  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDTPIRIHSNIYEPDYVVVVDDSLIAVDVTSGLKDNGAIVINTNEDIDSLRKKLGFSGKIYTIDASKISLECLKANFPNTAMLAAVVNITKIMSKEELVDNMKDAFSHKFKPEVIEPNMEALLRGYDEIK... 187
64 3.000e-89T2D.2210046 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  49  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDTPIRIHSNIYEPDYVVVVDDSLIAVDVTSGLKDNGAIVINTNEDIDSLRKKLGFSGKIYTIDASKISLECLKANFPNTAMLAAVVNITKIMSKEELVDNMKDAFSHKFKPEVIEPNMEALLRGYDEIK... 187
65 3.000e-89JGI.Meta JGI_HUM.1569042 7027027734 SRS016335_WUGC_scaffold_25731__gene_49688 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate f  ali  49  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDTPIRIHSNIYEPDYVVVVDDSLIAVDVTSGLKDNGAIVINTNEDIDSLRKKLGFSGKIYTIDASKISLECLKANFPNTAMLAAVVNITKIMSKEELVDNMKDAFSHKFKPEVIEPNMEALLRGYDEIK... 187
66 4.000e-89JGI.Meta JGI_HUM.4198331 7011748143 C1977199__gene_184467 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  49  8...MKDIVEIRWHGRGGQGAKTASLLLADAAFNTGKYVQGFPEYGPERMGAPITAYNRISSERSTVHSNIYFPDYVVVVDETLLSVDVTAGLKKEGAIVINSSKSPAELRPLLGYEGRVCTIDAGKISEEELGKNFPNTPMLAAIVRVSGVIGEEEFIKDMEGSFKHKFKPQVIEGNMRALKRSLEEVQV.. 198
67 6.000e-89METAHIT MH0067 GL0030712 [Complete] locus=scaffold40327_1:6741:7379:+  ali  47  20...MDNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGAERMGAPITAYNRISTAPIRIHCNIYNPDYVVVVDDTLLSVDVTSGLKESGAIIINTTKDGETLKRLLGYKGHIYTIDARTVSVEALGKYFPNTPMLAAVVKVTGIIPEEDFLKDMEGSFKHKFKPEVIEGNMKALEIALQKVIKVQ 212
68 6.000e-89T2D.3027663 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  49  1...MKDIVEIRWHGRGGQGAKTASLLLADAAFNTGKYVQGFPEYGPERMGAPITAYNRISSERSTVHSNIYFPDYVVVVDETLLSVDVTAGLKKEGAIVINSSKSPAELRPLLGYEGRVCTIDAGKISEEELGKNFPNTPMLAAIVRVSGVIGEEEFIKDMEGSFKHKFKPQVIEGNMRALKRSLEEVQV.. 191
69 7.000e-89gi|547892600|ref|WP_022297413.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:465]  clstr ali  48  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDTPIRIHSNIYEPDYVVVVDDSLIAVDVTSGLKDNGAIVINTNEDIDSLRKKLGFSGKIYTIDASKISLECLKANFPNTAMLAAVVNITKIMSKEELVDNMKDAFSHKFKPEVIEPNMEALLKGYDEIK... 187
70 7.000e-89METAHIT V1 GL0022008 [Lack 5`-end] locus=scaffold40168_2:3:611:+  ali  48  13...MKDTLEIRWHGRGGQGAKTAALLLAEVAFKTGKNAQGFPEYGPERMGAPITAYDRISDQPIRVHSNIYDPQYVVVGDETLIEVDVTKGLREDGAILINTARPKEEIIPHLGYKGKVYTVDARKIAMETLGKNFPNTPMLAAIVKVTGVIDDETFLNEMEGSFKHKFKPEVIKGNMDALRIALREVK... 202
71 8.000e-89METAHIT MH0035 GL0091539 [Complete] locus=scaffold21813_2:343:915:-  ali  44  1...MNKTVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEPITVHSNIYEPDYVVVVDESLLEIDVTKGLKREGAVIINSERSKEELRKHLGYEGSVYTVNAKQISMRTLGKNYPNSPMLAAAVAVSNVMERKAFLQEMRASFQHKFKPEVIDGNMQALELAFEEA.... 189
72 8.000e-89T2D.610645 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  44  1...MNKTVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEPITVHSNIYEPDYVVVVDESLLEIDVTKGLKREGAVIINSERSKEELRKHLGYEGSVYTVNAKQISMRTLGKNYPNSPMLAAAVAVSNVMERKAFLQEMRASFQHKFKPEVIDGNMQALELAFEEA.... 189
73 8.000e-89gi|653148965|ref|WP_027398137.1| pyruvate synthase [Anaerovorax odorimutans]  clstr ali  50  4....NNIVEIRWHGRGGQGAKTACLLLADVAFQSGKYVQGFPEYGPERMGAPITAYNRISEERCNIHSNIYGPDYVVVVDETLLSVDVTSGLKEDGAVIINSEKEPGELRHLLGYNGKIYTVDARKISEETLGRNFPNTPMLAAMVRVSNIIESEKFLEDMEKSFHHKFKPQVIEGNMKALRKSMEEV.... 191
74 9.000e-89JGI.Meta JGI_HUM.3273697 7058552834 SRS011529_WUGC_scaffold_22421__gene_43009 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate f  ali  44  7...MDNMIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTAPIRIHSNIYEPDYVVVVDDSLLEVPVTAGLKETGAIIINTTKDVNALKTLLGYKGNVYTIDARKVSIEALGKYFPNTPMLAAIVKVSNIMSEEEFLNDMEGSFKHKFKPEVIEGNMKALTLALKEVKLV. 198
75 1.000e-88JGI.Meta JGI_HUM.6005511 7040709644 SRS017433_Baylor_scaffold_13850__gene_34054 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate  ali  46  1...MREIFEIRWHGRGGQGAKTASLLLADAAFSGGMYVQGFPEYGPERMGAPITAYNRISKNPVRVHSNIYEPDFVVVVDETLIEVDVTKGLKEDGAIIINSSKPASEVPFLKGYKGKVFTCDARTISEETLGKNFPNTPMLGAVVKVSRVMEEKAFLEAMEESFKHKFKPEVLKGNMDALIRSMNEVKE.. 191
76 1.000e-88JGI.Meta JGI_HUM.2090737 7051348970 SRS020328_Baylor_scaffold_37703__gene_96245 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate  ali  50  1...MKEIVEIRWHGRGGQGAKTASLLLADAAFNTGRYVQGFPEYGPERMGAPITAYNRISRERCTVHSNIYEPDYVVVVDETLLAVDVTKGLSEEGAVIVNSDKKPEELRSLHGYQGKICTVDAGRISEETLGKNFPNTPMLGAVVKVSGVIPEENFVKDMRQSFAHKFKPQMIEGNMRALVKAMQEV.... 189
77 1.000e-88T2D.1153464 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  47  20...MDNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGAERMGAPITAYNRISTAPIRIHCNIYNPDYVVVVDDTLLSVDVTSGLKESGAIIINTTKDGETLKRLLGYKGHIYTIDARTVSVEALGKYFPNTPMLAAVVKVTGIIPEEDFLKDMEGSFKHKFKPEVIEGNMKALEIALQKVIKVQ 212
78 4.000e-88gi|490741693|ref|WP_004604001.1| pyruvate synthase [Eubacterium cellulosolvens]  clstr ali  47  1...MDNTLEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAFNRISKDPIRVHSNIYYPDYVVVVDETLLHVHVTDGLKDEGAIIVNTSKTEEEIRPLLGYTGRVVVIDARDISEKALGKNFPNTPMLAAAVAVSGVMPKDDFIANMRESFGHKFKPEVIDGNMKALEDAFKAV.... 189
79 4.000e-88METAHIT unmapped GL0524513 unmapped_[Complete]_[mRNA]_locus=scaffold331974_1:35:625:-  ali  46  6....NEAVEIRWHGRGGQGAKTACLLLADVAFSSGKHVQGFPEYGPERMGAPITAYNRITDEHCKVHSNIYKPDYVVVVDETLLSVDVTKGLKEKGALIINSKKSPEEIRPLLGYKGKVCTIDAEKISMDALGKNFPNTPMLGAVVKVSHVIDQERFIQDMKESFQHKFKENLIEGNMSALKKSMEEVKV.. 195
80 4.000e-88T2D.2370172 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  46  6....NEAVEIRWHGRGGQGAKTACLLLADVAFSSGKHVQGFPEYGPERMGAPITAYNRITDEHCKVHSNIYKPDYVVVVDETLLSVDVTKGLKEKGALIINSKKSPEEIRPLLGYKGKVCTIDAEKISMDALGKNFPNTPMLGAVVKVSHVIDQERFIQDMKESFQHKFKENLIEGNMSALKKSMEEVKV.. 195
81 4.000e-88JGI.Meta JGI_HUM.3047291 7036664199 C2357780__gene_221064 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  46  6....NEAVEIRWHGRGGQGAKTACLLLADVAFSSGKHVQGFPEYGPERMGAPITAYNRITDEHCKVHSNIYKPDYVVVVDETLLSVDVTKGLKEKGALIINSKKSPEEIRPLLGYKGKVCTIDAEKISMDALGKNFPNTPMLGAVVKVSHVIDQERFIQDMKESFQHKFKENLIEGNMSALKKSMEEVKV.. 195
82 5.000e-88JGI.Meta JGI_HUM.0222781 7004221420 C4227057__gene_292349 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  47  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPLTAYNRISETPIRIHSNIYEPDYVVVVDDTLISVNVTQGLKENGAILINTNKSIDEIKYFKDYKGKIYTIDASKISRECLKANYPNTAMLSAIVKITGIMTKDELLKDMEESFKHKFKPEVIAPNMEAVKRAFDEV.... 186
83 6.000e-88METAHIT unmapped GL0048677 unmapped_[Complete]_[mRNA]_locus=scaffold18464_1:2342:2920:+  ali  42  1...MKDLIEIRWHGRGGQGAKTAALLLADVAFNNGLYVQGFPEYGPERMGAPITAYNRLSRNPIRVHSNIYEPDYVVVVDESLIEVDVTAGIKEGGAIIINSHKSSNELKPLLGYHGHIYTIDARKISIETLGKYFPNSPMLAAVVKITGVMEEKAFLEDMRKSYAHKFKPSVIDGNMKALEIALKEV.... 191
84 6.000e-88T2D.2257056 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  42  1...MKDLIEIRWHGRGGQGAKTAALLLADVAFNNGLYVQGFPEYGPERMGAPITAYNRLSRNPIRVHSNIYEPDYVVVVDESLIEVDVTAGIKEGGAIIINSHKSSNELKPLLGYHGHIYTIDARKISIETLGKYFPNSPMLAAVVKITGVMEEKAFLEDMRKSYAHKFKPSVIDGNMKALEIALKEV.... 191
85 6.000e-88JGI.Meta JGI_HUM.2849249 7007474604 C2508008__gene_199589 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  42  1...MKDLIEIRWHGRGGQGAKTAALLLADVAFNNGLYVQGFPEYGPERMGAPITAYNRLSRNPIRVHSNIYEPDYVVVVDESLIEVDVTAGIKEGGAIIINSHKSSNELKPLLGYHGHIYTIDARKISIETLGKYFPNSPMLAAVVKITGVMEEKAFLEDMRKSYAHKFKPSVIDGNMKALEIALKEV.... 191
86 6.000e-88gi|548187700|ref|WP_022408615.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:354]  clstr ali  46  1...MNDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGAERMGAPITAYNRISTTPIRIHCNIYNPDYVVVVDDTLLHVDVTAGLKESGAIIINTTKDGETLKRLLGYKGHIYTIDARTVSIEALGKYFPNTPMLAAVVKVTGIIPEKDFLQDMEGSFKHKFKPEVIGGNMKALEIALQKVVKVQ 193
87 8.000e-88METAHIT V1 GL0016542 [Complete] locus=scaffold12834_3:20:598:-  ali  49  1...MKDIVEIRWHGRGGQGAKTASLLLADAAFNTGKYVQGFPEYGPERMGAPITAYNRISSERSTVHSNIYFPDYVVVVDETLLSVDVPAGLKKEGAIVINSSKSPAELRPLLGYEGRVCTIDAGKISEEELGKNFPNTPMLAAIVRVSGVIGEEEFIKDMEGSFKHKFKPQVIEGNMRALKRSLEEVQV.. 191
88 9.000e-88METAHIT V1 GL0029471 [Complete] locus=scaffold29499_17:520:1092:-  ali  46  1...MQNCVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISPAPIRVHSNIYHPDYVVVVDEGLLDVHVTEGLSEDGAILINTSRDKSELEKLHGYKGAVYTIDAKKVSKACLGKYFPNTPMLAGIVKVSGVMDWDEFYNEMRASFLHKFKPEVIDGNMNALKMAFDEVK... 190
89 9.000e-88T2D.1820182 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  46  1...MQNCVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISPAPIRVHSNIYHPDYVVVVDEGLLDVHVTEGLSEDGAILINTSRDKSELEKLHGYKGAVYTIDAKKVSKACLGKYFPNTPMLAGIVKVSGVMDWDEFYNEMRASFLHKFKPEVIDGNMNALKMAFDEVK... 190
90 1.000e-87gi|547728309|ref|WP_022142453.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:230]  clstr ali  43  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDKIRVHSNIYHPDYVVVVDETLLDVDVTAGLKVNGAIIINTAKSREEIEKHLGYTGRVYTIDARKISMETLGKNFPNSPMLAATVAVSEVMPREDFFREMRASYQHKFKPEVIDGNMQALEMAFEELEE.. 191
91 1.000e-87gi|551036943|ref|WP_022780690.1| pyruvate synthase [Lachnospiraceae bacterium NK4A136]  clstr ali  45  1...MSKLTEIRWHGRGGQGAKTAALLLADVCFKIGKNVQGFPEYGPERMGAPITAFDRISDNPIRVHSNIYEPDFVVVVDETLLHIDVTKGLKKDGAILINTDRKAEDLIPLNGYKGKVFTIDAREVCMKTLGKYFPNTPMLAAVVKITGLMEPERFLTEMEESLKHKFKPEVLEGNMKALKLALEEV.... 189
92 1.000e-87gi|553306669|ref|WP_023052085.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Cetobacterium somerae]  clstr ali  45  1...MSKMVEIRWHGRGGQGAKTASLLLADVAFSSGMYVQGFPEYGPERMGAPITAYNRIGNEPIRVHSNIYEPNFVVVVDETLIKIEVEKGLKEGGAIIVNSERSPEELRAELRYTGRLYTCNARKISEECLGKYFPNTPMLGAVVKVSELIPEAEFIKNMEESFKHKFKPQVLEGNMCALKRSMDEVE... 190
93 2.000e-87T2D.4179805 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  43  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDKIRVHSNIYHPDYVVVVDETLLDVDVTAGLKANGAIIINTAKSRAEIEKHLGYTGRVYTIDARKISMDTLGKNFPNSPMLAATVAVSEVMPREDFFREMRASYQHKFKPEVIDGNMQALEMAFEELEE.. 191
94 2.000e-87gi|503146430|ref|WP_013381091.1| pyruvate synthase [Eubacterium limosum]  clstr ali  44  1...MKDNLEIRWHGRGGQGAKTAALLLADVAFSTGMYVQGFPEYGPERMGAPITAYNRLSQSKIRVHSNIYEPDYVVVVDETLLEVDVTKGVSPEGAVIINTSKDKEIIKHLKGYTGRVFTIDARKVSIEALGKYFPNTPMLASIVKVSGVMENEAFLSEMRHSFEHKFKPEVIEGNMKALSLALQEVK... 190
95 2.000e-87gi|490169788|ref|WP_004068429.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase, gamma subunit [Clostridium sp. ASF502]  clstr ali  44  1...MRNLTEIRWHGRGGQGAKTAALLLADVAFQTGKYVQGFPEYGPERMGAPITAYNRISDQPIRVHSNIYDPQYVVVVDESLLEVDVTAGLKKDGAILINTRRTKEEILPHLGYEGEVYIIDAHKVSMATMGKYFPNTPMLAAIVKVAGIMEEETFLREMQASFSHKFKPEVIEGNMAALKMALQEVR... 190
96 2.000e-87gi|499179806|ref|WP_010877346.1| pyruvate ferredoxin oxidoreductase subunit gamma/delta [Methanothermobacter thermautotrophicus]  clstr ali  47  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYSQAFPFFGVERRGAPVMAFTRIDDSPVRRRYQVYNPDYVVVLDEGLVDVDVFSGLKDDGVVVLNKSGDF------QGGDVKVHTIDATGIALETLGRPIVNTVMLGAFAGVTGLVSIDSLIKIIKETFPGK----IGEKNAEAARMAYEEIEK.. 175
97 3.000e-87T2D.2834806 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  48  1...MNNGLEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEVIRVHSNIYTPGLVVVVDETLLHVDVTAGLKEDGAIIVNTPKSADEIKPLNGYQGKVYTVDARKISVQALGKYFPNSPMLAAAVAVSGIMKKDAFISEMRASYQHKFKPEVIDGNMQALELTYEELKDV. 192
98 3.000e-87JGI.Meta JGI_HUM.1577479 7027075670 SRS016335_WUGC_scaffold_45747__gene_97624 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate f  ali  46  1...MNDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGAERMGAPITAYNRISTTPIRIHCNIYNPDYVVVVDDTLLSVDVTAGLKESGAIIINTTKDGETLKRLLGYKGHIYTIDARTVSIEALGKYFPNTPMLAAVVKVTGIIPEKEFLQDMEGSFKHKFKPEVIGGNMKALEIALQRVVEIQ 193
99 3.000e-87gi|645065613|ref|WP_025436744.1| pyruvate synthase [Eubacterium acidaminophilum]  clstr ali  48  1......MLEIRWHGRGGQGAKTASLLLADVAFNTGKYVQGFPEYGPERMGAPITAYNRISDEKITIHSNIYEPDFVVVVDESLLEVDVTKGIKEGGAILINTDKNAEEIKSLKGFNGTIYTIDARAISEKCLGRYFPNTPMLAAAVKICGIMEDEAFLREMQGSFEHKFKPEVIEGNMNALKMAIAEV.... 186
100 4.000e-87gi|547261972|ref|WP_021996672.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:780]  clstr ali  45  1...MNDLVEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPIVIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTVRDADYLKSVLGYNGGIYCIDARKISEEALGKYFPNTPMLAAIVKVAGIMNDEDFLADMQGSFKHKFKPEVIEGNMKALEMALQEIKKI. 192
101 4.000e-87gi|495666227|ref|WP_008390806.1| pyruvate synthase [Clostridium sp. SS2/1]  clstr ali  47  1...MNNGLEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDKVIRVHSNIYTPGLVVVVDETLLHVDVTAGLKEDGAIIVNTPKSADEIKPLNGYQGKVYTVDARKISVQALGKYFPNSPMLAAAVAVSGIMKKDAFISEMRASYQHKFKPEVIDGNMQALELTYEELKDV. 192
102 4.000e-87JGI.Meta JGI_HUM.1825840 7014911943 SRS050422_LANL_scaffold_94323__gene_176623 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate  ali  47  1...MNNGLEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEVIRVHSNIYTPGLVVVVDETLLHVDVTAGLKEDGAIIVNTPKSADEIKPLNGYQGKVYTVDARKISVQALGKYFPNSPMLAAAVAVSGVMKKDAFISEMRASYQHKFKPEVIDGNMQALELTYEELKDV. 192
103 4.000e-87METAHIT V1 GL0087878 [Complete] locus=scaffold89761_1:690:1271:-  ali  47  1...MNNGLEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEVIRVHSNIYTPGLVVVVDETLLHVDVTAGLKEDGAIIVNTPKSADEIKPLNGYQGKVYTVDARKISIQALGKYFPNSPMLAAAVAVSGVMKKDAFISEMRASYQHKFKPEVIDGNMQALELTYEELKDV. 192
104 4.000e-87JGI.Meta JGI_HUM.4907754 7019946776 SRS048870_WUGC_scaffold_19168__gene_31810 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate f  ali  45  1...MNDLVEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPIVIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTVRDADYLKSVLGYNGGIYCIDARKISEEALGKYFPNTPMLAAIVKVAGIMNDEDFLADMQGSFKHKFKPEVIEGNVKALEMALQEVKKI. 192
105 5.000e-87gi|547250035|ref|WP_021985671.1| putative uncharacterized protein [Clostridium sp. CAG:127]  clstr ali  45  1...MKKNIEIRWHGRGGQGAKTAALLLADVAFNTGMHVQGFPEYGPERMGAPITAYNRIGESEIRVHSNIYHPDYVVVVDETLLHVDVTNGLKEDGAIVINTPRPKEEILPLLGYKGSVYTIDAHKVSMETLGKYFPNSPMLAAIVKVADIMDKDVFLSQMQASYEHKFKPEVIDGNMRALKMAFEEVK... 190
106 5.000e-87gi|547282151|ref|WP_022015523.1| pyruvate ferredoxin oxidoreductase gamma subunit [Clostridium sp. CAG:122]  clstr ali  43  1...MNNGIEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAYNRISEDKIRIHSNIYTPDYVVVVDETLLDVDVTAGLKKDGAIIINTPKSRDEIKKLNGYEGKVYTVDARHISVKTLGKNFPNSPMLAAVVAVSNVMPRDTFIREMRASYQHKFKPEVIDGNMEALEMTFD...... 187
107 6.000e-87METAHIT MH0073 GL0097987 [Complete] locus=scaffold23130_2:2278:2883:+  ali  43  1...MNNGIEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAYNRISEDKIRIHSNIYTPDYVVVVDETLLDVDVTAGLKKDGAIIINTPKSRDEIKKLNGYEGKVYTVDARHISVKTLGKNFPNSPMLAAVVAVSNVMPRDTFIREMRASYQHKFKPEVIDGNMEALEMTFD...... 187
108 6.000e-87T2D.1248742 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  43  1...MNNGIEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAYNRISEDKIRIHSNIYTPDYVVVVDETLLDVDVTAGLKKDGAIIINTPKSRDEIKKLNGYEGKVYTVDARHISVKTLGKNFPNSPMLAAVVAVSNVMPRDTFIREMRASYQHKFKPEVIDGNMEALEMTFD...... 187
109 7.000e-87T2D.2680910 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  45  14...MKKNIEIRWHGRGGQGAKTAALLLADVAFNTGMHVQGFPEYGPERMGAPITAYNRIGESEIRVHSNIYHPDYVVVVDETLLHVDVTNGLKEDGAIVINTPRPKEEILPLLGYKGSVYTIDAHKVSMETLGKYFPNSPMLAAIVKVADIMDKDVFLSQMQASYEHKFKPEVIDGNMRALKMAFEEVK... 203
110 7.000e-87JGI.Meta JGI_HUM.0247313 7004276787 C4265882__gene_347716 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  45  8...MKKNIEIRWHGRGGQGAKTAALLLADVAFNTGMHVQGFPEYGPERMGAPITAYNRIGESEIRVHSNIYHPDYVVVVDETLLHVDVTNGLKEDGAIVINTPRPKEEILPLLGYKGSVYTIDAHKVSMETLGKYFPNSPMLAAIVKVADIMDKDVFLSQMQASYEHKFKPEVIDGNMRALKMAFEEVK... 197
111 1.000e-86METAHIT V1 GL0069366 [Complete] locus=scaffold76268_1:269:862:+  ali  45  8...MKKNIEIRWHGRGGQGAKTAALLLADVAFNTGMHVQGFPEYGPERMGAPITAYNRIGESEIRVHSNIYHPDYVVVVDETLLHVDVTNGLKEDGAIVINTPRPKEEILPLLGYKGSVYTIDAHKVSIETLGKYFPNSPMLAAIVKVADIMDKDVFLSQMQASYEHKFKPEVIDGNMRALKMAFEEVK... 197
112 1.000e-86gi|652836142|ref|WP_027118816.1| pyruvate synthase [Lachnospiraceae bacterium YSB2008]  clstr ali  47  1...MRKHIEIRWHGRGGQGAKTAALLLADVAWSTGMYVQGFPEYGPERMGAPITAYNRIGDTEIRAHSNIYYPDYVVVVDETLLHVDVTKGLSKDGGILINTEKSKEEISLLNGYEGKVYTIDARKISMETLGKYFPNSPMLAGIVKVANIMEKDEFLSQMEASYQHKFKPEVIEGNMQALRRAFEEVQ... 190
113 1.000e-86JGI.Meta JGI_HUM.1405165 7016948985 SRS052697_LANL_scaffold_73088__gene_156732 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate  ali  43  1...MNNGIEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAYNRISEDKIRIHSNIYTPDYVVVVDETLLDVDVTAGLKKDGAIVINTPKSRDEIKKLKGYEGRVYTVDARHISVKTLGKNFPNSPMLAAVVAVSNVMPRDTFIREMRASYQHKFKPEVIDGNMEALEMTFD...... 187
114 1.000e-86METAHIT MH0012 GL0289442 [Complete] locus=scaffold151113_1:654:1235:-  ali  46  1...MNDLIEIRWHGRGGQGAKTACLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSAIYEPNYVVVVDDTLLDVDVTAGLKEDGAIVINTTNDAETLKKKLGYKGGIYTIDARSISIDALGKYFPNTPMLAAIVKVSGVIPEDQFLADMEGSFKHKFKPEVIDGNMKALKNTLEKVNKIQ 193
115 1.000e-86T2D.307054 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  46  1...MNDLIEIRWHGRGGQGAKTACLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSAIYEPNYVVVVDDTLLDVDVTAGLKEDGAIVINTTNDAETLKKKLGYKGGIYTIDARSISIDALGKYFPNTPMLAAIVKVSGVIPEDQFLADMEGSFKHKFKPEVIDGNMKALKNTLEKVNKIQ 193
116 1.000e-86JGI.Meta JGI_HUM.1242504 7068076096 SRS015782_WUGC_scaffold_5202__gene_11566 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate fa  ali  46  1...MNDLIEIRWHGRGGQGAKTACLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSAIYEPNYVVVVDDTLLDVDVTAGLKEDGAIVINTTNDAETLKKKLGYKGGIYTIDARSISIDALGKYFPNTPMLAAIVKVSGVIPEDQFLADMEGSFKHKFKPEVIDGNMKALKNTLEKVNKIQ 193
117 2.000e-86gi|618852160|gb|KAJ51395.1| pyruvate synthase subunit porC [Clostridium tetanomorphum DSM 665]  clstr ali  49  1..MKKKLIEIRWHGRGGQGAKTASLLLAEVAFNTGMYIQGFPEYGPERMGAPITAYNRIANYPLRVHSNIYEPDYVVVVDETLLKVDCTAGLKGDGAIVINTKKSPEGIRKELRYEGKVYTIDARTISEQTLGANFPNTPMLAAIVKILGIMDKEEFIKDMEKSFKHKFKPNVIAKNIEALKRGLQEVKGLE 194
118 2.000e-86gi|653208452|ref|WP_027424948.1| pyruvate synthase [Lachnospiraceae bacterium NC2004]  clstr ali  42  1...MKDTVEIRWHGRGGQGAKTAALLLADVCFKHGKNVQGFPEYGPERMGAPITAYNRISDKKLRVHSNIYDPDYVVVVDETLLEIDVTAGLNPEGAIVINTTRPKEEIIPHLGYEGKVYTLDARKISEEALGKYFPNSPMLAAIVAVSKVMEKDEFMTQMRDSYQHKFKPEVIDGNMKALEMAFTEV.... 189
119 2.000e-86METAHIT V1 GL0093698 [Complete] locus=scaffold8233_8:8447:9076:-  ali  45  9...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDTIRVHSNIYHPDYVVVVDETLLSVDVTAGLKKTGAIIINTPKSKEEVMDELGYEGRVYTVDARKISVETLGKNFPNSPMLAAAVAVSDIMPRDKFIHEMRASYEHKFKPEVIDGNMKALERAYDVVEEA. 200
120 2.000e-86T2D.1798775 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  45  9...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDTIRVHSNIYHPDYVVVVDETLLSVDVTAGLKKTGAIIINTPKSKEEVMDELGYEGRVYTVDARKISVETLGKNFPNSPMLAAAVAVSDIMPRDKFIHEMRASYEHKFKPEVIDGNMKALERAYDVVEEA. 200
121 2.000e-86gi|571052250|gb|AHF25916.1| pyruvate synthase subunit PorC [uncultured bacterium Contigcl_1539]  clstr ali  44  1...MNIM-EIRWHGRGGQGAKTASLLLADAAFMAGKYVQSFPEYGPERSGAPITAYNRISDERCSIHSNIYEPDYVVVVDETLLEVDVTAGLKEEGGIVINSAKSAAELKPLLGYQGKVYTVDAGTISRKHLGDYFPNTPMLAAIVAISGCVEKETFLKDMEEAYTHKFKPQVIKGNLDCLAEAMQAVRE.. 190
122 2.000e-86gi|547210314|ref|WP_021950957.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:678]  clstr ali  45  1...MQNCVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISTDPIRVHSNIYDPDFVVVVDEGLLDVHVTDGLSENGAILINTAKDKSEIEKLHGYKGAVYTIDAKKVSKACLGRYFPNTPMLAGIVKVSGVMEWDDFYNEMRASFMHKFKPEVIDGNMNALKMAFDEVR... 190
123 3.000e-86gi|547471567|ref|WP_022090269.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:492]  clstr ali  46  1...MNDLIEIRWHGRGGQGAKTACLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSAIYEPNYVVVVDDTLLDVDVTAGLKEDGAIVINTTNDAKTLKKKLGYKGGIYTIDARSISIDALGKYFPNTPMLAAIVKVSGVIPEEQFLADMEGSFKHKFKPEVIDGNMKALKNTLEKVNKIQ 193
124 3.000e-86gi|516898213|ref|WP_018154510.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanothermococcus thermolithotrophicus]  clstr ali  43  1......MIEIRFHGRGGQGAVTAAQILAKAAFFDGKFCQAFPFFGVERRGAPVMAFTRIDDRKIRLRSQIYKPDYVVVQDPTLLDVDVTSGLKKGGKLIINT------LKDVKMDDYEVYPIDATGISLEVLGLPIVNTTMLGAFAGATNEVTLESLKKAILETFPGK----LGQKNAEAAEVAYNRIK... 174
125 3.000e-86gi|490986969|ref|WP_004848702.1| pyruvate synthase [Coprococcus eutactus]  clstr ali  45  15....KDTIEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISSEPIRVHSNIYEPQYVVVVDESLIEVHVTAGLAEDGAIIINTPKTPDEVRPLLGYKGRVYTLDAKEISLKTLGKNFPNSPMLAAIVAVSGIMEEGPFLEDMRQSYQHKFKPEVIEGNMEALKLAFREVMK.. 204
126 3.000e-86JGI.Meta JGI_HUM.1228770 7038094104 C3329961__gene_277855 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  45  15....KDTIEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISSEPIRVHSNIYDPQYVVVVDESLIEVHVTAGLAEDGAIIINTPKTPDEVRPLLGYKGRVYTLDAKDISLKTLGKNFPNSPMLAAIVAVSGIMEEGPFLEDMRQSYQHKFKPEVIEGNMEALKLAFREVMK.. 204
127 3.000e-86gi|557699355|ref|WP_023439536.1| pyruvate synthase subunit porC [Clostridium tetani]  clstr ali  48  1..MDKKLMEIRWHGRGGQGAKTASLLLAEAAFNAGMYIQGFPEYGPERMGAPITAYNRISNFPLRVHSNIYEPDYVVVVDETLLKTGVTKGLKKEGGIIVNTKKTPDEIRKELGYEGKVYTVNARKISEEALGAYFPNTPMLGSIVRVTNIIDIDKFIGDMEGSFKHKFKPHFIPKNMEALKRGIQEVSGIE 194
128 4.000e-86gi|491630860|ref|WP_005488398.1| Pyruvate:ferredoxin oxidoreductase, gamma subunit [Halanaerobium saccharolyticum]  clstr ali  53  1......MMQIRWHGRGGQGAKTASLLLADAAFSTGKYVQGFPEYGPERMGAPITAYNRISDDKIRVHSNIYKPDYVVVVDETLLEVDVTAGLKEEGAIVVNTAKDGEKIRKKLGYEGELFTVDAREISMATIGRYFPNTPMLSALVKVAGIMEEEDFVTEMEKLFKKKFKPEVIDGNVEAVKKALKEVNAH. 189
129 4.000e-86gi|491472799|ref|WP_005330552.1| pyruvate synthase [Dorea formicigenerans]  clstr ali  46  1...MSNHTEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEVIRVHSNIYDPEFVVVVDESLLEVDVTAGLKKEGAILVNTARPKEEIIPHLGYEGKLYTIDAHKVSMEAMGRYFPNTPLLAAIVKVANIMDEETFLREMQASFKHKFKPEVIDGNMKALEMALKEVK... 190
130 4.000e-86METAHIT V1 GL0028706 [Lack 5`-end] locus=scaffold106782_2:1132:1731:-  ali  45  8....ENLVEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPIVIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTVKDADYLKKLKGYKGGIYCIDARKVSEEALGRYFPNTPMLAAIVKVANIMDEKDFLNDMKGSFKHKFKPEVIEGNMKALEMALNEVKKI. 198
131 4.000e-86T2D.2174313 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  45  8....ENLVEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPIVIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTVKDADYLKKLKGYKGGIYCIDARKVSEEALGRYFPNTPMLAAIVKVANIMDEKDFLNDMKGSFKHKFKPEVIEGNMKALEMALNEVKKI. 198
132 5.000e-86gi|547903150|ref|WP_022306621.1| pyruvate/2-ketoisovalerate family acceptor oxidoreductase [Roseburia sp. CAG:380]  clstr ali  44  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDKIRVHSNIYHPDYVVVVDETLLSVDVTAGLKKTGAIIINTPKSREEVMDELGYEGRVYTVDARKISVETLGKNFPNSPMLAAAVAVSDIMPREKFIHEMRASYQHKFKPEVIEGNMKALECAYDVVEAA. 192
133 5.000e-86METAHIT O2 GL0003449 [Complete] locus=scaffold2518_1:171:785:-  ali  45  15....KDTIEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISSEPIRVHSNIYDPQYVVVVDESLIEVHVTAGLAEDGAIIINTPKTPDEVRPLLGYKGRVYTLDAKEISLKTLGKNFPNSPMLAAIVAVSGIMEEGPFLEDMRQSYQHKFKPEVIEGNMEALKLAFREVMK.. 204
134 5.000e-86T2D.1741630 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  45  15....KDTIEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISSEPIRVHSNIYDPQYVVVVDESLIEVHVTAGLAEDGAIIINTPKTPDEVRPLLGYKGRVYTLDAKEISLKTLGKNFPNSPMLAAIVAVSGIMEEGPFLEDMRQSYQHKFKPEVIEGNMEALKLAFREVMK.. 204
135 8.000e-86gi|652814460|ref|WP_027105853.1| pyruvate synthase [Lachnospiraceae bacterium V9D3004]  clstr ali  46  1...MEKTVEIRWHGRGGQGAKTAALLLADVSFKAGKYVQGFPEYGPERMGAPITAYNRISDNKITVHSNIYDPDYVVVVDEGLLDIDVTAGLSPEGAIVINSAKKPEELASKLRYTGKIYTVDARKISVEALGKYFPNSPMLAAIVAVSGVMDRDQFLNEMEASYRHKFKPEVIEGNMNALRMTFEEV.... 189
136 8.000e-86JGI.Meta JGI_HUM.0427106 7049120526 C5190418__gene_356523 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  45  1...MSNHTEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEVIRVHSNIYDPEFVVVVDESLLEVDVTAGLKKEGAILVNTARPKEEIIPHLGYEGKLYTIDAHKVSMEAMGKYFPNTPLLAAIVKVANIMDEETFLREMQASFKHKFKPEVIDGNMKALEMALKEVK... 190
137 1.000e-85gi|511048272|ref|WP_016302159.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase, gamma subunit [Lachnospiraceae bacterium COE1]  clstr ali  44  1...MKDTVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISSEPITVHSNIYEPDYVVVVDESLLEIDVTKGLSKNGAVIINSEHTKEELAPLHGYEGAVYTVDAKEISIKALGKNYPNSPMLAATVAVSGIMDKDAFLGEMRALFEHKFKPEVIDGNMQALEMAFQEA.... 189
138 2.000e-85gi|499960049|ref|WP_011640783.1| pyruvate synthase [Syntrophomonas wolfei]  clstr ali  43  4....NNMVEIRWHGRGGQGAKMACLLLADVAGLEGKFVQGFPEYGPERMGAPITAYNRISEKRCTIHSNIYYPDYVVVVDETLLDVDVTGGLKDGGAIIINTPSSPQEIRPLQGWTGKVCTVDARRISEDVLGTNFPNTPMLAAAVKVSGVLETERFLANIEESFKHKFKPQLIEGNMATLKKSMEEVQ... 192
139 2.000e-85gi|517059510|ref|WP_018248328.1| pyruvate synthase [Orenia marismortui]  clstr ali  46  1...MSDLIEIRWHGRGGQGSKTASILLGKVAAKTGKNIQAFPEYGPERMGAPVLAYNRISDKEITVHCQVTEPDIVSVLDPTLLDVDVTEGVPDNGVIIVNTEISASKLRDKIGFNGELYTVDAYGISTEEIGAPFPNTPMLGALIKATDLLDFEGFLSEMKNEFEKKFKPEVIEGNINSMKRAYQEVK... 189
140 2.000e-85gi|547303460|ref|WP_022035698.1| pyruvate ferredoxin oxidoreductase gamma subunit [Roseburia sp. CAG:50]  clstr ali  43  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYNRISSDVIRVHSNIYDPDFVAVVDETLLHVDVTAGLKKEGAIIVNTAKSKEEIMPLNGYEGRVVTIDARTISEEALGKYFPNSPMLAAVVATTGVMPKETFLHEMRASYKHKFKPEVIDGNMKALEMAFAAVEEA. 192
141 2.000e-85METAHIT unmapped GL0311727 unmapped_[Complete]_[mRNA]_locus=scaffold179434_2:266:844:+  ali  43  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYNRISSDVIRVHSNIYDPDFVAVVDETLLHVDVTAGLKKEGAIIVNTAKSKEEIMPLNGYEGRVVTIDARTISEEALGKYFPNSPMLAAVVATTGVMPKETFLHEMRASYKHKFKPEVIDGNMKALEMAFAAVEEA. 192
142 2.000e-85T2D.2319690 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  43  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYNRISSDVIRVHSNIYDPDFVAVVDETLLHVDVTAGLKKEGAIIVNTAKSKEEIMPLNGYEGRVVTIDARTISEEALGKYFPNSPMLAAVVATTGVMPKETFLHEMRASYKHKFKPEVIDGNMKALEMAFAAVEEA. 192
143 2.000e-85JGI.Meta JGI_HUM.0220665 7004215512 C4221464__gene_286441 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  43  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYNRISSDVIRVHSNIYDPDFVAVVDETLLHVDVTAGLKKEGAIIVNTAKSKEEIMPLNGYEGRVVTIDARTISEEALGKYFPNSPMLAAVVATTGVMPKETFLHEMRASYKHKFKPEVIDGNMKALEMAFAAVEEA. 192
144 3.000e-85gi|503042057|ref|WP_013277033.1| pyruvate synthase [Acetohalobium arabaticum]  clstr ali  48  1...MANLTEIRWHGRGGQGAKTASILLGKVASKTGKNIQAFPEYGPERMGAPVLAFNRISDEELTVHCQVTEPSIVTVLDPTLLEVDVTEGIPADGKIIINTTKSPTDVKKELDFEGEVYTVDADGISTDEIGAAFPNTPMLGALVKVTDLLEFDNFKEQVEKEFKKKFKPEVIDGNMKSIERAYQEVK... 189
145 3.000e-85gi|501539343|ref|WP_012544830.1| pyruvate synthase [Coprothermobacter proteolyticus]  clstr ali  56  1...MTVLLEIRWHGRAGQGVKTAAYLLAEAAMDTGKYIQAFPEYGAERSGAPIAAFTRIGDEPIRIHYGIRTPDVVVVVDESLIAMDVTSGLKENGILLVNSNQSPEIYRKLPSFHGKIATVDATQIALDCIGRPIPNIPIMGALIRASGIVSLEDLEPRLRHKFSAKFSEQVVEGNVKALKRGYEEVK... 188
146 4.000e-85gi|547200714|ref|WP_021941841.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:632]  clstr ali  45  1...MSHTIEIRWHGRGGQGAKTAALLLADVAFKTGMHVQGFPEYGPERMGAPITAYNRISDAPIRVHSNIYTPQYVAVVDETLLEVDVTAGLREDGAIIVNTSRPKEILPHLKGYKGSVYTVDAHKISMATLGKYYPNSPMLAAVVAITKVMEPEAFLREMELSFQHKFKPEVIAGNMEALRMTFKEVQ... 190
147 4.000e-85METAHIT MH0065 GL0088479 [Complete] locus=scaffold111416_1:2484:3056:-  ali  45  1...MSHTIEIRWHGRGGQGAKTAALLLADVAFKTGMHVQGFPEYGPERMGAPITAYNRISDAPIRVHSNIYTPQYVAVVDETLLEVDVTAGLREDGAIIVNTSRPKEILPHLKGYKGSVYTVDAHKISMATLGKYYPNSPMLAAVVAITKVMEPEAFLREMELSFQHKFKPEVIAGNMEALRMTFKEVQ... 190
148 4.000e-85T2D.1119968 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  45  1...MSHTIEIRWHGRGGQGAKTAALLLADVAFKTGMHVQGFPEYGPERMGAPITAYNRISDAPIRVHSNIYTPQYVAVVDETLLEVDVTAGLREDGAIIVNTSRPKEILPHLKGYKGSVYTVDAHKISMATLGKYYPNSPMLAAVVAITKVMEPEAFLREMELSFQHKFKPEVIAGNMEALRMTFKEVQ... 190
149 6.000e-85T2D.3518144 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  26...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPAYGPEQRGGTANVTVIVSDEKI-SSPILSKYDAAIILNQPSLEK-FESKVKTGGILIYDG---YGIINPPTRKDIKVYRIDAMDAANEMNNAKAFNMIVLGGLLKLKPMVTLDSVLRGLKKTLPERH-HHLIPMNEEAIKKGMELIKEV. 205
150 1.000e-84gi|494109016|ref|WP_007049800.1| pyruvate synthase [Anaerofustis stercorihominis]  clstr ali  43  1...MNDCVEIRWHGRGGQGAKTAALLLADVAFQTGKYVQGFPEYGPERMGAPITAYNRISDKPVRVHSNIYTPQFVVVVDESLLSVDVTKGLREDGAIVINTTKEKEDIKHLLNYKGDIYTIDAKKVSIACLGKYFPNSPMLAAIVKVSNIMDEKLFLSEMKSSFEHKFKPEVVNGNMKALKMALKEVR... 190
151 1.000e-84gi|548146543|ref|WP_022384285.1| 2-oxoglutarate ferredoxin oxidoreductase gamma subunit [Bacteroides sp. CAG:462]  clstr ali  25  2.....KTEEIIISGFGGQGVLSMGKILAYSALMEGKEVTWMPAYGPEQRGGTANVTVIISDERI-SSPILSTYDTAIILNQPSMAK-FESKVKPGGTIIYDG---YGISQPPTRKDIKVYRIDAMDAAAEMNNMKAFNMIVLGGLLKLRPMVSIESVLKGLRKTLPERH-HHLIPMNEEAIRKGMEIIREHE 182
152 1.000e-84gi|503565409|ref|WP_013799485.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanotorris igneus]  clstr ali  45  1......MIEIRFHGRGGQGAVTAAQILAKAAFYDGKYCQAFPFFGVERRGAPVMAFTRIDDKKIRLRCQIYEPDYVVVQDATLLDVDVTSGLKNDGKVIINT------VKDIKLGDYDTYCIDATGIALDVLGVPIVNTTMLGAFAGVTGEVSIESLKKAIMETFPAK----LGEKNAKAAEVAYEAM.... 173
153 1.000e-84gi|502865756|ref|WP_013100732.1| pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Methanocaldococcus infernus]  clstr ali  47  1......MIEIRFHGRGGQGAVTAAQILAKAAFYDGKYCQAFPFFGVERRGAPVRAFTRIDDKEILIRSQIYEPDYVVVLDPTLLDVNVLEGLKKDGAVIVNTVKDLD-------LGYKVYTLDATKIALDVLGVPIVNTSMVGAFAGATKLVSLESVKKAILETF----KGKLGEKNALAAEKAYNEI.... 172
154 2.000e-84JGI.Meta JGI_HUM.0050509 7030175727 C7119965__gene_310485 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Supragi  ali  28  14..FMK--TEIIIAGFGGQGVLSMGKILAYSGLLENKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPILSKYDVAIVLNQPSLDK-FMPKLKPGGILIYDG---FGIVNPPQRDDIRIYRVDAMDKAAEMKNAKVFNMIVLGALLKVCPIVSTDGLQKALYKTLPERH-HGLIPLNMQAVEEGMKLVNE.. 193
155 2.000e-84gi|548064186|ref|WP_022377269.1| 2-oxoacid:acceptor oxidoreductase gamma subunit pyruvate/2-ketoisovalerate family [Clostridium sp. CAG:62]  clstr ali  44  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDVIRVHSNIYHPDYVVVVDETLLDVDVTAGLKETGAIIINTPKKREDIPKLNGYKGRVYAIDARHISVETLGKNFPNSPMLAATVAVSEVMEKETFIHEMRASYEHKFKPEVIDGNMEALERAFDVV.... 189
156 2.000e-84METAHIT MH0014 GL0075525 [Complete] locus=scaffold31536_3:8665:9270:+  ali  44  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDVIRVHSNIYHPDYVVVVDETLLDVDVTAGLKETGAIIINTPKKREDIPKLNGYKGRVYAIDARHISVETLGKNFPNSPMLAATVAVSEVMEKETFIHEMRASYEHKFKPEVIDGNMEALERAFDVV.... 189
157 2.000e-84T2D.352728 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  44  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDVIRVHSNIYHPDYVVVVDETLLDVDVTAGLKETGAIIINTPKKREDIPKLNGYKGRVYAIDARHISVETLGKNFPNSPMLAATVAVSEVMEKETFIHEMRASYEHKFKPEVIDGNMEALERAFDVV.... 189
158 2.000e-84JGI.Meta JGI_HUM.0423156 7049113521 C5187580__gene_349518 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  44  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDVIRVHSNIYHPDYVVVVDETLLDVDVTAGLKETGAIIINTPKKREDIPKLNGYKGRVYAIDARHISVETLGKNFPNSPMLAATVAVSEVMEKETFIHEMRASYEHKFKPEVIDGNMEALERAFDVV.... 189
159 3.000e-84gi|492690206|ref|WP_005923688.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Bacteroides]  clstr ali  27  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEKI-SSPILSKYDTAIILNQPSLEK-FESRIKPGGILIYDG---YGIINPPTRKDIKVYRIDAMDAANEMKNAKAFNMIVLGGLLKLRPIVTLENVIKGLKKTLPERH-HHLIPMNEEAIKKGMELIKELK 181
160 3.000e-84gi|500041927|ref|WP_011722645.1| pyruvate synthase [Clostridium novyi]  clstr ali  46  1..MDKKLIEIRWHGRGGQGAKTASLLLAEVAFNTGMYIQGFPEYGPERMGAPITAYNRIANFPLRVHSNIYEPDFVVVVDESLLSVNCVAGLKKEGAIIINTKKSIDEIRKELGYEGKVYTIDARTISEETLGAYFPNTPMLAAIVKVLGIMDLDEFIEDMKDSFKHKFKPQVISKNMNALKRSLQEVNGIE 194
161 4.000e-84METAHIT V1 GL0031243 [Lack 3`-end] locus=scaffold64815_1:2660:3166:+  ali  44  1...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDKPITIHSNIYEPDYVVVVDDTLLTVPVTAGLKKEGAIVINTTKKPEELKELLGYDGSVYTIDARKVSEEALGRYFPNTPMLAAIVKVAGVMTDEELLEDMKTSFKHKFA...................... 169
162 4.000e-84T2D.2080951 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  44  1...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDKPITIHSNIYEPDYVVVVDDTLLTVPVTAGLKKEGAIVINTTKKPEELKELLGYDGSVYTIDARKVSEEALGRYFPNTPMLAAIVKVAGVMTDEELLEDMKTSFKHKFA...................... 169
163 4.000e-84gi|547178254|ref|WP_021920713.1| pyruvate ferredoxin oxidoreductase gamma subunit [Firmicutes bacterium CAG:114]  clstr ali  45  1...MKELVEFRWHGRGGQGAKTACLLLADAAFSSGKFVQGFPEYGPERMGAPITAYNRISDTRCSIHCNIDCPDYVVVVDETLLDVDVTKGLSPTGAVIVNTAKSPGEIRGKLRWTGPVCTIDARRISEETLGRNFPNTPMLSAAVRVSGVLEEERFKQDMEESFHHKFKPQVVAGNMAALMQAWEEVQV.. 193
164 5.000e-84gi|511025661|ref|WP_016279924.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase, gamma subunit [Lachnospiraceae bacterium A4] :_  clstr ali  43  1...MKDTVEIRWHGRGGQGAKTAALLLADVAFQTGKYVQGFPEYGPERMGAPITAYNRISASPITVHSNIYEPDYVVVVDESLLDIDVTKGLSPKGAVIINSTRSKEEIEHLHGYQGAVYTVDAKEISMRALGKNYPNSPMLAAVVAVSKIMEKEEFLAEMKASFQHKFKPEVIDGNMMALELAFEAA.... 189
165 6.000e-84gi|503545168|ref|WP_013779244.1| pyruvate synthase [Tepidanaerobacter acetatoxydans]  clstr ali  52  1..MSEKVLEIRWHGRGGQGAKTAALMLAETVAQMGKYVQGFPEYGPERMGAPILAFNRISDEPIHIHSNVINPDIVIVLDATLLGEKVTAGVPEDGIYIVNTTKTPQEVRKKLNIKGKIFTVDANQISLDTIGRVIPNTPLMGAFVKATGLMSYDEFIENVKGELEKKFKPEVIAGNIKAIERAYQEVK... 190
166 8.000e-84JGI.Meta JGI_HUM.2702438 7016111453 C3306628__gene_248629 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  48  2....KNTVEIRWHGRGGQGAKTAALLLADVAFKAGKYVQGFPEYGPERMGAPITAYNRISDEKITVHSNIYDPDYVVVVDEGLLDIDVTAGLNPEGAIVVNSAKPSEIIPKLHGYTGKVYTVDAHKISVAALGKYFPNSPMLAAIVAVSKVMDKEQFLTEMEGSYKHKFKPEVIDGNMKALRMTLEEV.... 189
167 9.000e-84gi|648287783|ref|WP_026068932.1| pyruvate synthase [Methanomassiliicoccus luminyensis]  clstr ali  46  2.....RTLEIRWHGRGGQGVVTANEILAGAALQEGKYMKAFPEFGPERMGAPIRAFARVSDEPIKVHSQVYFPDYVIVLDPTLINVNVLEGMKADGGLIVNYPDGKDHLRKALATDLEVHVVDGTKIALETVGRPLANTAMLGALVKVSGIVELDSVKDELRAKLGGKLPQKVVEKNVLSVERAYQEV.... 185
168 9.000e-84METAHIT MH0076 GL0033049 [Complete] locus=scaffold58000_2:258:803:+  ali  25  4........EIIIAGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDDPV-SSPILSSYDIAIVLNQPSLEK-FEPKVKPGGIIIYDGYGINE---PPTRKDIKVYRIDAMDAAAEMNLIKTFNMIVLGGLLKIRPVVKIESVLAALRKTLPERH-HHLIPKNEEAIRKGMEIIKEVQ 181
169 9.000e-84T2D.1295159 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  4........EIIIAGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDDPV-SSPILSSYDIAIVLNQPSLEK-FEPKVKPGGIIIYDGYGINE---PPTRKDIKVYRIDAMDAAAEMNLIKTFNMIVLGGLLKIRPVVKIESVLAALRKTLPERH-HHLIPKNEEAIRKGMEIIKEVQ 181
170 2.000e-83gi|503521538|ref|WP_013755860.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Thermodesulfobium narugense]  clstr ali  51  1...MKSYWEIRWHARGGQGAWTASQFLASAALSVNKYFQSFPEFGAEREGAPIVAYTKISDMPIKNYSQIEEPDAVVVLDPTLFSVNFLNGLKSDGYLIVNYPGDPKQLREELKIPIKVFTVDATKIALETLKRPITNTTMAGALVKATGILNFEDVVNEMIRSFSGKFKQEIIDANVNAIRRAYEEVKQ.. 190
171 2.000e-83JGI.Meta JGI_HUM.1797017 7014779701 SRS050422_LANL_scaffold_30517__gene_44381 ketoisovalerate ferredoxin oxidoreductase [Human Stool microbiome from visit n  ali  27  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEKI-SSPILSKYDTAIILNQPSLEK-FESRIKPGGILIYDG---YGIINPPTRKDIKVYRIDAMDAANEMKNAKAFNMIVLGGLLKLRPIVTLENVIKGLKKTLPERH-HHLIPMNEEAIKKGMELI.... 177
172 4.000e-83gi|516282851|gb|AGO81711.1| pyruvate ferredoxin oxidoreductase subunit gamma [Thermotoga hypogea]  clstr ali  71  1..MPTKYFEIRWHSRAGQGAKSAAQLVAETVLDEGKYAQAFPEYGAERSGAPMRAFNRISEGKIRVHYSVENPDVVVVIDDTLLSPTIVSGLKEDGVLIVNTKHSFDFVRKKTNFNGKVCIVNATDIALQEIKRGVPNTVMIGTLARVTGLVNLEVVEKKIREMFERKLPEEMIQANIRALRRGYEEVQ... 187
173 5.000e-83gi|490508195|ref|WP_004374226.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella oris]  clstr ali  28  1...MK--TEIIIAGFGGQGVLSMGKILAYSGMLEGKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPILSKYDVAIVLNQPSLDK-FMPKLKPGGMLIYDG---FGIINPPTRDDITVYRIDAMDKAAEMKNAKVFNMIILGALLKACPIVSTEGLQKALFKTLPERH-HHLIPLNMQAVEEGRKMVK... 178
174 5.000e-83JGI.Meta JGI_HUM.2056026 7026104706 SRS063999_LANL_scaffold_41716__gene_47251 ketoisovalerate oxidoreductase subunit vorA [Human Supragingival plaque microb  ali  25  16.......HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPSYGPEQRGGTANVTVILNDERI-SSPILNSYDIAIVLNQPSLDK-FEPKVKPGGVLIYDG---YGIQRPATRTDINVYRIDAMDAATELNMQKTFNMIVLGGLLKVVPMVQLESVLRGLKKTLPERH-HKLIPVNEEAIRKGMELIRKV. 193
175 5.000e-83METAHIT V1 GL0001325 [Complete] locus=scaffold3459_9:9049:9612:+  ali  26  6.KTMKE--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDDRI-SSPILSQYDTAIILNQPSLEK-FENRIKPGGILIYDG---YGIINPPTRKDIKVYRIDAMDAANEMKNAKAFNMIVLGGLLKLRPIVTLENIIKGLKKTLPERH-HHLIPMNEEAIKKGMELIREA. 187
176 5.000e-83gi|501072378|ref|WP_012123396.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Ignicoccus hospitalis]  clstr ali  47  4.PQMS-LVEIRWHGRGGQGAVTASEIVAKAAIAQGKYAQAFPSFGVERRGAPVEAFTRIDEKPIYIRSKIYEPDIIVVLDPSLLGPKLAEGLKEGGMAIVNTEKTPDEVRKLLREDVKVAVVNATKIALETLKRPIVNTAILGAFAKATGLVDLDALLEAVKEKVPPRT----VEANLEAVRRAYEEV.... 186
177 7.000e-83gi|9651770|gb|AAF91262.1|AF230199_4 pyruvate oxidoreductase delta subunit [Methanococcus maripaludis]  clstr ali  44  1......MKEVRFHGRGGQGAVTAAQILAKAAFYDGKFCQAFPFFGVERRGAPVMAFTRIDDEKIRLRSQIYEPDYVIVQDPTLMDVDVTSGIKDGGIILINTLKDI----KLNGYDVK--TIDATGIALDVLGVPIVNTTLCGAFAGLTGEVTIESLKKSILETFPGK----LGPKNADAAEKAYNLTK... 174
178 7.000e-83gi|517171709|ref|WP_018360527.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas macacae]  clstr ali  30  2......TYEIVIAGFGGQGVLSMGKILAYSGLMEGKNVSWMPSYGPEQRGGTSNVTVIVSDEPV-SSPVVNEYDVVIVLNQPSLDK-FESKVKPGGLLLFDSN---GIHRLPKRKDIKVCQVDATEEALHMGNQKVFNMLVLGGMLKEAPVVKIEGIEKGLMKSLPERH-HKLIPMNIEAIQRGMEIVKE.. 179
179 1.000e-82gi|503743892|ref|WP_013977968.1| pyruvate synthase [Clostridium sp. SY8519]  clstr ali  46  1...MSKGIEIRWHGRGGQGAKTAALLLADVAFKTGKQVQGFPEYGPERMGAPITAYNRISEEEIRVHSNIYDPDYVAVVDETLLHVDVTAGLSEQGAIIVNSPRSAREVAELPDYHGKVVTIDARKISEETLGKNFPNSPMLAAVVAVTQVMNREEFLREMRASYGHKFKPEVIEGNMRALER......... 184
180 1.000e-82gi|500836055|ref|WP_012003807.1| pyruvate synthase [Thermotoga lettingae]  clstr ali  67  1..MPAKYYEIRWHSRAGQGAKSASQLLAEAVLDMGKYAQAFPEYGAERSGAPMRAFNRISDGKITIHSSVEKPNVVVVIDDTLLSPAVVEGITEDGVLIVNTTHPVDYIRKKTHFNGKICTLKATDIALEEIKRGIPNTVILGAVAKITNVVTLESLEQKIKNMFGKKLSEEMLEANLRALRRGYEEV.... 186
181 1.000e-82METAHIT V1 GL0006131 [Complete] locus=scaffold14237_8:292:915:-  ali  43  15...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISQDVIRVHSNIYHPDYVVVVDETLLEVDVTAGLKKEGAIIVNTPKSKEEIEHLKGYEGDVYTVDGRKISVDALGKNFPNSPMLAAIVAVSKVMPRDKFITEMRASYEHKFKPEVIDGNMKALEMAFDAVE... 204
182 1.000e-82T2D.2160303 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  43  15...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISQDVIRVHSNIYHPDYVVVVDETLLEVDVTAGLKKEGAIIVNTPKSKEEIEHLKGYEGDVYTVDGRKISVDALGKNFPNSPMLAAIVAVSKVMPRDKFITEMRASYEHKFKPEVIDGNMKALEMAFDAVE... 204
183 1.000e-82JGI.Meta JGI_HUM.0941007 7067737779 C3213547__gene_286756 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  43  15...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISQDVIRVHSNIYHPDYVVVVDETLLEVDVTAGLKKEGAIIVNTPKSKEEIEHLKGYEGDVYTVDGRKISVDALGKNFPNSPMLAAIVAVSKVMPRDKFITEMRASYEHKFKPEVIDGNMKALEMAFDAVE... 204
184 2.000e-82METAHIT MH0021 GL0032157 [Complete] locus=scaffold52916_1:152:694:+  ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPSYGPEQRGGTANVTVILSDERI-SSPVLNAFDVAVILNQPSLEK-FESKVKPGGILIYDG---YGIHHPPTRTDINVYCINAMEAAIEMNNTKAFNMIVLGGLLKLRPMVSMENVLKGLKKSLPERH-HHLIPMNEQAILKGMEIIRKV. 180
185 2.000e-82T2D.425829 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPSYGPEQRGGTANVTVILSDERI-SSPVLNAFDVAVILNQPSLEK-FESKVKPGGILIYDG---YGIHHPPTRTDINVYCINAMEAAIEMNNTKAFNMIVLGGLLKLRPMVSMENVLKGLKKSLPERH-HHLIPMNEQAILKGMEIIRKV. 180
186 2.000e-82JGI.Meta JGI_HUM.1978192 7017302681 C3365162__gene_207930 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  44  1...MSSGLEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAYNRISREQIRVHSNIYTPDLVVVVDETLLHVDVTAGLKENGAIIINTAKSREEVLPLLGYRGSIYTVDGRKISVEALGKNFPNSPMLAAAVAVSGVMPKKEFISEMRASYQHKFKPEVIEGNMKALTMAYDAVEE.. 191
187 2.000e-82JGI.Meta JGI_HUM.5361158 7075615254 C4871385__gene_143149 putative 2-oxoglutarate synthase subunit [Human Stool microbiome from visit number 1 of subject 15  ali  24  2......TEEIIIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPSYGPEQRGGTANVTVILSDNRI-SSPILNAFDAAIILNQPSLDK-FESKIKPGGVLIYDS---YGIHHAPTRTDINIYCIDAMDAAVEMNNTKAFNMIILGGLLKIKPMVTLENVLKGLKKSLPERH-HKLIPMNEQAILKGMELIRKV. 180
188 2.000e-82gi|493348553|ref|WP_006305281.1| 2-oxoglutarate oxidoreductase, gamma subunit [Clostridiaceae bacterium L21-TH-D2]  clstr ali  27  1......MQEIIMAGFGGQGVMSMGQLLTYAGMIENKNVSWLPSYGPEMRGGTANCNVMVSDTPVG-SPIVTEATAAIVMNRPSLDK-FEKDVVKDGNLLINSSLID---KKAERDDINVYYIPANEIAVELGNAKVANMVMLGAYLELTKVVKSESVLEALKKVFGESKKH-LIPLNEKALQRGAEEVRK.. 179
189 3.000e-82gi|546845206|ref|WP_021897504.1| 2-oxoglutarate oxidoreductase gamma subunit [Prevotella sp. CAG:924]  clstr ali  24  1...MK--TELIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDQRI-SSPILSRYDVAIVLNQPSLDK-FESKVKPGGTLIYDG---YGVLNPPTRKDINVYRIDAMDKAAEMKNSKVFNMIVLGGLLKVYPVVSTEGLQKALYKSLPERY-HHLIPLNMQALEEGMKIISKVE 181
190 3.000e-82T2D.1729697 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIISDDPI-SSPILNQYDVAVVLNQQSLDK-FESKVKPGGILIYD---NYGIHRAPERTDIRVYNVEAMEASFDMQNAKTYNMIVLGALLKVCPMVKMESVLAGLRKSLPERH-HKLIPMNEEAIRKGMALIKE.. 179
191 3.000e-82gi|490470799|ref|WP_004341300.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella buccae]  clstr ali  25  22...MK--TEIIIAGFGGQGVLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPILSKYDVAIVLNQPSLDK-FEPKLKPGGILIYDG---FGVFNPPTREDISVYRINAMDKATEMKNSKVFNMIVLGGLLKVCAVVSTDGLKKALKKSLPERH-HNLIPLNMQAVEEGMSIITK.. 200
192 3.000e-82METAHIT MH0053 GL0050276 [Complete] locus=scaffold925_3:2239:2811:-  ali  25  4........EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPILSHYDVAIVLNQPSLDK-FEPKVKPGGILIYDG---FGIINPPTRKDINVYRIDAMDKAAELKNSKVFNMIVLGGLLKVCPIVSTDGLNKALFKTLPERH-HGLIPLNMQAVEEGMKIMTKMQ 181
193 3.000e-82T2D.872003 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  4........EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPILSHYDVAIVLNQPSLDK-FEPKVKPGGILIYDG---FGIINPPTRKDINVYRIDAMDKAAELKNSKVFNMIVLGGLLKVCPIVSTDGLNKALFKTLPERH-HGLIPLNMQAVEEGMKIMTKMQ 181
194 3.000e-82gi|567410065|gb|ETK01353.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Tannerella sp. oral taxon BU063 isolate Cell 2]  clstr ali  25  3.......HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPSYGPEQRGGTANVTVILNDERI-SSPILNSYDIAIVLNQPSLDK-FEPKVKPGGVLIYDG---YGIQRPATRTDINVYRIDAMDAATELNMQKTFNMIVLGGLLKVVPMVQMESVLRGLKKTLPERH-HKLIPVNEEAIRKGMELIRKV. 180
195 3.000e-82gi|493297876|ref|WP_006255506.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Alloprevotella tannerae]  clstr ali  25  2......TQEIIISGFGGQGVLSMGKILAYAGLMEGKEVSWMPAYGPEQRGGTANVTVIVSDNPI-SSPILSEYDTAILLNQPSLEK-FESKIKPGGTIIYDS---FGIIKKPTRTDINIYCIDAMNTAAELKMMKTFNMIVLGGLLKIHPIVQLEGVMKALKKTLPERHWH-LLPTNEQAILKGMEIIK... 178
196 3.000e-82JGI.Meta JGI_HUM.0336996 7062861711 C5342740__gene_369907 2-oxoglutarate oxidoreductase, gamma subunit [Human Supragingival plaque microbiome from visit num  ali  25  2......TQEIIISGFGGQGVLSMGKILAYAGLMEGKEVSWMPAYGPEQRGGTANVTVIVSDNPI-SSPILSEYDTAILLNQPSLEK-FESKIKPGGTIIYDS---FGIIKKPTRTDINIYCIDAMNTAAELKMMKTFNMIVLGGLLKIHPIVQLEGVMKALKKTLPERHWH-LLPTNEQAILKGMEIIK... 178
197 3.000e-82gi|505138643|ref|WP_015325745.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Methanomethylovorans hollandica  clstr ali  42  1......MKEIRIHGRGGQGSVTAAELLAVAAFADGKFSQAFPAFGVERRGAPVQAFTRMDDTPIRLRSQVYEPDYVIVQDPTLIEVDVASGLKEDGIIIINSEFDPSTFK--LNTKAKVVTVNATKIALEIIGRPIVNTVLLGAFAGATGNIRPESIKEAVKERFPGK----VGERNAEAIQQAYDMMKEA. 180
198 5.000e-82gi|503698998|ref|WP_013933074.1| pyruvate synthase [Thermotoga thermarum]  clstr ali  70  1..MPAKYFEVRWHSRAGQGAKSAAQLLAEAVLDMGKYAQAFPEYGAERSGAPMRAFNRISDEKITVHSAVENPDVVVVIDDTLLSPAVVVGLKKEGVLIVNTAHPIEFVRKKTGFEGKICIVRATDIALEELKRGIPNTVMLGTIARVTGLITLETAAQRIREMFERKLPEEMIQANLRALKRGYEEV.... 186
199 5.000e-82gi|501003491|ref|WP_012056571.1| pyruvate synthase [Thermosipho melanesiensis]  clstr ali  67  1..MPAKYFEIRWHARAGQGAKSASQMLAEAALEMGKYVQSFPEYGAERTGAPMKAFNRVSDEPILIHSSVDYPDVVVIIDDTMLQPALTDGTDENTVFIVNTVKDVEYVREKLGVKGKICTIAATDIALEELKRGIPNTVMLGAIAKVTGVITLESAEQRIRKAFSKKFPEELVEANVRALRRGFEEVKCN. 190
200 8.000e-82gi|506329934|ref|WP_015849653.1| pyruvate/ketoisovalerate ferredoxin oxidoreductase subunit gamma [Thermococcus sibiricus]  clstr ali  45  2......MIEIRFHGRGGQGAVTAANILAEGAFLEGKYVQAFPFFGVERRGAPVTAFTRIDEKPIRIKTQIYEPDVVVVLDPSLLDVDVTAGLKEGGLVIVNTEKTKEEVEKLKKKPAKLALVDATTIALEILGLPITNTSILGAVAKATGIVKIESVEEAIKEAFSG----ELGEKNAKAAREAFEKTVVYE 185
201 9.000e-82T2D.3631868 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  26  53...MKQ--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPILSQYDTAIILNQPSLEK-FEGKIKPGGILIYDG---YGIIEPPTRRDIQIYRIDAMDAANEKGMAKTFNMIVLGGLLKLRPVVSIESVIKALRKTLPERH-HHLIPMNEEAIRIGMEIIK... 230
202 1.000e-81gi|506213460|ref|WP_015733235.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanocaldococcus vulcanius]  clstr ali  42  1......MIEVRFHGRGGQGAVTAAQILAKASFYDGKFCQAFPFFGVERRGAPVMAFTRIDDKKITLRCQIYEPDYVIVQDPTLLEVNVVDGLKENGAVIINT------VKEDLDLGYKTYTIDATGIALDVLGVPIVNTAMVGAFAGVTKLVSIESVKKAILDTF----KGKLGEKNAKAAELAYNEM.... 173
203 1.000e-81gi|496676860|ref|WP_009319350.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonadaceae]  clstr ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPSYGPEQRGGTANVTVILSDERI-SSPVLNTFDVAIILNQPSLEK-FENKVKPGGILIYDG---YGIHHAPTRKDIDIYRIDAMDTAIEMENSKAFNMIVLGGLLKVKPMVSLENVLKGLKKSLPERH-HKLIPMNEQAILKGMEIIRKV. 180
204 2.000e-81gi|517275715|ref|WP_018464533.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella paludivivens]  clstr ali  25  1...MKK--EIIISGFGGQGVLSMGKILAYSGLLEDKEVTWMPAYGPEQRGGTANVTVIISDERI-SSPILSKFDIAIVLNQPSMDK-FLSKVKPGGILIYDG---FGIINPPARKDITVYRIDAMDKAAEMKNAKVFNMIVLGGLLKVCKIVSTDGLNKALYKTLPERH-HKLIPLNMQAVEEGMNLIEEVK 181
205 2.000e-81JGI.Meta JGI_HUM.0460535 7058221908 SRS049959_WUGC_scaffold_38415__gene_72859 ketoisovalerate ferredoxin oxidoreductase [Human Stool microbiome from visit n  ali  25  4........EIIIAGFGGQGVLSMGKILAYAGLMENKEVTWMPAYGPEQRGGTANVTVIVSDDPV-SSPILSSFDIAIVLNQPSLEK-FEPKVKPGGIIIYDGYGISE---PPTRKDIKVYRIDAMDAAAEMNLIKTFNMIVLGGLLKIRPVVKIESVLAALRKTLPARH-HNLIPQNEEAIRKGMEIIKEVQ 181
206 2.000e-81JGI.Meta JGI_HUM.2207253 7019594635 C3022825__gene_183178 hypothetical protein [Human Stool microbiome from visit number 2 of subject 158337416]  ali  25  1...MKE--EIVIAGFGGQGVLSMGKILAYAGLMDNLEVTWMPSYGPEQRGGTANVTVIVSDKPI-SSPVLDKYDTAVVLNQQSLDK-FESRVKSGGTLIYD---PSGIHHLPSRTDIRVVPVDAMEAAIELQNSKTYNMILLGALLKCRPIVEIDAVLRGLKKTLPERH-HHLIPLNEKALRKGMTLV.... 177
207 2.000e-81gi|550908677|ref|WP_022661777.1| pyruvate ferredoxin oxidoreductase subunit gamma [Desulfovibrio longus]  clstr ali  45  1......MIEIRLHGRGGQGGVTSAELLARAAIAEGKFAQAFPSFGPERRGAPVMAFVRVDDKKIRIREKVYNPDVVLVLDPTLLDVDVSEGLKEGGTVVVNTGQSPDELKKKYGFP-KVACVDANKVALEELGVPITNTTMLGALLRATGIVEVD----HMEAVIADRFGPKLGPKNYNALKRAHGETRAA. 181
208 3.000e-81JGI.Meta JGI_HUM.1062993 7039710596 C5394291__gene_271595 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Supragi  ali  29  2......TYEIIIAGFGGQGVLSMGKILAYSGLMEEKEVSWMPSYGPEQRGGTSNVTVIVSDEQV-SSPVVNDYDIVVALNQPSLDK-FASRVKPGGVLLYDSNGVHYE---NPRTDIDIYEVDATNEATRMGNSKVFNMLILGALLKTRTILHLDSIKKGLEKSLPERH-HKLIPMNMEALQRGAELLKKH. 180
209 4.000e-81gi|503588911|ref|WP_013822987.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfotomaculum kuznetsovii]  clstr ali  28  1......MYEILIAGFGGQGVLSTGQLLAYAGMLEGKHVSWIPSYGPEMRGGTANCGVTISDSPI-SSPVVTEPTSLIVMNRPSLEK-FEGSVVPGGLILINSSLVDI---KATRKDVRVYYIPANELAEELGNARVAGNVILGALLELTGVVSLDAVEKSLREVLPA-HRHKLIPLNRQALETGAALVR... 178
210 4.000e-81gi|490720913|ref|WP_004583473.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas gingivalis]  clstr ali  27  2......TYEIVIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPSYGPEQRGGTSNVTVIVSDEQV-SSPVLNEYDIVIVLNQPSLDK-FEARVKKGGILVYD---PDSIVLKNKRDDIQIYEVDATQESLRMGNQKAFNMIVLGGVLKVAPMVKIESVIKGLKKTLPERH-HKLIPMNEQAIQRGMEIIKQI. 180
211 5.000e-81JGI.Meta JGI_HUM.3784884 7008544408 SRS017307_Baylor_scaffold_32843__gene_69279 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate  ali  41  7...MAKSVEIRWHGRGGQGAKTAALLLADVAFKTGSYVQGFPEYGPERMGAPITAYNRISQEPITIHSNIYYPDYVAVVDDSLLEIDVTHGLKKEGAVIVNTTKDKAKILPLLGYEGRVYTIDAREISVKALGKYYPNSPMLAAVVAVSGVMEPHVFLQEMRASFQHKFKPEVIEGNMMALELTLESIGAVE 199
212 7.000e-81gi|548235179|ref|WP_022453645.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase gamma subunit [Prevotella sp. CAG:873]  clstr ali  28  1...MKE--EIIIAGFGGQGVLSMGKILAYAALMDNLETTWMPAYGPEQRGGTANVTVIISDSAI-SSPIVDSYDTAVILNQQSLDK-FESKVKPGGTLIYD---PYGIHRAPTRTDIRVIPVDATDAAIEMGNSKTYNMILLGALLKARPLVPDDAVVRGLRKTLPERH-HHLIPLNEEAIARGKALVK... 178
213 7.000e-81gi|553311831|ref|WP_023056794.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit [Prevotella sp. BV3P1]  clstr ali  25  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPILSKYDVAIVLNQPSLDK-FQPKIKPGGILIYDGN---GIVSPPSRTDIQVYRIDAVEQAAEMKNAKVFNMIVLGGLLKVCPVVSTDGLQKALYKSLPERH-HHMIPLNMQAVDIGMKLITK.. 179
214 1.000e-80gi|547515172|ref|WP_022102733.1| putative uncharacterized protein [Prevotella sp. CAG:5226]  clstr ali  25  1...MKQ--EIIISGFGGQGVLSMGKILAYAALMEGKEVTWMPAYGPEQRGGTANVTVIISDEPI-SSPILSTYDTAILLNQPSLDK-FQPKVKKGGTLIYDS---FGIIEKPSRTDITSWHIPAMESAAEMSMMKCFNMFILGGFLKVHPIVSIESVMKALRKTLPERH-HNLLPMNEQAILKGRDIISK.. 179
215 1.000e-80JGI.Meta JGI_HUM.0346226 7048805609 SRS011134_Baylor_scaffold_29841__gene_41606 hypothetical protein [Human Stool microbiome from visit number 1 of subject  ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMDNLEITWMPSYGPEQRGGTANVTVILSDAKI-SSPVLDTYDTAVILNQQSLDK-FESKVKPGGTLIYDS---YGIHRMPQRTDINVYRVDAMDATFEMKNAKTYNMIVLGALLKIRPIVSVDSVMAGLKKALPERH-HHLLPLNREAINRGMDLVK... 178
216 1.000e-80CGD_mhc9a.230009 GDAKSKM01EN1P9|GDAKSKM01EN1P9|metagene|gene_1  ali  41  1...MKDLIEIRWHGRGGQGAKTAALLLADVAFNNGLYVQGFPEYGPERMGAPITAYNRLSRNPIRVHSNIYEPDYVVVVDESLIEVDVTAGTKEGGAIIINSHKSSNELKPLLGYHGHIYTIDARKISIETLGKYYPNSPMLAAVVKITGVMEEKAFLEDMRKSYAHKFASK.................... 173
217 1.000e-80gi|502960259|ref|WP_013195235.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanohalobium evestigatum]  clstr ali  41  1......MKEIRVHGRGGQGSVTAAELLAIAAFSDGKFSQAFPSFGVERRGAPVQAFTRIGDKPIRLRSQIYEPDYVIVQDPTLIDVDVAHGMDENGIVIINSDFNPEDFN--IDTDAKIMTVDATKIALDIIGRPIVNTILLGAFAGATDEINPESIKEAVKERFPGK----IGDKNAEAVQKAYDMIRE.. 179
218 1.000e-80gi|497238876|ref|WP_009553135.1| 2-oxoacid:acceptor oxidoreductase subunit gamma [Burkholderiales bacterium JOSHI_001]  clstr ali  39  1......MLQIRIHGRGGQGVVTAADMLAIAAFNQGRHAQSFPSFGSERTGAPVVAFCRIDDREIRLREPILSPDVLIVQDPTLLHVDVFQGLKPDGYVLINSRKSLDELGLSERDRSHLLTVPATDIAIAHVGRPLPNAVLLGGFAALAGLISLDAVEHAIRDRFTGK----VAEGNVAAARQAFEHVRQ.. 185
219 1.000e-80gi|503041887|ref|WP_013276863.1| pyruvate synthase [Thermosediminibacter oceani]  clstr ali  52  1...MAKVMEIRWHARGGQGAKTAALMLAESVAAMGKYVQGFPEYGPERMGAPMLAFNRISDEPIYIHSNVINPNVVIVLDPTLIGKKITEGVPEDGIYIINTTKTPAEVREMLDIKGKIYTLDANQISLDTIGRAIPNTPMMGAFIRATGIIPFDQFMSHIKELLSKKFKPEVVEGNLKAIERAYREVKE.. 191
220 1.000e-80gi|500684840|ref|WP_011973989.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanococcus aeolicus]  clstr ali  45  1......MIEVRFHGRGGQGAVTAAQLLAKATFIDGNFAQAFPFFGVERRGAPVIAFTRIDDKKIRIRSQIYEPDYVVVQDPSLLDIDVKSGLKEGGKIIINTTKDI----KFEGYD--VFCVDATGIALDVLGLPIVNTSILGAFAGVTGEVSIEALKEAIMDSFPKK----LAEKNAKAAEVAYNAVKK.. 175
221 2.000e-80gi|647307497|ref|WP_025747581.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Caldicoprobacter oshimai]  clstr ali  29  2......THQIIIAGFGGQGIMLMGQLLAYAGMLEGKNVSWLPSYGPEMRGGTANCNVIISDEPV-ASPIVTEATAVMVMNRPSLD-RFEGAVMKGGLLLVNSSLID---KKASRDDIEVCYIPANEIADQLGNSRVANMVVLGSYIAKTGVVSPASVIESLRKALGPS-KEHLIPLNEEALKRGAECVKEC. 180
222 2.000e-80JGI.Meta JGI_HUM.0012545 7029940069 SRS023595_Baylor_scaffold_74716__gene_74827 putative 2-oxoglutarate oxidoreductase gamma subunit [Human Supragingival pl  ali  28  2......TCELVIAGFGGQGVLSMGKILAYSGLMEDKNVSWMPSYGPEQRGGTANVTVIISDESV-SSPLVNEYDVVIALNQPSVDK-FTPRVKPGGILIYDTNGVTHI---PERTDIQIYEVPATDEANHMGNAKVFNMLVLGATLSVHPMLPLDSIRKGLEKSLPERH-HKLIPMNMKALERGGEIIRRH. 180
223 2.000e-80METAHIT MH0077 GL0029609 [Complete] locus=C4559709_1:1404:1946:-  ali  25  1...MKQ--EIIAAGFGGQGVLSMGKILAYAGLIDDLEVTWMPSYGPEQRGGTANVTVVLSDSPI-SSPVLDSYDTAVILNQQSLDK-FESKVKPGGTLIYD---PYGIHHAPTRTDINIYPVNAMDVALELKNAKSYNMIILGALLKINPIVSVDSVMTGLKKTLPERH-HHLLPANREAIMRGMDLVEV.. 179
224 2.000e-80T2D.1334984 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  1...MKQ--EIIAAGFGGQGVLSMGKILAYAGLIDDLEVTWMPSYGPEQRGGTANVTVVLSDSPI-SSPVLDSYDTAVILNQQSLDK-FESKVKPGGTLIYD---PYGIHHAPTRTDINIYPVNAMDVALELKNAKSYNMIILGALLKINPIVSVDSVMTGLKKTLPERH-HHLLPANREAIMRGMDLVEV.. 179
225 2.000e-80JGI.Meta JGI_HUM.1933051 7068837476 C2300718__gene_188973 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  44  3...MQDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNKPITIHSNIYEPDYVVVVDDTLLEVDVTAGLKATGAIVINTTKTPEYLKKLKDFKGEIYTIDARKVSMETLGRYFPNTPMLAAIVKVSKIMDEQDFINDMKGSFK.......................... 167
226 2.000e-80gi|548216883|ref|WP_022436183.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Prevotella sp. CAG:279]  clstr ali  28  1...MK--HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVILSDEKI-SSPILNAFDIAVVLNQQSLDK-FESKVKPGGILIYD---NYGIHRAPTRKDIKVYNVAAMDATLEMKNSKTYNMIVLGALLKVCPMVTLESVIKGLKKSLPERH-HKLIPLNEEAIRKGMSLINE.. 179
227 2.000e-80METAHIT MH0020 GL0058237 [Complete] locus=scaffold7090_3:1790:2329:+  ali  28  1...MK--HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVILSDEKI-SSPILNAFDIAVVLNQQSLDK-FESKVKPGGILIYD---NYGIHRAPTRKDIKVYNVAAMDATLEMKNSKTYNMIVLGALLKVCPMVTLESVIKGLKKSLPERH-HKLIPLNEEAIRKGMSLINE.. 179
228 2.000e-80JGI.Meta JGI_HUM.0448489 7058186620 SRS049959_WUGC_scaffold_19765__gene_37571 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate f  ali  28  1...MK--HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVILSDEKI-SSPILNAFDIAVVLNQQSLDK-FESKVKPGGILIYD---NYGIHRAPTRKDIKVYNVAAMDATLEMKNSKTYNMIVLGALLKVCPMVTLESVIKGLKKSLPERH-HKLIPLNEEAIRKGMSLINE.. 179
229 2.000e-80gi|518369348|ref|WP_019539555.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Proteiniphilum acetatigenes]  clstr ali  23  2......LQEIVISGFGGQGVLSMGKILAYSGIMEDKEVSWFPAYGPEQRGGTANVTVIISDEPI-SSPVVNKYDIAIVLNQPSLEK-FEDKVKPGGALIYDG---YGIHKKVERNDINVFRINAMDESMKMNNTKVFNMIVLGGLLKISPMVDVENVMEGLKKSLPERH-HKLLPMNEEAILRGMEIIQLEQ 181
230 3.000e-80gi|547733071|ref|WP_022147011.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Bacteroides sp. CAG:709]  clstr ali  24  2......TDEIIIAGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDAPV-SSPILSSFDIAIVLNQPSLEK-FEPKVKPGGIIIYDGYGISE---PPTRKDIKVYRIDAMDAAAEMNLIKTFNMIVLGGLLAIRPVVKIDSVIAALRKTLPERH-HNLIPKNEESIRKGMELIKEVK 181
231 3.000e-80gi|503448828|ref|WP_013683489.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Archaeoglobus veneficus]  clstr ali  44  1......MLEVRFHGRGGQGSVTAAEVLAIAAFKDGKYSQAFPIFGVERRGAPVQAFCRIDEKPIKQRCQVYEPDLVVVQDATLMDVDVTAGLKEGGILLINSAKSPEEFGINSNTTVK--TIDATRLALETLGRPIVNTVMLGALAKL-GIVSLNSIVEAV----GEKFGCKLAEKNILAVKKAFEE..... 175
232 3.000e-80gi|503592337|ref|WP_013826413.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanobacterium paludis]  clstr ali  42  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYCQAFPFFGVERRGAPVMAFSRIDDQPIRRRYQVYKPNYVIVLDDGLLEVDVFSGIKDGGKIIINTTSDVKTV-----DGAEVQKIDATGIALEILGVPIVNTVMLGAFAGLTGEISLESLIKIIKETFSGK----IGEKNAKAATIAYNKVRE.. 176
233 3.000e-80gi|547712965|ref|WP_022129508.1| putative uncharacterized protein [Bacteroides sp. CAG:530]  clstr ali  25  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDTRI-SSPILSKYDTAIILNQPSLAK-FEDKVKPGGVLIYDG---YGIIEPPTRKDIHVYRIDAMDEANERKMAKTFNMIVLGGLLKIRPIVSIESVVKALRKTLPERH-HNLIPMNEEAIRIGMDIIKK.. 179
234 3.000e-80gi|512184003|ref|WP_016410719.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Prevotella sp. CAG:1031]  clstr ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMDDLEVTWMPSYGPEQRGGTANVTVILSDKPI-SSPVLDEYDCVVALNQQSLDK-FEPKVKKGGTLLYD---PYGIHRAPTRPDINAVAVPAMEATFEMGNSKTFNMIVLGGLLGVRPMVPVESVLKGLKKVLPERH-HHLIPLNEEALRKGISLTKK.. 179
235 3.000e-80JGI.Meta JGI_HUM.6024259 7072109127 C1866798__gene_123955 hypothetical protein [Human Stool microbiome from visit number 2 of subject 159490532]  ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMDDLEVTWMPSYGPEQRGGTANVTVILSDKPI-SSPVLDEYDCVVALNQQSLDK-FEPKVKKGGTLLYD---PYGIHRAPTRPDINAVAVPAMEATFEMGNSKTFNMIVLGGLLGVRPMVPVESVLKGLKKVLPERH-HHLIPLNEEALRKGISLTKK.. 179
236 3.000e-80gi|504218338|ref|WP_014405440.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanocella conradii]  clstr ali  42  1......MKEIRIHGRGGQGSVTAAELIAVAAFEDGKWSQAFPYFGTERRGAPVTAFARISDKKIRVRSQIYEPDYVIVQDPSLLSVDVASGIKKDGLIIVNTEKDPSELK--MDTNATVKTIDATTLAIKILGVPIVNTALLGAFAGASGQIRLESVSKAIKERFPGK----VGEKNVEAVRQAYEMMR... 178
237 3.000e-80JGI.Meta JGI_HUM.1254918 7068140767 SRS015782_WUGC_scaffold_34082__gene_76237 2-oxoglutarate oxidoreductase, gamma subunit [Human Stool microbiome from visi  ali  26  1...MK--TEIIISGFGGQGCLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTASVTVIVSDERI-SSPILSKYDVAIVLNQPSLDK-FESKVKPGGILIYDGN---GIINPPTRKDITVYQIDATDKAAEMKNSKVFNMIVLGGLLKVCPVVSTEGLNKALFKSLPERH-HKLIPLNMEAVSEGMKIIEKKE 181
238 3.000e-80JGI.Meta JGI_HUM.7571846 7021039456 C785596__gene_59310 hypothetical protein [Human Posterior fornix microbiome from visit number 2 of subject 159005010] :_  ali  26  5.KAMKE--ELIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPSYGPEQRGGTANVTVILSDERI-SSPVLNAFDTVIVLNQQSLD-RFESKVKPGGILIYDS---YGIHTPPKRTDIKIYKIDATEASIEMQNAKSFNMIVLGAYLKVKPTVSMESVIKGLKKSLPERHW-NLIPMNEEALKKGASLV.... 183
239 4.000e-80METAHIT MH0012 GL0027729 [Complete] locus=scaffold132115_2:3227:3787:+  ali  45  3......TLEVRWHGRGGQGIVTANEILAGAALYEGKFMKAFPEFGPERMGAPIRAFARVSDEPIKVHSQVYFPDYVAVLDPTLININVLEGLKETGSLIVNNTASVSELKKTLDTDMDVHVVDASKIALETIGKPLANTAMLGALVKISGIVGLDSIIAEMQIKLGGKLPAPVVEKNVLSVKRAYEEVQ... 186
240 4.000e-80JGI.Meta JGI_HUM.4915769 7020011719 SRS048870_WUGC_scaffold_48618__gene_96753 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate f  ali  45  3......TLEVRWHGRGGQGIVTANEILAGAALYEGKFMKAFPEFGPERMGAPIRAFARVSDEPIKVHSQVYFPDYVAVLDPTLININVLEGLKETGSLIVNNTASVSELKKTLDTDMDVHVVDASKIALETIGKPLANTAMLGALVKISGIVGLDSIIAEMQIKLGGKLPAPVVEKNVLSVKRAYEEVQ... 186
241 4.000e-80gi|652798684|ref|WP_027096536.1| pyruvate synthase [Clostridium viride]  clstr ali  46  1.MANKTMVEIRWHGRGGQGAKMACLLLAEVAGQVGKFVQGFPEYGPERMGAPITAYNRISDTRCPVHSNIYTPDYVVVLDETLLDVDVTHGLRDGGAIIVNTPSSGEVIRPKLRYTGALYTLDARHLSEEILGRNFPNTALLAAVVKVSGVLELEAFLEHIEASFRKKFKPQVIAGNLEILRKASEEV.... 191
242 4.000e-80gi|504063031|ref|WP_014297025.1| pyruvate synthase [Marinitoga piezophila]  clstr ali  67  1..MPEKYFEIRWHGRAGQGAKSASQFLTEAAVEAGKYSTAFPEYGAERSGAPMKAFNRIADVPIRIRSGIENPDVVVVFDDTMLGPDITAGLGEDKIMLVNTVMSPEEVREKTGFKGKIYTIPATDIALEEIKRGIPNTVMIGALVKLTNVVPMEVVKEKVRKTFEKKFSEEVVQANLRAVDRGYQEVK... 188
243 5.000e-80T2D.3912864 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMDDLEVTWMPSYGPEQRGGTANVTVILSDKPI-SSPVLDEYDCVVALNQQSLDK-FEPKVKKGGTLLYD---PYGIHRAPTRPDINAVAVPAMEATFEMGNSKTFNMIVLGGLLGVRPMVPVESVLKGLKKVLPERH-HHLIPLNEEALRKGISLTKK.. 179
244 6.000e-80gi|547008725|ref|WP_021909771.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Prevotella sp. CAG:755]  clstr ali  25  1...MKE--EIIISGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEPI-SSPILSRYDTAILLNQPSLEK-FEPKVRPGGTLIYDG---YGIADPPTRADIEAWRIDAMDAAAELKMMKCFNMFVLGALLKLHPIVSVSNVMQALRKTLPERH-HDLLPLNEQAILKGMELVR... 178
245 6.000e-80gi|516484378|ref|WP_017872822.1| hypothetical protein [Candidatus Caldatribacterium saccharofermentans]  clstr ali  46  1...MEKPLEIRWHGRGGQGVVTASRILADALLREGKYFQAFPEYGPERMGAPVKAYNRVSSTPIRIHSGVTSPEMVVVVDPTLLAVDVLEGLAENGTVVANFPGTPGDLRNLLHFSGTVVVVDASRISREILGRVVVNTPILGALCRVLPEVKLENILEAVKAQFGEKLRAEVVEKNLACLRRAYEEAQ... 188
246 6.000e-80gi|506404069|ref|WP_015923788.1| pyruvate synthase [Halothermothrix orenii]  clstr ali  44  1......MLEIRWHGRGGQGSKTASILLAKIASATGKHIQAFPEYGPERMGAPVLAYTRISDGPIHLHCQVETPDLVVVLDPTLITVDITQNLKKGGNLIINSDYEPDKIRDKLGADVNTYTIDANTISEEEIGRIFPNTPMLGAINRVVNLMDQDSFLNQAREELKKKFKPEVIEGNMRSIDMAYREVK... 188
247 6.000e-80JGI.Meta JGI_HUM.6180330 7022066744 C3690145__gene_144657 ketoisovalerate ferredoxin oxidoreductase [Human Stool microbiome from visit number 1 of subject 1  ali  25  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMDDKEVTWMPSYGPEQRGGTANVTVILSDDKI-SSPILDTYDTAVILNQQSLDK-FESKVKPGGVLIYDS---YGIHKAPTREDITIYKVDAMEATFDMKNSKSYNMIVLGALLKVRPIVTLESVMNGLKKTIPERH-HHLMPLNEEALQKGMSLI.... 177
248 7.000e-80gi|565856343|ref|WP_023938641.1| MULTISPECIES: 2-oxoglutarate oxidoreductase, gamma subunit [Porphyromonas]  clstr ali  25  2......TYEIVIAGFGGQGVLSMGKILAYSGLMENKEVSWMPSYGPEQRGGTSNVTVIVSDDAV-SSPVVNEYDIVIVLNQPSMDK-FEPKVKKGGILIYD---PNGIHRKPSRTDVSIYEVDATDESMAMGNQKAFNMIVLGGMLKVAPMVTIESVVAGLRKSLPERH-HKLIPMNEDAIKRGMDIIRK.. 179
249 7.000e-80gi|547530666|ref|WP_022107576.1| pyruvate/ketoisovalerate oxidoreductase gamma subunit [Clostridium sp. CAG:138]  clstr ali  24  6..........IFAGFGGQGVLLIGQLLAYAGMYEGKNVSWLPSYGPEMRGGTANCSVVVSDEPV-ASPVINKCDCVIAMNRPSLDK-FEQNVLPGGKLFINSSIID---KKATRTDIDVYYVPCNEIADKLNNPKVANMAMLGAYLEATKAVQTKSVLDALLYKLGEK-KAALIPLNEEAIEAGAASIRK.. 179
250 7.000e-80METAHIT MH0012 GL0160567 [Complete] locus=scaffold8930_4:7449:7988:-  ali  24  6..........IFAGFGGQGVLLIGQLLAYAGMYEGKNVSWLPSYGPEMRGGTANCSVVVSDEPV-ASPVINKCDCVIAMNRPSLDK-FEQNVLPGGKLFINSSIID---KKATRTDIDVYYVPCNEIADKLNNPKVANMAMLGAYLEATKAVQTKSVLDALLYKLGEK-KAALIPLNEEAIEAGAASIRK.. 179
251 7.000e-80T2D.3199182 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  24  6..........IFAGFGGQGVLLIGQLLAYAGMYEGKNVSWLPSYGPEMRGGTANCSVVVSDEPV-ASPVINKCDCVIAMNRPSLDK-FEQNVLPGGKLFINSSIID---KKATRTDIDVYYVPCNEIADKLNNPKVANMAMLGAYLEATKAVQTKSVLDALLYKLGEK-KAALIPLNEEAIEAGAASIRK.. 179
252 7.000e-80JGI.Meta JGI_HUM.2083292 7051301965 SRS020328_Baylor_scaffold_21331__gene_49240 pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Human Stool microbio  ali  24  6..........IFAGFGGQGVLLIGQLLAYAGMYEGKNVSWLPSYGPEMRGGTANCSVVVSDEPV-ASPVINKCDCVIAMNRPSLDK-FEQNVLPGGKLFINSSIID---KKATRTDIDVYYVPCNEIADKLNNPKVANMAMLGAYLEATKAVQTKSVLDALLYKLGEK-KAALIPLNEEAIEAGAASIRK.. 179
253 1.000e-79JGI.Meta JGI_HUM.4703284 7025450186 SRS045004_LANL_scaffold_30381__gene_46936 hypothetical protein [Human Stool microbiome from visit number 1 of subject 60  ali  23  1...MKQ--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVSWMPSYGPEQRGGTANVTVILSDDRI-SSPVLNEYDIAIILNQPSMEK-FENKVKKGGIIIYDG---YGIHTPVKRTDVSVYRVDAMDAATEMKNEKAFNMLILGGLLKIVPMVKLENVLLGLKKSLPERH-HKLIPMNEAAIKKGMEIITNVQ 181
254 1.000e-79JGI.Meta JGI_HUM.3166316 7033889227 C5459614__gene_233812 putative 2-oxoglutarate synthase subunit [Human Supragingival plaque microbiome from visit number  ali  26  2......TEEIIIAGFGGQGVLSMGKILAYSGIMQGQEVAWMPSYGPEMRGGTANVTVILSDSRI-SSPVIQEFDTVIVLNQQSLDK-FESRVKPGGTLIFD---PNGISNPPKRKDIAIYSVKATDEATAMNNSKTFNMIVLGAFLKVKPIVDMDNVVKGLQKSLPERH-HNLIPMNEQAIRRGMEIVEK.. 179
255 1.000e-79gi|493851596|ref|WP_006798524.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Dysgonomonas gadei]  clstr ali  23  2......TQEVIIAGFGGQGVLSMGKILAYSGLMEDKEVSWFPSYGPEQRGGTANVTVILSDNAI-SSPIVNEYDIAIILNQPSLDK-FEPHVKPGGILIYD---PSGFQHPPTRKDIYIYKIEAIDTATLMQNTKAFNMIVLGGLLKVSPMVQLDNVMLGLKKSLPERH-HKLLPMNEQAILKGMEIIQEVQ 181
256 1.000e-79gi|503665205|ref|WP_013899281.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanosalsum zhilinae]  clstr ali  40  1......MKEIRIHGRGGQGSVTAAELLAVAAFADGKYSQAFPAFGVERRGAPVQAFTRLSDRPIRLRSQVYQPDYVIVQDPTLIEVDVANGIKDNGTIIINSEFEPEQFSFSTG--AKVMTVDATRIALDVIGRPIVNTILLGAFAAATGEIQPGSIADAVKQRFSGK----IGEKNAEAIDRAYNMTMEAK 181
257 1.000e-79gi|647556686|ref|WP_025837762.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas cangingivalis]  clstr ali  25  1...MKKY-EIVIAGFGGQGVLSMGKILAYSGLMGNKEVSWMPSYGPEQRGGTANVTVIISDEKI-SSPILNSYDIAIVLNQPSLDK-FISKVKPGGMLIYDG---YGIHTEPKRDDIKLYKIDAMDASLEMNNTQVFNMIVLGGLLKLAPMVDIEHVLLGLKKSLPERH-HKLIPLNEAAILKGMEIIREKE 182
258 1.000e-79JGI.Meta JGI_HUM.6531445 7039910113 SRS016989_Baylor_scaffold_912__gene_1810 ketoisovalerate oxidoreductase subunit vorA [Human Stool microbiome from visit  ali  25  1...MKQ--EIIIAGFGGQGVLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPILSQYDTAIILNQPSLAK-FENKVKPGGILIYDG---YGIIEPPTRKDIQIYRIDAMDAANERGIAKTFNMIVLGGLLKLRPVVAIESVLKALRKTLPERH-HHLIPVNEEAIHIGMEIIK... 178
259 1.000e-79gi|521284011|ref|WP_020448279.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family protein [Candidatus Methanomassi  clstr ali  45  3......TLEVRWHGRGGQGIVTANEILAGAALYEGKFMKAFPEFGPERMGAPIRAFARVSDEPIKVHSQVYFPDYVAVLDPTLININVLEGLKETGSLIVNNTASVSELKKTLDTDMDVHVVDASKIALETIGKPLANTAMLGALVKISGIVGLDSIIAEMQIKLGGKLPAPVVEKNVLSVKRAYEEVQ... 186
260 1.000e-79T2D.299916 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  45  3......TLEVRWHGRGGQGIVTANEILAGAALYEGKFMKAFPEFGPERMGAPIRAFARVSDEPIKVHSQVYFPDYVAVLDPTLININVLEGLKETGSLIVNNTASVSELKKTLDTDMDVHVVDASKIALETIGKPLANTAMLGALVKISGIVGLDSIIAEMQIKLGGKLPAPVVEKNVLSVKRAYEEVQ... 186
261 2.000e-79gi|514416197|ref|WP_016564031.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Bacteroides sp. CAG:927]  clstr ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMDNLEITWMPSYGPEQRGGTANVTVILSDAKI-SSPVLDTYDTAVILNQQSLDK-FESKVKPRGTLIYDS---YGIHRMPQRTDINVYRVDAMDATFEMKNAKTYNMIVLGALLKIRPIVSVDSVMAGLKKALPERH-HHLLPLNREAINRGMDLVK... 178
262 2.000e-79METAHIT V1 GL0011323 [Complete] locus=scaffold3321_7:6227:6796:+  ali  26  8.KVMKQ--EIIIAGFGGQGVLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPILSQYDTAIILNQPSLAK-FENKVKPGGILIYDG---YGIIEPPTRKDIQIYRIDAMDAANERGIAKTFNMIVLGGLLKLRPVVAIESVLKALRKTLPERH-HHLIPVNEEAIHIGMEIIK... 187
263 2.000e-79gi|503484508|ref|WP_013719169.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanosaeta concilii]  clstr ali  42  1......MKEIRLHGRGGQGSVTAAEIIAVAAFEDKRFSQAFPAFGVERRGAPVMAFARIADKPIRVRSQIYEPDYVIVQDVTLLDVDVASGLKPDGKIIINTDRSGEQLK--LDTKAEVITIDATKIAMEVLGRPIVNTTMLGAFCGASGEVGLESLNKAI----SERFRGELGKKNLLAIKTAYERV.... 177
264 2.000e-79gi|503409432|ref|WP_013644093.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanobacterium lacus]  clstr ali  44  1......MIEVRFHGRGGQGAVTAAEILAKAAFEDGKYCQAFPFFGVERRGAPVMAFTRIDDKPIRRRYQVYNPDYVVVLDDGLLEVDVFSGIKEGGNVIINTNNGVE-----NSNGVKINKIDATGIALDILGVPIVNTILLGAFAGVTGQVSIESLIKIINETFSG----SVAEKNVKAAKMAYDAAKK.. 176
265 3.000e-79gi|503025017|ref|WP_013259993.1| pyruvate/ketoisovalerate oxidoreductase, subunit gamma [Desulfarculus baarsii]  clstr ali  48  1......MIEVRFHGRGGQGAVTSAELMAQAAIAEGKYAQAFPSFGPERRGAPLQAFLRISDEQIRLREKIYEPDVVVVLDPSLLATNVNAGLKPDGVLVVNSAKNVEAVRGECQFNGRTAIVDASKIAEEELGVPITNTTMLGALLKAAGHVDL----KAIEKPLAARF-GRIAEKNLRALKRAYEETVIEE 182
266 3.000e-79METAHIT V1 GL0101855 [Complete] locus=scaffold5334_2:7723:8262:+  ali  25  1...MKQ--EIIISGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEKI-SSPILSKYDTAIVLNQPSLDK-FQPKVKVGGDIIYDS---FGILDKPTREDIEAYHIPAMETAAEMKMMKCFNMFVLGGLLKIHPIVSLESVMKALKKTLPERH-HDLLPLNEQAILKGMEIISK.. 179
267 3.000e-79T2D.2026735 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  1...MKQ--EIIISGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEKI-SSPILSKYDTAIVLNQPSLDK-FQPKVKVGGDIIYDS---FGILDKPTREDIEAYHIPAMETAAEMKMMKCFNMFVLGGLLKIHPIVSLESVMKALKKTLPERH-HDLLPLNEQAILKGMEIISK.. 179
268 4.000e-79gi|610423482|gb|AHW60686.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Draconibacterium orientale]  clstr ali  23  2......TEEMIIAGFGGQGVLSMGKILAYSGIMEDKEVTWFPSYGPEMRGGTANVTVIVSDTRI-SSPILQQFDTAIILNQQSMDK-FEKAVKPGGTLLYD---PNGVIHPPTRTDINIFKVEATKTAVEMGNPKVFNMIVFGSYLKVRPILSLDNVEKGLEKSLPERY-HKLIPLNLEAIKKGQEIVEDVQ 181
269 4.000e-79gi|82617390|emb|CAI64301.1| pyruvate synthase, gamma subunit [uncultured archaeon]  clstr ali  40  1......MKEIRIHGRGGQGSVTAAELLAVAAFADGKFSQAFPAFGVERRGAPVQAFTRISDSTIRLRSQIYEPDYVIVQDPTLLEVDVASGAKDDGIIIINSEFGPETFK--LDTKATIMTVDATRIALDIIGRPIVNTVLLGAFAGATGEIDPTSIQDAVKERFPGK----VGKKNAEAIQKAYDMMMEAK 181
270 4.000e-79gi|553028203|gb|AGY53620.1| 2-oxoglutarate oxidoreductase, gamma subunit [Bacteroidales bacterium CF]  clstr ali  25  1...MKE--EIIIAGFGGQGVLSMGKILAYSGIMQGQQVTWMPSYGPEMRGGTANVTVILSDSKI-SSPLLSKFDTAIILNQQSMDK-FENSVKPGGILIYD---PNGITRQPVRKDIKIYSIDAVDISNELGNSKAYNMVVLGAFLSKKSIVSMENVIKGLKKSIPERH-HHLIPMNEQAIRVGMEKIQE.. 179
271 5.000e-79gi|653038368|ref|WP_027290054.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Rikenella microfusus]  clstr ali  25  1...MKE--EIIIAGFGGQGVLSMGKILAYSGVMQGQEVSWIPSYGPEMRGGTANVTVILSDRKI-SSPVVQEFDTGIVLNQQSLDK-FEDSIKPGGTLLYD---PNGITHPPHRTDLDVYTIDAAVEAARSGNAKVFNMFVLGAFLKIKPLVTVENVIEGLRHSLPER-AHKMIPANEEALRKGMELVKKAE 181
272 5.000e-79METAHIT MH0074 GL0055570 [Complete] locus=scaffold30043_1:17:562:-  ali  25  1...MKE--EIIIAGFGGQGVLSMGKILAYSGVMQGQEVSWIPSYGPEMRGGTANVTVILSDRKI-SSPVVQEFDTGIVLNQQSLDK-FEDSIKPGGTLLYD---PNGITHPPHRTDLDVYTIDAAVEAARSGNAKVFNMFVLGAFLKIKPLVTVENVIEGLRHSLPER-AHKMIPANEEALRKGMELVKKAE 181
273 5.000e-79T2D.1268329 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  1...MKE--EIIIAGFGGQGVLSMGKILAYSGVMQGQEVSWIPSYGPEMRGGTANVTVILSDRKI-SSPVVQEFDTGIVLNQQSLDK-FEDSIKPGGTLLYD---PNGITHPPHRTDLDVYTIDAAVEAARSGNAKVFNMFVLGAFLKIKPLVTVENVIEGLRHSLPER-AHKMIPANEEALRKGMELVKKAE 181
274 5.000e-79gi|491611263|ref|WP_005468821.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit [Porphyromonas catoniae]  clstr ali  29  2......TCEIVIAGFGGQGVLSMGKILAYSGLMEDKNVSWMPSYGPEQRGGTANVTVIISDDAV-SSPLVQDYDVVIALNQPSVDK-FTPRVKPGGTLIYDTNGVSHI---PERSDIEIYEVPATDEATNMGNAKVFNMLILGAMLAVRPILPLDSIRKGLEKSLPERH-HKLIPMNMQALERG........ 173
275 5.000e-79gi|504400645|ref|WP_014587747.1| Pyruvate:ferredoxin oxidoreductase subunit C [Methanosaeta harundinacea]  clstr ali  44  40....SRLKEIRFHGRGGQGAVTAAELIAIAAFEDKKYSQAFPAFGVERRGAPVMAFARIASEPIRIRSQIYEPDYVIVQDVTLLEVDVASGLKPEGKIIINTDRDPKDLKLKTG--AEVVTIDATRIALEKLGRPIVNTTMLGAFCGATGEVSLESVNKAIL----SRFSGSLGEKNLAAIKTAYEGV.... 218
276 6.000e-79gi|501423447|ref|WP_012448117.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Natranaerobius thermophilus]  clstr ali  29  1......MQEVIMAGFGGQGVMSMGQLLTYAGMLESKGVAWMPSYGPEMRGGTANCTVVITDEEQVGSPIVSNPDTLIAMNYPSL-VKFKDSIKAGGVLLYNSSLIEEEVESI--DDVDIYPIPANEIANELGESRIANMVMLGAFIEKTHAVSIDSVLESLKKVLPEK-RHNLIPVNEKALRKGAEMVK... 179
277 6.000e-79gi|490462644|ref|WP_004333203.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas endodontalis]  clstr ali  26  2......THEIVIAGFGGQGVLSLGKILAYSGLMENKEVSWMPSYGPEQRGGTSNVTVIVSDEKV-SSPVVNQYDIVIALNQPSLDK-FAPRVKKGGILIY---EPNGIHTKTTRDDIRIYSVDATEEALKLGNDKAFNMIILGGLLKIVPVVKLDSVVAGLKKSLPERH-HKLIPMNEEAIKIGMTAIKQ.. 179
278 6.000e-79JGI.Meta JGI_HUM.0337317 7062862388 C5344568__gene_370584 2-oxoglutarate oxidoreductase, gamma subunit [Human Supragingival plaque microbiome from visit num  ali  26  2......THEIVIAGFGGQGVLSLGKILAYSGLMENKEVSWMPSYGPEQRGGTSNVTVIVSDEKV-SSPVVNQYDIVIALNQPSLDK-FAPRVKKGGILIY---EPNGIHTKTTRDDIRIYSVDATEEALKLGNDKAFNMIILGGLLKIVPVVKLDSVVAGLKKSLPERH-HKLIPMNEEAIKIGMTAIKQ.. 179
279 6.000e-79gi|494007467|ref|WP_006949929.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella marshii]  clstr ali  27  1...MKK--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDDRI-SSPILSSYDVAIVLNQPSLDK-FESKVKTGGILIYDG---FGMLHPPTRTDIEVYRIDAMDKVAEMKNSKVFNMVVLGGFLRVCPIVTESGLEKALRKTLPERH-HRLIPLNMTAVEAGKTLIQREE 181
280 6.000e-79gi|651641605|ref|WP_026627417.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Dysgonomonas capnocytophagoides]  clstr ali  25  4........EIIIAGFGGQGVLSMGKILAYSGLMEGKEVSWFPSYGPEQRGGTSNVTVILSDDVI-SSPIVSEYDIAIILNQPSLEK-FESQVKPGGIILYD---PDGIHRPPTRTDISVYKVDAMGKASEMQNQKAFNMIVLGGLLKINPVVDLEHVMMGLKKTLPARH-HGLLPMNEKAILQGMEIVEKV. 180
281 6.000e-79gi|516840489|ref|WP_018125372.1| hypothetical protein [Desulfovibrio oxyclinae]  clstr ali  43  1......MIEIRLHGRGGQGGVTSAELLAKAAIAEGKYAQAFPSFGPERRGAPVMAFVRVDDEQIRLREKIYSPDIVLVLDPSLLDVDVAEGLSENGTVVVNSAMTPEELKEKYGFP-KVATVDANKVAMEELGVPITNTTMLGALLKASGIIGV----QEMEEPIGERFGGKLGPKNFKALERAYGETMVA. 181
282 7.000e-79METAHIT MH0083 GL0122822 [Complete] locus=scaffold2599_6:19897:20448:-  ali  28  1...MKK--EIIAAGFGGQGVLSMGKILAYAGLMDDLEVTWMPSYGPEQRGGTANVTVVLSDTPI-SSPVLDAFDTAVILNQQSLDK-FESKVKPGGVLIYD---PYGIHRKPTREDITIVPVEAMEAAIEMKNAKTYNMIILGALLKVNPVVDIESVMKGLKKALPERH-HHLLPLNREAILRGMELVK... 178
283 7.000e-79T2D.1448615 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  28  1...MKK--EIIAAGFGGQGVLSMGKILAYAGLMDDLEVTWMPSYGPEQRGGTANVTVVLSDTPI-SSPVLDAFDTAVILNQQSLDK-FESKVKPGGVLIYD---PYGIHRKPTREDITIVPVEAMEAAIEMKNAKTYNMIILGALLKVNPVVDIESVMKGLKKALPERH-HHLLPLNREAILRGMELVK... 178
284 7.000e-79gi|501164171|ref|WP_012208425.1| pyruvate synthase [Petrotoga mobilis]  clstr ali  63  1..MPEKYFEIRWHARAGQGAKSASQFLTEAAEEAGKYSSSFPEYGAERSGAPMKAFNRVADVPIRLKSNIETPDVVVVIDDTLLKSEVTSGLAEDKLLLVNTSRSIEEVRKLSGYKGRIGVIPATEIALEEIKRGIPNTVMIGALIRATDVVPLDAVKEKIKAAFSKKFSDEVVRANIRALERGYQEVKLSE 191
285 8.000e-79gi|491855034|ref|WP_005635292.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Parabacteroides]  clstr ali  23  1...MKQ--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVSWMPSYGPEQRGGTANVTVILSDDRI-SSPVLNEYDIAIILNQPSMEK-FENKVKKGGIIIYDG---YGIHTPVKRTDVSVYRVDAMDAATEMKNEKAFNMLILGGLLKIVPMVKLENVLLGLKKSLPERH-HKLIPMNEAAIKKGMEIITNVQ 181
286 9.000e-79JGI.Meta JGI_HUM.5356996 7075601684 C4854629__gene_129579 ketoisovalerate ferredoxin oxidoreductase [Human Stool microbiome from visit number 1 of subject 1  ali  25  1...MKK--EIVAAGFGGQGVLSMGKILAYAGLMDDLEVTWMPSYGPEQRGGTANVTVVVSDKPI-SSPVLDAYDTAVILNQQSLDK-FESKIKPGGVLIYD---PYGIHRKPTRTDIDVYPVEAMEASIELKNAKVYNMIVLGALLKVNPVVDIESVMRGLKKALPERH-HHLLPANREAILKGMELVEV.. 179
287 9.000e-79JGI.Meta JGI_HUM.2386619 7036419810 C2166001__gene_246668 putative 2-oxoglutarate synthase subunit [Human Stool microbiome from visit number 2 of subject 76  ali  23  12.KIMTE--EIIIAGFGGQGVLSMGKILAYSGIMQDQEVAWMPSYGPEMRGGTANVTVILSDERI-SSPILTKYDTAIVLNQQSMDK-FESMVKPGGTLIYD---PNGITHEPTRKDINIYKIEGTAIAAEQGNPKVFNMIVLGGFLKVKPIVKLDNVEKGLQKSLPPRH-HKMIPMNIEAIQTGMKSVEVV. 193
288 1.000e-78gi|494422246|ref|WP_007221274.1| pyruvate ferredoxin oxidoreductase gamma subunit [planctomycete KSU-1]  clstr ali  43  1......MIEIRVHGRGGQGSVTAAELLGFAAHSDGKYAQAFPSFGSERMGAPVQAFVRISDKPIRIRSQVYKPNYVIVQDPTLLEVNVLDGLQEDGLLLINSKKKVAELG--VNTTIKVKTIPAMEIALEVIGRPIMNTTLLGAFAAATGEISLE----GIRKAIHHKFPGSVGEKNIAAVLKAFDFIKK.. 179
289 1.000e-78JGI.Meta JGI_HUM.2506661 7027895214 SRS021948_Baylor_scaffold_926__gene_997 ketoisovalerate oxidoreductase subunit vorA [Human Stool microbiome from visit n  ali  28  1...MKK--EIIIAGFGGQGVLSMGKILAYAGLMDDLEVSWMPSYGPEQRGGTANVTVILSDQPI-SSPVLDTYDVAVILNQQSLDK-FESRIKPGGILIYD---PYGIHHKPTRSDIKIYEVNGMDAAIDMKNSKTYNMILLGALLAIVPIVPVESVMKGLQKVLPERH-HHLLPLNRDAILRGMSLV.... 177
290 1.000e-78gi|504641101|ref|WP_014828203.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfosporosinus acidiphilus]  clstr ali  26  2......LQEIILAGFGGQGVMSMGQLLAYAGLEENKFVSWIPSYGPEMRGGTANCSVTISDAEV-SSPIITEPNTLIVLNRPSLEK-FEKDVRPGGWVLLNSSLIDIE---PSRQDLKVLKIPADEIANEFNNSRVANMIILGAYIHLTGAVSLESVVGALKKVLPE-YRYHLIPLNRQALELGIELAQ... 179
291 1.000e-78JGI.Meta JGI_HUM.0791120 7018926684 SRS022609_Baylor_scaffold_86040__gene_153426 hypothetical protein [Human Stool microbiome from visit number 2 of subject  ali  26  1...MKE--EILIAGFGGQGVLSMGKILAYAGLMSGLEVTWMPSYGPEQRGGTANVTVIVSDSPI-SSPVLDSYDTAVLLNQQSLDK-FENKVKPGGTLIYD---PSSIHRLPARTDIAIVAIDAMTAAIEMNNAKTYNMILLGALLKRRPIVSVDAVIKGLKKTLPERH-HHLIPLNEEAINRGMSLV.... 177
292 1.000e-78gi|504866582|ref|WP_015053684.1| pyruvate synthase, gamma subunit [Methanolobus psychrophilus]  clstr ali  43  1......MKEIRIHGRGGQGSVTAAELLAVAAFADSKFSQAFPAFGVERRGAPVQAFTRINDTPIRLRSQIYKPDYVIVQDPTLLEVDVASGLKDDGILIINSDFDPE--KFKLDTKAKIMTVNATKIALDIIGMPIVNTVLLGAFAGATGEIRPESIMEAVRERFPGK----VGDRNAQAIMEAYKMMEGQK 181
293 1.000e-78METAHIT MH0077 GL0114960 [Complete] locus=scaffold35126_3:587:1144:+  ali  23  1...MKQ--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVSWMPSYGPEQRGGTANVTVILSDDRI-SSPVLNEYDIAIILNQPSMDK-FENKVKKGGIIIYDG---YGIHTPVKRTDVSVYRVDAMDAATEMKNEKAFNMLILGGLLKIVPMVKLENVLLGLKKSLPERH-HKLIPMNEAAIKKGMEIIQ... 178
294 1.000e-78T2D.1314607 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  23  1...MKQ--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVSWMPSYGPEQRGGTANVTVILSDDRI-SSPVLNEYDIAIILNQPSMDK-FENKVKKGGIIIYDG---YGIHTPVKRTDVSVYRVDAMDAATEMKNEKAFNMLILGGLLKIVPMVKLENVLLGLKKSLPERH-HKLIPMNEAAIKKGMEIIQ... 178
295 1.000e-78gi|502259056|ref|WP_012744891.1| pyruvate synthase [Kosmotoga olearia]  clstr ali  64  1..MPEKYFEVRWHGRAGQGAKSASQLLAEAALEAGMYAQSFPEYGAERSGAPMKAFNRISDVPIRVHHTVENPDIIVIVDDTLLGSAITEGVKEDTVMIVNTVRGSNFVREKTGFKGKIFTIPATDIALEEIGRGIPNTVMIGALLKASNDIPLDAVLNRVKKMFSGKLTEEKIEANLRAVRRGYEEVK... 189
296 1.000e-78gi|500016075|ref|WP_011696793.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanosaeta thermophila]  clstr ali  44  1......MKEIRFHGRGGQGAVTAAEMIAIAAFEDGRFSQAFPAFGVERRGAPVMAFARINDKPIRMRSQVYEPDYVIVQDVTLLDVDVTGGLKSDGKIIINTDRDASALK--LNTEAEVVTIDATRIAIDTLGRPIVNTTMLGAFCGATKEVKLES----LEKSILTRFSGSLGEKNIQAVRTAYERV.... 177
297 1.000e-78METAHIT MH0036 GL0008767 [Complete] locus=scaffold82734_1:6935:7474:+  ali  22  1...MKE--EMIIAGFGGQGVLSMGKILAYSGLMDDKEVTWMPSYGPEQRGGTANVTVILSDDRI-SSPILNMYDTAIVLNQQSLD-RFESQVKPGGVLIYDS---YGIHNPPTRTDINVYCINAMEASFEMKNGKAFNMIVLGAYLKIKPVVSIENVLAGLKKAIPERHW-NLIPLNEEALKKGMSLVKE.. 179
298 1.000e-78T2D.637028 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  22  1...MKE--EMIIAGFGGQGVLSMGKILAYSGLMDDKEVTWMPSYGPEQRGGTANVTVILSDDRI-SSPILNMYDTAIVLNQQSLD-RFESQVKPGGVLIYDS---YGIHNPPTRTDINVYCINAMEASFEMKNGKAFNMIVLGAYLKIKPVVSIENVLAGLKKAIPERHW-NLIPLNEEALKKGMSLVKE.. 179
299 1.000e-78gi|496146203|ref|WP_008870710.1| pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Desulfonatronospira thiodismutans]  clstr ali  41  1......MWEIRLHGRGGQGAVTSAELLARAAISREKFAQAFPSFGPERRGAPVQAFVRVDDKKIRKREKIYQPDMVLVLDPSLLDVNVAEGLKEDGIVVVNSPQDSAELKQKHNWPG-AYTVDATKIAMDILSVPITNTTMLGALLKASGILEP----QDMEEVIMDRFGPKLGPKNFEALKKAYELA.... 178
300 1.000e-78gi|493797514|ref|WP_006745506.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Bacteroides coprosuis]  clstr ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDKKI-SSPILSSYDIAVVLNQPSLNK-FESKVKPGGVLIY---EESGIINPPTRKDIQVYRIGAIDAANEMDNSKAFNMIVLGGLLKVRPMVSLESVIKGLRETLPERH-HHLIPLNEEAINLGAKIIRQ.. 179
301 1.000e-78T2D.3597867 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYAAMLEGKEVSWMPSYGPEQRGGTANVTVIISDERI-SSPILSKYDTAVILNQPSLDK-FESQIKPGGTLIYDG---YGITIPPSRKDIRIYRIDAMDAAAELKLGPAYNMVVLGGLLKARPIIQTEHVTNALRKTLPARH-QHLIPVNEKALLKGMSIITEI. 180
302 1.000e-78gi|490491298|ref|WP_004357520.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella disiens]  clstr ali  26  3.......TEIIISGFGGQGVLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTANVTVIISDERI-SSPILSKYDVAIVLNQPSLEK-FEPKVKTGGILIYDG---FGIINPPTRSDIKTYRIDAMNKAAEMKNSKVFNMIVLGGLLKVCPIVSLDGLQKALYKTLPERH-HGMIPLNIEAVEIGKNIITETK 181
303 2.000e-78gi|497437823|ref|WP_009752021.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit [Prevotella sp. oral taxon 473]  clstr ali  26  2......TQEIIIAGFGGQGVLSMGKILAYAALMEGKEVSWMPAYGPEQRGGTANVTVIISDENI-SSPILSNYDTAILLNQPSIDK-FQPKVKPGGTLIFDG---FGVMQPPSREDINVYSVAAMNTATEMKLAKCFNMFILGSYLKVHPIVKVESVMKALRKTLPERH-HHLLPANEQAILKGMDLV.... 177
304 2.000e-78gi|502645577|ref|WP_012881934.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Dehalococcoides mccartyi]  clstr ali  43  1...MKHFIEIRWHGRGGQGAVTSAELIAQAAIGKGKYAQAFPSFGPERRGAPVQSFNRISDNPIRERSGISQPDIVVVLDPSLVIINVVSGLKEGGTLIINTTKPLEYFASQYGDRWKVATVDATAIAKEVLGVNIVNTTMLGALIKATALADMEAFEEPLKHRFG-----KLAAKNMAAMKKAFEEVKELK 188
305 2.000e-78JGI.Meta JGI_HUM.5883873 7053805477 C2705071__gene_138870 2-oxoglutarate oxidoreductase, gamma subunit [Human Tongue dorsum microbiome from visit number 2 o  ali  25  8.KAMKK--EFIIAGFGGQGVLSMGKMLAYTGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDSRI-SSPILSKYDVAVVLNQPSLDK-FEPKVKEGGILIYDGN---GIINPPKRKDIQVYRIDAMKKAIELKNAKVFNMIVLGGMLKVCPIVSVQGLEKALFKSLPERH-HHLIPLNMKAVNVGLESIEQ.. 188
306 2.000e-78gi|490130345|ref|WP_004030731.1| pyruvate ferredoxin oxidoreductase subunit gamma/delta [Methanobacterium formicicum]  clstr ali  45  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYCQAFPFFGAERKGAPVMAFSRINDKPIRRRYQVYNPDHVLVLDETLIEVDVLSGLKDGGKVIVNTKED------LKLGDADVHTIDATGIALDILGVPIVNTVMLGAFAKIIGGVSLDSIIKITKETFPGK----IGEKNAEAAKIAFEQAK... 174
307 2.000e-78JGI.Meta JGI_HUM.0058638 7030216153 C7194894__gene_350911 2-oxoglutarate oxidoreductase [Human Supragingival plaque microbiome from visit number 2 of subjec  ali  26  1...MKK--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDDHI-SSPILSSYDVAIVLNQPSLDK-FESKVKTGGILIYDG---FGMLHPPTRTDIEVYRIDAMDKVAKMKNSKVFNMVVLGGFLKVCPIVTESGLEKALRKTLPERH-HRLIPLNMTAVEAGKTLIQREE 181
308 2.000e-78gi|494500979|ref|WP_007290442.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Thermosinus carboxydivorans]  clstr ali  31  2......THEIIMAGFGGQGVMLMGQLVTYAGMIEGKQVSWIPSYGPEMRGGTANCSVIVSDEAIGA-PIVTEPTAVVAMNLPSLDK-FESALLPGGVLIINSSLIE---RSSKRDDITVYRVPANDIAAELGNSKVANMVVLGALIAATGAVATTSVLKAFQKMFAKK--PELLAINEQAIHRGAECIKK.. 178
309 3.000e-78gi|516754396|ref|WP_018085110.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfurispora thermophila]  clstr ali  28  1......MFEILIAGFGGQGVLSMGQLLAYAGMTDGRHVAWIPSYGPEMRGGTANCGVTISDKPI-SSPVVSEPTVLIAMNRPSLEK-FEKAVVPGGLILVNSSLIDIQVQ---RRDVKAFYIPANELAEEIGNSKVANNTILGALLKLTGAVSIPAVEESLKKVLPAR-RHNLIPVNLQALQVGMDFI.... 177
310 3.000e-78T2D.475342 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  26  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTCNVTVIVSDERV-SSPIVSEYDVAIVLNQPSLDK-FEPKVKKGGFLIYDTS---GIINPPKRTDITVCPIAALDKAVEMKNSKVFNMIVLGGLLKVCPVVSDKGVEKALYKTLPERH-HGLIPLNMEAIKAGREIIK... 178
311 3.000e-78gi|502828835|ref|WP_013063811.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella ruminicola]  clstr ali  27  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPILSKYDIAVVLNQPSLEK-FEPKIKPGGILIYDG---FGIINKPTRKDITVYEINAMDKAAEMKNGKVFNMIVLGGLLKVAPVVSDKGVEKALYKTLPERH-HGLIPLNMEALKEGAKIIQEIK 181
312 3.000e-78gi|494607266|ref|WP_007365513.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Porphyromonas uenonis]  clstr ali  24  3.......YEIVISGFGGQGVLSMGKIIAYSGIMENKEVSWMPSYGPEQRGGTSNVTVIVSDEPV-SSPVVNEYDVVIVLNQPSLDK-FGPRVKKGGILIYDPALIQ---HKSDRKDINIYEVPATEQSMEMGNDKIFNMIILGGMLKAAPMLKLESIIAGLKKSLPERH-HKLIPLNEEAIKRGMNSLSKV. 180
313 3.000e-78gi|500775754|ref|WP_011994034.1| pyruvate synthase [Fervidobacterium nodosum]  clstr ali  68  30.....NIFEIRWHGRAGQGAKSASQMLAEAALDMGKYVQAFPEYGAERTGAPMKAFNRISDEPILLHSSVETPNLVVVIDDTLLSPDILAGTNEETVLIVNTVRSIEWVRQKSGFKGKICVVKATDIALEELGRGTPNTVMLGAIARVTGVIELKYVEDKIRDMFLKKFGEEVVNKNIRALHRGYEEV.... 213
314 4.000e-78METAHIT MH0068 GL0042485 [Complete] locus=scaffold54612_2:506:1087:+  ali  46  1...MNDMIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNTPIRIHSNIYDPDYVVVVDDTLLGVDVTAGLKPNGAIVINTTKDIDYLRKVLGYSGAIYTIDARKVSMETLGKYFPNTPMLAAIVKVANIMEENDFLKDMEGSFKHKFKPEVIDGNMKALEVALKEVKK.. 191
315 4.000e-78T2D.1165054 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  46  1...MNDMIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNTPIRIHSNIYDPDYVVVVDDTLLGVDVTAGLKPNGAIVINTTKDIDYLRKVLGYSGAIYTIDARKVSMETLGKYFPNTPMLAAIVKVANIMEENDFLKDMEGSFKHKFKPEVIDGNMKALEVALKEVKK.. 191
316 4.000e-78JGI.Meta JGI_HUM.1734188 7024854104 SRS013951_WUGC_scaffold_48237__gene_81841 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate f  ali  46  1...MNDMIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNTPIRIHSNIYDPDYVVVVDDTLLGVDVTAGLKPNGAIVINTTKDIDYLRKVLGYSGAIYTIDARKVSMETLGKYFPNTPMLAAIVKVANIMEENDFLKDMEGSFKHKFKPEVIDGNMKALEVALKEVKK.. 191
317 4.000e-78gi|517797942|ref|WP_018968150.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella loescheii]  clstr ali  26  1...MK--HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDQRI-SSPVLSKYDVAIVLNQPSLDK-FEPRVKPGGILIYDGN---GIASPPSRTDIKVYRMDAMDKAAEMKNAKVFNMIVLGGLLKVCPVVSTEGLNKALFKTLPERY-HNLIPLNMEAVEQG........ 173
318 4.000e-78gi|505138698|ref|WP_015325800.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Halobacteroides halobius]  clstr ali  47  1...MASLTEIRWHGRGGQGAKTASILLGKVAAKTGKHIQAFPEYGPERMGAPVLAYNRISEDDITVHCQVTDPGIVTVLDPTLLNVDVTDGVPEDGTLVVNSEEDVATIKEQLEFDGDIWVLDAYGVANKEIGRPFPNTPMLGALMQATDLLPFENFVKQIKVELEKKFKPEMIDKNVAAIKRAYKEVAK.. 190
319 4.000e-78gi|499625285|ref|WP_011306019.1| pyruvate ferredoxin oxidoreductase, gamma subunit [Methanosarcina barkeri]  clstr ali  41  1......MKEIRIHGRGGQGSVTAAEMLSVAAFEDGKFSQAFPAFGVERRGAPVQAFTRINNNPIRLRSQVYTPDYVIVQDATLLEVDVASGVKDDGIIIVNTTENPESLK--LNTKARVMTVDATKVAMDIIGVPIVNTVLLGAFAGATGEINVESIQHAIRARFSGK----VGEKNANAIQKAYKLIRGEE 181
320 4.000e-78JGI.Meta JGI_HUM.3166631 7033891879 C5464584__gene_236464 hypothetical protein [Human Supragingival plaque microbiome from visit number 1 of subject 6048120  ali  25  2......TEEIIVAGFGGQGVLSMGKILAYSGIMQGQEVSWMPSYGPEMRGGTANVTVILSDTRI-SSPIVQEYDTVIALNQQSLDK-FEPRVKKGGTLIYD---PNGISTPPSRTDISIYKIAAADEAAKMNNSKTFNMIVLGGLLKVKPIVELGNVEKGLTKSLPERH-HKLIPLNMDAVKRGMEIVEKV. 180
321 4.000e-78gi|560430017|ref|WP_023625495.1| hypothetical protein [Bacillus sp. 17376]  clstr ali  26  1......MEEILIAGFGGQGVMSMGQLIAYAGMTEGRYVSWLPSYGPEQRGGTANCAVVVSEEQVG-SPIVSRPTTVIVLNNPSYEK-FEPMVRAGGLLVVNSSLIS---KVSARTDIRVLTIDATDKANELGNPKVANMVLLGAFLEETGILSDESILEALKKVLSP-EKHSLLEINRRALELGRSLTKE.. 178
322 4.000e-78gi|496509701|ref|WP_009217984.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Bacteroidetes oral taxon 274]  clstr ali  26  1...MKK--EIIIAGFGGQGVLSMGKILAYSGLLEGKEVTWMPAYGPEQRGGTANVTVQISDKKI-SSPILKFYDIAIVLNQPSMDK-FEERVKPGGILIYDSN---GMTRKPNRKDISVYRIDATDKALEMGAQKTFNMIVVGGLLKADPMVKTENVMLALKKSLPERH-HKLLPANEEAMKVGMQIIEK.. 179
323 4.000e-78JGI.Meta JGI_HUM.0552661 7070015465 SRS047634_LANL_scaffold_50025__gene_56789 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate f  ali  26  1...MKK--EIIIAGFGGQGVLSMGKILAYSGLLEGKEVTWMPAYGPEQRGGTANVTVQISDKKI-SSPILKFYDIAIVLNQPSMDK-FEERVKPGGILIYDSN---GMTRKPNRKDISVYRIDATDKALEMGAQKTFNMIVVGGLLKADPMVKTENVMLALKKSLPERH-HKLLPANEEAMKVGMQIIEK.. 179
324 5.000e-78gi|503673950|ref|WP_013908026.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Thermodesulfatator indicus]  clstr ali  44  1......MIEVRLHGRGGQGAVTSAELIAISAINQGNYAQAFPSFGPERRGAPVMAFVRISDQRIRTREKVYNPDIVVVLDPSLPTVNVTDGLKKDGWVVLNSAKDEKTLREILGFKGKLAVVDATKIAIEELGLPITNTTMLGAFLKATGLVDQEYLEEALEHRFG-----RLAEKNKAAMARAIKETKIY. 182
325 5.000e-78gi|518983647|ref|WP_020139522.1| 2-oxoacid:acceptor oxidoreductase subunit gamma [Streptomyces sp. 351MFTsu5.1]  clstr ali  40  1......MFQVRIHGRGGQGAVTAAELLSVAAFVEGRYAQAFPSFGSERTGAPVMAFCRIDDRPIRVREPVMRPDALVVQDPTLLHVDVFDGLHPGGAVLVNSPLTAAELGLAELVVARVLTVPATALALRHFGRPVPNAVLLGGLAALTGCVAIDSLTAAVRERFPG----SLGTANADAAREAYEHVK... 181
326 5.000e-78gi|499327960|ref|WP_011018452.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanopyrus kandleri]  clstr ali  44  1......MIEIRIHGRGGQGAVTAAEILAIAAKEDGKYSQAFPFFGVERRGAPVTAFARIDDEFIKIRSQIYEPDHVIVLDSSLLAVDVTEGLPEDGLIVINAREEELDKIMEKFEDSDVYTVDATQIALDELGVPIVNTAMVGAYLKASDILTLDAVKKAI----HARFSGEIAEKNVRAVERAYREVKAV. 182
327 6.000e-78gi|652500340|ref|WP_026894740.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Clostridiisalibacter paucivorans]  clstr ali  26  1......MDEIIIAGFGGQGVMAMGQLLTYSGMIEDKNVAWLPSYGPEMRGGTANCNVLISDEPIGA-PVVTEATAAVVMNLPSLDK-FEKDVVPGGKLFINSSLID---KKCSRDDIDVYYVPVNDLANDLGNAKVANMVMLGAFLELTNAVKVDSILEAFKKVFGE-NKSHLLPINEKALEKGASVVK... 178
328 6.000e-78gi|498109903|ref|WP_010424059.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Anaerophaga thermohalophila]  clstr ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYSGVIQDMEVSWMPSYGPEMRGGTANVTVVLSDHRI-SSPILHSFDTAIILNQQSLDK-FEPKVKPGGVLLYDSN---GITRHPERDDINIYRIDATEEAARMKSTKTMNMIVLGAYLKIKPIIEMENILKGLRKSLPQRH-HHLLPMNEKAIQRGKEIVSEV. 180
329 6.000e-78METAHIT MH0080 GL0144139 [Complete] locus=scaffold92103_1:10565:11101:-  ali  25  1...MKE--EIVIAGFGGQGVLSMGKILAYAGLMDNLEVSWMPSYGPEQRGGTANVTVILSDSRI-SSPVLDTFDTAVILNQQSLDK-FESRVKPGGTLIYD---PYGIHHAPTRTDIRIVPVEAMEATFEMKNAKTYNMILLGALLACRPVVSLDAVIRGLRKTLPERH-HHLIPLNEEALRKGMALVK... 178
330 6.000e-78T2D.1380583 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  1...MKE--EIVIAGFGGQGVLSMGKILAYAGLMDNLEVSWMPSYGPEQRGGTANVTVILSDSRI-SSPVLDTFDTAVILNQQSLDK-FESRVKPGGTLIYD---PYGIHHAPTRTDIRIVPVEAMEATFEMKNAKTYNMILLGALLACRPVVSLDAVIRGLRKTLPERH-HHLIPLNEEALRKGMALVK... 178
331 6.000e-78T2D.101500 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPVLSKFDIAIVLNQPSLDK-FESRVKPGGILIY---EGNGIINPPTRTDIDIYRIDAMDKAAELKNTKVFNMIVLGGMLKVSPVVSENGVEKALFKTLPERH-HKLIPLNMEAIKIGGDIMQK.. 179
332 6.000e-78JGI.Meta JGI_HUM.0463714 7058231662 SRS049959_WUGC_scaffold_43331__gene_82613 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit [Human Stool mic  ali  25  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPVLSKFDIAIVLNQPSLDK-FESRVKPGGILIY---EGNGIINPPTRTDIDIYRIDAMDKAAELKNTKVFNMIVLGGMLKVSPVVSENGVEKALFKTLPERH-HKLIPLNMEAIKIGGDIMQK.. 179
333 6.000e-78gi|547913341|ref|WP_022316210.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase gamma subunit [Prevotella sp. CAG:592]  clstr ali  25  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPVLSKFDIAIVLNQPSLDK-FESRVKPGGILIY---EGNGIISPPTRTDIDIYRIDAMDKAAELKNTKVFNMIVLGGMLKVSPVVSENGVEKALFKTLPERH-HKLIPLNMEAIKIGGDIMQK.. 179
334 8.000e-78gi|503676298|ref|WP_013910374.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Thermodesulfobacterium geofontis]  clstr ali  42  1......MIEIRIHGRGGQGAVTSAELIAVAAINEGKFAQAFPSFGPERRGAPVQAFARIGEERIRTREKIYHPDIILVLDPSLPKIKVTEGLKENGVAILNSHLSEEEVRKILGYKGKLALVNATKIAIEEIGVPITNTTMLGALLKATGLIEVKSMEEALKERFG-----KLAEKNIKALHRALEETQIYK 183
335 9.000e-78gi|517148338|ref|WP_018337156.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Butyricimonas synergistica]  clstr ali  23  2......TEEIIIAGFGGQGVLSMGKILAYSGIMQDQEVAWMPSYGPEMRGGTANVTVILSDERI-SSPILTKYDTAIVLNQQSMDK-FESMVKPGGVLIYD---PNGITHEPTRKDINIYKIEGTAIAVEQGNPKVFNMIVLGGFLKIKPIVKLENVEKGLQKSLPARH-HKMIPMNIEAIQTGMNSVEVV. 180
336 9.000e-78JGI.Meta JGI_HUM.0252669 7004286699 C4270394__gene_357628 2-oxoglutarate ferredoxin oxidoreductase, gamma subunit [Human Stool microbiome from visit number  ali  24  5........EIIIAGFGGQGVLSMGKILAYSGVMQGLEVSWMPSYGPEMRGGTANVTVILSDRQI-SSPIVHDYDTAIILNQQSMDK-FEPRVKPGGVLIYD---PNGVVRPPQRKDIRVYAIPATEEAARLGNIRVFNTMILGGYLKVKPVVSLDNVFRGLAKSLPERM-ASLIPANEAAIQKGMEIIRVSE 182
337 9.000e-78gi|496343635|ref|WP_009052813.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Thermoanaerobacter]  clstr ali  29  1......MEEIIFAGFGGQGVLSMGLIITYAGMFEGKNVSWTPSYGPEMRGGTAYCNVTVSDEEVG-SPVITEATSVIVMNRPSLDK-YESYVIPGGKLFINTLLVD---RKAERKDIEVYEIPANDIANELGNLKIANMVMLGAFIEATKVVKLETVLKALPEVF-GKGKEHLIPINEKALNKGAELVK... 178
338 9.000e-78JGI.Meta JGI_HUM.1908395 7045753154 C3039935__gene_176366 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  45  1..................GAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSNIYEPDYVVVVDDTLLEVEVTAGLKEDGAIIINTTKNYDYLKNVLGYNGKVYTIDAREISMEALGKYFPNTPMLAAVVKVTGIMTDEEFLNDMQGSFKHKFKPEVIDGNMKALQLALNQV.... 174
339 1.000e-77gi|652920830|ref|WP_027174704.1| pyruvate synthase [Desulfovibrio aminophilus]  clstr ali  39  1......MIEIRIHGRGGQGGVTSAELLARAAIADGRFAQAFPSFGPERRGAPVQAFVRVDGKKIRLREKIYEPDLVLVLDPTLLDVDVAEGLKEGGMVVVNSAQPAEELKRKYGWP-KAACVDAGKVALEELGVPITNTTMLGALLKASGLLDVD----GMREVIDERFGPKLGPKNYKALERAFRET.... 178
340 1.000e-77gi|517172693|ref|WP_018361511.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella nanceiensis]  clstr ali  26  1...MKK--EFIIAGFGGQGVLSMGKMLAYTGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDNRI-SSPILSKYDVAVVLNQPSLDK-FEPKVKEGGILIYDGN---GIINPPKRKDIQVYRIDAMKKAIELKNAKVFNMIVLGGMLKVCPIVSVQGLEKALFKSLPERH-HHLIPLNMKAVNVGLESIEQ.. 179
341 1.000e-77gi|630829780|gb|KCZ71493.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Candidatus Methanoperedens nitroredu  clstr ali  39  1......MKEIRIHGRGGQGSVTAAELLAVAAFEDGKYSQAFPAFGVERRGAPVTAFVRLSDKPIRLRSQIYEPDYVIVQDATLVDVDVEKGAKCDGIILINTEKNPSSFKFDTKASIK--TLDATKLAMDFIGKPIVNTTLIGAFAGVSGLIRPESIINAVMERFPG----PIGEKNAKAIQAAYDLME... 178
342 1.000e-77gi|567928041|ref|WP_024030634.1| pyruvate/ketoisovalerate oxidoreductase [Bacillus vireti]  clstr ali  26  1...MNMLEEIIIAGFGGQGVMSMGQLIAYAGMLEGKGVSWLPSYGPEQRGGTANCAVVVSDEPVG-SPLVTRPSTAIVLNNPSFDK-FEPRVRHEGLLIINSSLV---VGTSERKDIKVLEIPATDIANDLGNSRVANMILLGAFLELTKLVSTDSIIESLKKVLSS-EKHHLIEVNKQALIKGAALV.... 179
343 1.000e-77gi|547372807|ref|WP_022063532.1| 2-oxoglutarate ferredoxin oxidoreductase gamma subunit [Alistipes sp. CAG:157]  clstr ali  25  1...MKE--ELIIAGFGGQGVLSTGKILAYSGVMQDYEVSWLPSYGPEMRGGTANVTVIISDKPI-SSPTLQTFDTAIILNQQSMDK-FESQVKPGGVLIYDTN---GITRHPQRKDIKIYVIDATEEAAKRGNSRIFNTLILGGYLKVRPIVTLENVYKGLKKSLPERAWKSL-PMNEEAIRIGMDIIKEIQ 181
344 1.000e-77METAHIT V1 GL0103851 [Complete] locus=scaffold2978_4:1335:1880:-  ali  25  1...MKE--ELIIAGFGGQGVLSTGKILAYSGVMQDYEVSWLPSYGPEMRGGTANVTVIISDKPI-SSPTLQTFDTAIILNQQSMDK-FESQVKPGGVLIYDTN---GITRHPQRKDIKIYVIDATEEAAKRGNSRIFNTLILGGYLKVRPIVTLENVYKGLKKSLPERAWKSL-PMNEEAIRIGMDIIKEIQ 181
345 1.000e-77T2D.2107049 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  1...MKE--ELIIAGFGGQGVLSTGKILAYSGVMQDYEVSWLPSYGPEMRGGTANVTVIISDKPI-SSPTLQTFDTAIILNQQSMDK-FESQVKPGGVLIYDTN---GITRHPQRKDIKIYVIDATEEAAKRGNSRIFNTLILGGYLKVRPIVTLENVYKGLKKSLPERAWKSL-PMNEEAIRIGMDIIKEIQ 181
346 1.000e-77JGI.Meta JGI_HUM.1405978 7016951870 SRS052697_LANL_scaffold_73714__gene_159617 2-oxoglutarate ferredoxin oxidoreductase, gamma subunit [Human Stool microbio  ali  25  1...MKE--ELIIAGFGGQGVLSTGKILAYSGVMQDYEVSWLPSYGPEMRGGTANVTVIISDKPI-SSPTLQTFDTAIILNQQSMDK-FESQVKPGGVLIYDTN---GITRHPQRKDIKIYVIDATEEAAKRGNSRIFNTLILGGYLKVRPIVTLENVYKGLKKSLPERAWKSL-PMNEEAIRIGMDIIKEIQ 181
347 2.000e-77gi|516804592|ref|WP_018109468.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Bacteroides propionicifaciens]  clstr ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMEDKEVTWMPSYGPEQRGGTANVTVIVSDERI-SSPIVSTFDIVVVLNQPSLEK-FESKVKPGGLLIY---EESTIINPPTRTDIKVHSIAAIDAANEMHNSKAFNMIVLGGLLKLKPMVSTEGVLKGLFKTLPERH-HHLIPVNEQAITLGGQIIK... 178
348 2.000e-77gi|640558784|ref|WP_024990317.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prevotella albensis]  clstr ali  27  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMENKEVTWMPAYGPEQRGGTANVTVIISDNRI-SSPILSSYDIAIVLNQPSLDK-FESKVKPGGILIYDG---FGVMNPPKRKDIKVYRIDAMDKAAEMKNSKVFNMIVLGGLLQVCPILPDKALEKALYKTLPERH-HNLIPLNMEAVGEGRKIINE.. 179
349 2.000e-77JGI.Meta JGI_HUM.2312088 7004878074 C3886371__gene_246334 2-oxoglutarate oxidoreductase, gamma subunit [Human Tongue dorsum microbiome from visit number 1 o  ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIISDEKI-SSPILSQYDTAILLNQPSLDK-FQPKVKIGGTIIYDS---FGIIEKPKREDINNFCLDAMNTAAEMKLMKTFNMMVLGGFLKLHPIVSIESVMKALKKSLPERHW-DLLPMNEQAILKGMEII.... 177
350 2.000e-77gi|493568431|ref|WP_006521719.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfotomaculum gibsoniae]  clstr ali  28  1......MFEILIAGFGGQGVLSTGQLLAYAGMMEDKHVAWIPSYGPEMRGGTANCGVTISSEPI-SSPVVSEPTVLIAMNRPSLEK-FEPAVAPGGLILVNSSLINI---KTKRTDVRTVYVPANDMAEELGNGKVANNIILGALLELTGVVSNDAVLESLKKVLPPK-RHNLIPINGEALEKGRQLAR... 178
351 2.000e-77gi|503303483|ref|WP_013538144.1| pyruvate synthase [Thermovibrio ammonificans]  clstr ali  53  1......MIEIRWHARGGQGAVTASKILASAVIREGKYAQSNPDYGAERSGAPLRAYNRVSEEPITLHCMVLNPDIVVVVDPTLLKVPFLEGTSEDAVLVINTNKTPQEVREKYNIQGKIYTVDATKIAMEELKRPLMNVPMLGALVKVLGLVDIKTVEEDIKKTFGKKISENALAANVRALYRAYEEVK... 186
352 2.000e-77JGI.Meta JGI_HUM.3272199 7058544087 SRS011529_WUGC_scaffold_18283__gene_34262 2-oxoglutarate oxidoreductase, gamma subunit [Human Stool microbiome from visi  ali  24  1...MKQ--EIIISGFGGQGVLSMGKILAYAALMEKKEVTWMPAYGPEQRGGTANVTVIISDEPI-SSPILSSYDTAILLNQPSLDK-FQSKVKTGGTLIYDS---FGIIDKPSRTDIISWHIPAMETAAEMSMMKCFNMFILGGFLKVHPIVSIESVMKALHKTLPERH-HDLLPMNEQAILKGRDIISK.. 179
353 3.000e-77gi|498348581|ref|WP_010662737.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Marinilabilia salmonicolor]  clstr ali  24  11..VMKE--EIIIAGFGGQGVLSMGKILAYSGVMQGQEVTWMPSYGPEMRGGTANVTVVLSDNRI-SSPILHAFDTAIILNQQSMDK-FEPLVKPGGLLLYD---PNGITRHPEREDINIYKIEAAEEAAQLKSAKTFNMIVLGAFLKIKPVVEMENVLKGLKKSLPERH-HHLIPMNEKAIQRGVEIVKEV. 191
354 3.000e-77JGI.Meta JGI_HUM.7340007 7073746025 SRS023468_LANL_scaffold_12683__gene_26332 hypothetical protein [Human Posterior fornix microbiome from visit number 1 of  ali  27  1...MK--TEIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPILSMYDIAIVLNQPSLDK-FMPKVKPGGILIYDG---FGIMDKPNRDDITIYRIDAMDKAAEMKNSKVFNMIVLGGLLKVAHVVSTDGINKALFKTLPERH-HGLIPLNMEALGVGMDIIKKV. 180
355 3.000e-77gi|495688070|ref|WP_008412649.1| Pyruvate/ketoisovalerate oxidoreductase [Desulfotomaculum hydrothermale]  clstr ali  27  2......LQEILIAGFGGQGVLSTGQLLAYAGMLENKQVAWIPSYGPEMRGGTANCGVTISDEPI-SSPLVTEPTTLIVMNRPSLEK-FEPAVVPGGLILINASLVD---RQVKRNDVQVMEIHANQIAEELGNVKVANNVILGALIELTGIVSVESVVESLKKVLPAR-RHNMIPVNRQALEKGAQLAREMK 181
356 3.000e-77gi|503126051|ref|WP_013360712.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [[Clostridium] sticklandii]  clstr ali  22  2.....QTQKIICAGFGGQGVMSMGQLITYAGMLESKEVSWLPSYGPEMRGGTANCSVIVSETPIGSPVITNDATSAIIMNLPSLTK-FEKDVAPGGSIFINRSLIE---KKVERTDVDVYYIDANEIALELGNPRVANMVMLGALIEINKTVSIDSVLEAFKKVFGPS-KEKFVPLNKEAIEKGMQAVRES. 182
357 3.000e-77METAHIT V1 GL0094072 [Complete] locus=scaffold11853_1:1466:2023:+  ali  23  5........EIIIAGFGGQGVLSMGKILAYSGVMQGLEVSWMPSYGPEMRGGTANVTVILSDRQI-SSPIVHDYDTAIILNQQSMDK-FEPRVKPGGVLIYD---PNGVVRPPQRKDIRVYAIPATEEAARLGNIRVFNTMILGGYLKVKPVVSLDNVFRGLAKSLPERM-ASLIPANEAAIQKGMEIIRVPE 182
358 3.000e-77T2D.1938853 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  23  5........EIIIAGFGGQGVLSMGKILAYSGVMQGLEVSWMPSYGPEMRGGTANVTVILSDRQI-SSPIVHDYDTAIILNQQSMDK-FEPRVKPGGVLIYD---PNGVVRPPQRKDIRVYAIPATEEAARLGNIRVFNTMILGGYLKVKPVVSLDNVFRGLAKSLPERM-ASLIPANEAAIQKGMEIIRVPE 182
359 3.000e-77gi|503608932|ref|WP_013843008.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfotomaculum ruminis]  clstr ali  28  2......LQEILIAGFGGQGVLSTGQLLAYAGMLEGKQVAWIPSYGPEMRGGTANCGITISDEPI-SSPLVTEPTTLIIMNRPSLDK-FENTVVPGGLILVNSSLVE---QKVKRTDVKVMEIPANRIAEELGNGKVANNVILGVLIELTKIVSIEAVVESLKKVLPSRH-HRLIPVNQLALEKGAQLAK... 178
360 4.000e-77gi|488933092|ref|WP_002844167.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Peptostreptococcus]  clstr ali  25  6.........VICAGFGGQGVMSMGQLMTYAGMLENKEVSWLPSYGPEMRGGTANCAVTISDEPVGSPIITDDATAAVIMNSPSLTK-FEGDVVPGGTILINSSLVHE---KCERDDIEAYYINANELSNELGGSKFANMVMLGAFLAVDSSVDIESVLEAFKKVFGKR-KEKFIPVNRQALQAGYDAV.... 179
361 4.000e-77gi|491750135|ref|WP_005583268.1| conserved hypothetical protein [Clostridium ultunense]  clstr ali  29  1......MEEITIAGFGGQGVMAIGQLLTYAGMIEGKHVSWLPSYGPEMRGGTANCSVIVSSEPVG-SPVVVNSTTAIVMNKPSLDK-FESTVNPEGRLFINSSLIE---QKSGREDIEVYYIPANEIADELGNMRVANMVMLGAYLEVTKIVDLESILEGFTKVFGE-NRAHLIPINKDALERGAETAR... 178
362 4.000e-77METAHIT MH0059 GL0091528 [Complete] locus=scaffold29395_3:378:917:+  ali  25  2......TNELIISGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEKI-SSPILSTFDTAILLNQPSLEK-FENKIKPGGTLIYD---AFGISEPPTRTDISIYRINAMDVAAELKMMKAFNMVVLGSFLKVHPIVTIENVIKALKKTLPLRH-HNLIPLNEQAIKKGMEII.... 177
363 4.000e-77T2D.989050 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  2......TNELIISGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEKI-SSPILSTFDTAILLNQPSLEK-FENKIKPGGTLIYD---AFGISEPPTRTDISIYRINAMDVAAELKMMKAFNMVVLGSFLKVHPIVTIENVIKALKKTLPLRH-HNLIPLNEQAIKKGMEII.... 177
364 5.000e-77JGI.Meta JGI_HUM.7571157 7021038390 C784795__gene_58244 hypothetical protein [Human Posterior fornix microbiome from visit number 2 of subject 159005010] :_  ali  25  1...MK--TEIIISGFGGQGVLSMGKILAYSGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDQRI-SSPILSKYDVAIVLNQPSLDK-FEEKVKPGGILIY---EGNGIINPPKRTDIQIYRINAVEKAAELKNSKVFNMIVLGGLLGVCPVVSNDGLQKALYKTLPERH-HGLIPLNMEAVEAGKSIMKK.. 179
365 5.000e-77JGI.Meta JGI_HUM.2309765 7004858999 C3838891__gene_227259 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Tongue  ali  25  6.........VICAGFGGQGVMSMGQLMTYAGMLENKEVSWLPSYGPEMRGGTANCAVTISDQPVGSPIITDDATAAVIMNSPSLTK-FEGDVVPGGVILINSSLVHE---KCSRDDIEAYYIDANELSNELGGPKFANMVMLGAFLAVDDSVNIESVLEAFKKVFGKR-KEKFIPVNRQALEAGYNAV.... 179
366 5.000e-77gi|546379562|ref|WP_021853315.1| keto/oxoacid ferredoxin oxidoreductase gamma subunit [Prevotella sp. CAG:255]  clstr ali  26  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTCNVTVIVSDERV-SSPIVSEYDVAIVLNQPSLDK-FEPKVKKGGFLIYDTS---GIINPPKRTDITVCPIAAMDKAVEMKNSKVFNMIVLGGLLKVCPVVSDKGVEKALYKTLPERH-HGLIPLNMEAITAGKEII.... 177
367 5.000e-77METAHIT MH0021 GL0016683 [Complete] locus=scaffold168_2:356:892:+  ali  26  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTCNVTVIVSDERV-SSPIVSEYDVAIVLNQPSLDK-FEPKVKKGGFLIYDTS---GIINPPKRTDITVCPIAAMDKAVEMKNSKVFNMIVLGGLLKVCPVVSDKGVEKALYKTLPERH-HGLIPLNMEAITAGKEII.... 177
368 5.000e-77JGI.Meta JGI_HUM.1642634 7049438142 SRS051031_LANL_scaffold_22816__gene_44309 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit [Human Stool mic  ali  26  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTCNVTVIVSDERV-SSPIVSEYDVAIVLNQPSLDK-FEPKVKKGGFLIYDTS---GIINPPKRTDITVCPIAAMDKAVEMKNSKVFNMIVLGGLLKVCPVVSDKGVEKALYKTLPERH-HGLIPLNMEAITAGKEII.... 177
369 6.000e-77gi|544696280|ref|WP_021127424.1| pyruvate ferredoxin/flavodoxin oxidoreductase family protein [[Clostridium] sordellii]  clstr ali  26  6.........VICAGFGGQGVMSMGQLLTYAGMLEEKEVSWLPSYGPEMRGGTANCSVTISDIPVGSPVITDDATCAIVMNLPSLDK-FEKDVVPGGKILVNNSLID---KKVERTDVKSYYIPANELALELGNPRVANMIMLGAYLELNKCVEVESVLEAFKKVFGPS-KEKFVPLNKEALMKGAEAVKSQE 183
370 7.000e-77JGI.Meta JGI_HUM.5548169 7037370633 C1863691__gene_128962 hypothetical protein [Human Stool microbiome from visit number 1 of subject 160582958]  ali  27  2......TEEILISGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIISDENI-SSPVLSEYDTAILLNQPSLEK-FEHKIKPGGILIYDT---FGISTPPTRSDINVYKIDAMDVAAENKMMKAFNMVVLGAYLKVRPILNSTDIVSALKKSLPERH-HNLIPMNEKAILKGMDLIK... 178
371 8.000e-77gi|499735263|ref|WP_011415997.1| pyruvate:ferredoxin oxidoreductase subunit gamma [Syntrophus aciditrophicus]  clstr ali  47  1......MIEVRWHGRGGQGAVTSVELLALAAIGEGRYAQGFPSFGPERRGAPVEAFNRINDTRIKKRQRIYRPDVVVVLDPGLISVNVSEGLKPEGLLIINTSKSLKEIEKHIQFKGRIALVDATAIAWKELKVPITNTTMLGALVKMTDVVKLESLNEPIEHRFG-----RIANRNLAAMKLAYDEV.... 178
372 8.000e-77gi|490167970|ref|WP_004066615.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase, gamma subunit [Eubacterium plexicaudatum]  clstr ali  47  1...MNNGLEIRWHGRGGQGAKTAALLLADAAFQTGQYVQGFPEYGPERMGAPITAYNRIGREPIRVHSNIYTPDLVLVVDETLLHVDVTAGLKEEGAVIINTPKTREELLPLLGYRGSVYTVDARKISEETLGKNFPNSPMLAAAVAVSGVMEKEAFLKEMRSLYGHKFKPEVIEGNMQALYRTFDE..... 188
373 8.000e-77gi|519103677|ref|WP_020259552.1| hypothetical protein [Aminicenantes bacterium SCGC AAA252-F08]  clstr ali  27  2......LQEMIFAGFGGQGVLSMGELLAYAAMKEGKNISWMPSYGPEKRGGTANCMVNISDQQI-SSPIVSEYDAAVVLNLPSLKK-FESRVKKGGILIWESSNIKE---PPTRKDINIYALPAYEIATDLNNIKVMNMIMLGALVKLNKLVKTESLLLALKETLPERH-HHLIPLNKKAIEIGMGLVQ... 179
374 8.000e-77gi|503178680|ref|WP_013413341.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanothermus fervidus]  clstr ali  43  1......MIEIRFHGRGGQGAVTAAEILAKAAFYDGKYSQAFPFFGVERRGAPVLAFVRIDNKPIRIRYQVYKPNYVIVLDDKLVEVDVFKGLHEPAVVVINS---KNEIKKE---GVKIYSVDATNIALETLGSPIVNTAMLGAFVGATKIIKLDSLIKAIKNSF----KDKIGEKNAKAAVKGYESV.... 173
375 9.000e-77gi|503633021|ref|WP_013867097.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanothermococcus okinawensis]  clstr ali  45  1......MIEIRFHGRGGQGAVTAAQILAKAAFYDGKFSQAFPFFGVERRGAPVMAFTRIDDKKIRLRSQIYEPDYVIVQDPTLLDIDIKGGLKKGGKIVVNTHNNLQF------SDCEVYTIDATGIALEVLGLPIVNTAMLGAFTGVTGEVTIESLKKAIMDTFPKK----LGEKNAKVAEVAYNMVK... 174
376 1.000e-76gi|503949559|ref|WP_014183553.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfosporosinus orientis]  clstr ali  26  5.........IILAGFGGQGVMSMGQLLAYAGLVEKKHVSWIPSYGPEMRGGTANCSVTISDEEV-SSPIITEPDTLIVLNRPSLEK-FEKDVKRGGRLLINSSLIQIE---SQRQDLQVLKIDASEMAREIGNNRVSNMIILGAFIELTRSVTLESVIGALKQVLPE-YRYNLIPLNRQALEKGIQLAK... 178
377 1.000e-76JGI.Meta JGI_HUM.7569828 7021036349 C782953__gene_56203 hypothetical protein [Human Posterior fornix microbiome from visit number 2 of subject 159005010] :_  ali  24  2......TYEIVIAGFGGQGVLSMGKTIAYSGMMEDKEVSWMPSYGPEQRGGTSNVTVIVSDEKV-SSPVLNSYDIAITLNQPSLDK-FAPRVKKNGILIY---EPNGIHTITDRKDINIYEVDATEIANAMGNDKLFNMIILGGLLKLVPFVKYESVITGLKKSLPERH-HKLIPLNEEAIKRGMEAIK... 178
378 1.000e-76gi|516660753|ref|WP_018027763.1| MULTISPECIES: hypothetical protein [Porphyromonas]  clstr ali  27  1...MKKSYEIVISGFGGQGVLSMGKILAYSGLMGGKEVSWMPSYGPEQRGGTANVTVIISEEGI-SSPILNEYDVAIVLNQPSMDK-FLPMVKKGGIVLYDSNGVS---HVPERDDINVFRVDAVDESVKMNNTKVFNIIVLGGLLKVAPMVDINNIEAGLKKSLPERH-HKLIPLNLDALKRGMEIV.... 179
379 1.000e-76METAHIT V1 GL0073571 [Complete] locus=scaffold22961_6:498:1058:-  ali  27  1...MKKSYEIVISGFGGQGVLSMGKILAYSGLMGGKEVSWMPSYGPEQRGGTANVTVIISEEGI-SSPILNEYDVAIVLNQPSMDK-FLPMVKKGGIVLYDSNGVS---HVPERDDINVFRVDAVDESVKMNNTKVFNIIVLGGLLKVAPMVDINNIEAGLKKSLPERH-HKLIPLNLDALKRGMEIV.... 179
380 1.000e-76T2D.2092127 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  27  1...MKKSYEIVISGFGGQGVLSMGKILAYSGLMGGKEVSWMPSYGPEQRGGTANVTVIISEEGI-SSPILNEYDVAIVLNQPSMDK-FLPMVKKGGIVLYDSNGVS---HVPERDDINVFRVDAVDESVKMNNTKVFNIIVLGGLLKVAPMVDINNIEAGLKKSLPERH-HKLIPLNLDALKRGMEIV.... 179
381 1.000e-76JGI.Meta JGI_HUM.1501298 7054068203 C2677685__gene_239453 putative 2-oxoglutarate oxidoreductase gamma subunit [Human Stool microbiome from visit number 1 o  ali  27  1...MKKSYEIVISGFGGQGVLSMGKILAYSGLMGGKEVSWMPSYGPEQRGGTANVTVIISEEGI-SSPILNEYDVAIVLNQPSMDK-FLPMVKKGGIVLYDSNGVS---HVPERDDINVFRVDAVDESVKMNNTKVFNIIVLGGLLKVAPMVDINNIEAGLKKSLPERH-HKLIPLNLDALKRGMEIV.... 179
382 1.000e-76METAHIT MH0012 GL0034999 [Complete] locus=scaffold93051_1:5374:5952:-  ali  43  10.......TEICWHGRGGQGVVTANEILAESAIYSGKYVKAFPEFGPERMGAPIRAFSRISDGPVRVHTQVYEPDIVIVIDPTLIKVDVAKGLKKGGFILANYEGTPAELQKAIGTTAECHSVNASKIALEEIGKPLVNTAMLGALIKIRPIITYSEMEDNITDKFTGKLSDKLIVKNLSALKRAYEEVE... 192
383 1.000e-76T2D.284961 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  43  10.......TEICWHGRGGQGVVTANEILAESAIYSGKYVKAFPEFGPERMGAPIRAFSRISDGPVRVHTQVYEPDIVIVIDPTLIKVDVAKGLKKGGFILANYEGTPAELQKAIGTTAECHSVNASKIALEEIGKPLVNTAMLGALIKIRPIITYSEMEDNITDKFTGKLSDKLIVKNLSALKRAYEEVE... 192
384 1.000e-76gi|570736328|gb|AHF07359.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Desulfitobacterium metallireducens DSM 15288]  clstr ali  27  2......LQEIILAGFGGQGVMSMGQLLAYAGMFEGEHVSWIPSYGPEMRGGTANCSVTLSDLPI-SSPVISEPNTLIVLNRPSLEK-FEKGLKTGGLLLMNSSLIDI---SPQRDDIQVVKIPSDDLANKFGNSRVANMILLGAFLELTHAVSLESVEKALKKVLPE-YRYNLISMNRDALELGVSIVK... 179
385 1.000e-76gi|499507719|ref|WP_011194359.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Symbiobacterium thermophilum]  clstr ali  30  3......THEILIAGFGGQGVLTAGQLLAYAGNLEGQHVSWVPAYGPEQRGGTANCSVVISDQPVAC-PMVSEPTACIVLNQPSLEK-FTPAVQPGGTLVVNTSLCTG---RATRTDITVVPVPATDLAVELGNVRFANMIALGALLAVVPVVKVESILEVLPKVMGE-DKARYIPINREALSRGMEEARRV. 181
386 1.000e-76JGI.Meta JGI_HUM.6189657 7016201163 SRS063288_LANL_scaffold_48609__gene_81403 2-oxoglutarate oxidoreductase, gamma subunit [Human Tongue dorsum microbiome f  ali  26  1...MK--HEIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDSRI-SSPVLSKYDVAIVLNQPSLDK-FQPRVKPGGILIYDGN---GIASPPTRTDIKVYRMDAMDKAAEMRNAKVFNMIVLGGLLKVCPVVSTEGLNMALFKTLPERY-HNLIPLNMEAVEQG........ 173
387 1.000e-76gi|504366405|ref|WP_014553507.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Halanaerobium praevalens]  clstr ali  24  1..MMKE--EVIMAGFGGQGVMSIGKLLSYAGMKESKEVSWMPSYGPEMRGGTANCTVIVSDKKIP-SPLSSKPDSIIVMNLPSLDK-FAPKVKSGGTIFVNSSLISKEV---ERDDVEVVKIPANKIANELGNNKAANMAMLGAYIAKKEIVSLDTVKNSLENVLPER-RHGLIPINEKALAKGNEI..... 177
388 2.000e-76gi|496709728|ref|WP_009348496.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Alloprevotella rava]  clstr ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIISDEKI-SSPILSRFDTAILLNQPSLDK-FQPKVKAGGTIIYDS---FGIIEKPTREDVNNFCLDAMNTAAEMKLMKTFNMMVLGGFLKLHPIVSVKSVMKALKKSLPERHW-DLLPMNEQAILKGMEIIHE.. 179
389 2.000e-76gi|548184569|ref|WP_022405627.1| pyruvate/2-ketoisovalerate family 2-oxoacid:acceptor oxidoreductase gamma subunit [Prevotella sp. CAG:485]  clstr ali  27  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMDDKEVTWMPSYGPEQRGGTANVTVILSDEKI-SSPVLDKYDVVIALNQQSLDK-FGPKVKPGGILIYDT---DGIHNPCHRDDITIYPIDAMGATLAIGNSKAYNMIVMGALLEVMPYLPMENVIKGLKKSLPERH-HKLIPMNEQAIEKGRELVK... 179
390 2.000e-76METAHIT V1 GL0111234 [Lack 5`-end] locus=scaffold86132_1:8:541:-  ali  22  1...........IAGFGGQGVLSMGKILAYSGIMQDQEVAWMPSYGPEMRGGTANVTVILSDERI-SSPILTKYDTAIVLNQQSMDK-FESMVKPGGTLIYD---PNGITHEPTRKDINIYKIEGTAIAAEQGNPKVFNMIVLGGFLKVKPIVKLDNVEKGLQKSLPPRH-HKMIPMNIEAIQTGMNSVEVV. 174
391 2.000e-76gi|547186438|ref|WP_021928344.1| putative uncharacterized protein [Alistipes sp. CAG:831]  clstr ali  23  1...MKE--EIIIAGFGGQGVLSMGKILAYSGIMQDQEVAWMPSYGPEMRGGTCNVSVILSDKKI-SSPILSKFDTAIILNQQSLDK-FESRVKPGGLLVYD---PNGITHHPTRTDISIYKIDAADEAAKLGNAKAYNMIVLGAFLKVKPIVKMENVTAGLKKSLPPRH-HNLIPMNEQAIKVGMDAVVKV. 180
392 2.000e-76gi|502801850|ref|WP_013036826.1| pyruvate ferredoxin oxidoreductase, subunit gamma [Methanohalophilus mahii]  clstr ali  39  1......MKEIRIHGRGGQGSVTAAELLAGAAFEDSQFSQAFPAFGVERRGAPVQAFTRISDAPIRLRSQIYEPDYVIVQDPTLIEVDVESGAKDDGIILINSDFAPEDFD--LDTNARIMTVNATKVALDIIGRPIVNTVLLGAFAGATGEVRASSIVNAVK----GRFSGKIGEKNAEAVQKAYDLMAEEK 181
393 3.000e-76gi|502885563|ref|WP_013120539.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Thermincola potens]  clstr ali  25  4........ELIIAGFGGQGVMSMGQLLTYAGMIEDKHVAYIPSYGPEMRGGTANCSVTISDREI-SSPVFTEPSSVIIMNQPSLAK-FEPMLKPGGLMLINSSLVS---QKATRQDIRVLEIPGNEMAEKLGNGKVANIVLLGAYIEMTKVVTIDSIIESLKKVLPER-RHNLIPLNRQALELGAEIVQK.. 179
394 3.000e-76gi|505305571|ref|WP_015492673.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Thermoplasmatales archaeon BRNA  clstr ali  43  3.......TEICWHGRGGQGVVTANEILAESAIYSGKYVKAFPEFGPERMGAPIRAFARISDTPVRVHTQVYEPDIVIVIDPTLIKVDVAKGLKKGGFILANYEGTSAELQKAIGTTAECHAVKASKIALEEIGKPLVNTSMLGALIKIRPIISYSEMEDHITDKFTGKLSDKLIVKNLTALKRAYDEVE... 185
395 3.000e-76gi|652505602|ref|WP_026899911.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Peptostreptococcaceae bacterium VA2]  clstr ali  24  6.........VICAGFGGQGVMSMGQLLTYAGMLEGKEVSWLPSYGPEMRGGTANCAVTVSDSPVGSPLITGDATCAIVMNLPSLEK-FESEVKPGGKIIVNSSLIE---QKVQRDDIEVYYIPANDIASDLGNPKVANMIMLGAYLETEPAVEVDSVLEAFKKVFGPS-KEKFVPLNKDALLKGGAAIK... 180
396 4.000e-76gi|503209385|ref|WP_013444046.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Paludibacter propionicigenes]  clstr ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMQGQEVSWMPSYGPEQRGGTANVTVILSEERI-SSPVLNSYDTAIVLNQPSLD-RFESKVKPGGTLIFDGN---GFHKFPTRTDINVYRIDATEYAYANDSAKTMNMIILGGLLKVRPIVQVENVLKGLKKSLPERH-HHLLASNEKAIQIGMGLIQKI. 180
397 4.000e-76JGI.Meta JGI_HUM.2827226 7007347930 SRS016095_WUGC_scaffold_29363__gene_72915 hypothetical protein [Human Stool microbiome from visit number 1 of subject 76  ali  27  2...............GGQGVLSMGKILAYAALMEGKEVSWMPSYGPEQRGGTANVTVIISDQRI-SSPILSRYDTAVILNQPSLEK-FEPCIKPGGTLIYDGYGITE---PPRRKDIAVYRIDAMDTAAELHNPKGFNMIVLGGLIKVRPLVETENVIQALKKTLPERH-HALIPMNEEALRRGMEVI.... 168
398 5.000e-76METAHIT MH0030 GL0015692 [Complete] locus=scaffold8887_1:3515:4057:-  ali  25  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPVLSKYDIAIVLNQPSLDK-FESRVKPGGVLIY---EGNGIINPPTRKDIDIYRIDAMDKAAELKNTKVFNMIVLGGMLSVAPVVSEKGVEKALFKTLPERH-HKLIPLNMDAIKVGGEIMQK.. 179
399 5.000e-76gi|653272241|ref|WP_027470175.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Cytophaga fermentans]  clstr ali  22  2......TEELIIAGFGGQGVLSMGKILAYSGVMQDMEVSWMPSYGPEMRGGTANVTVILSDEKI-SSPILHEFDTAIILNQQSMDK-FEKQVKPGGTLIYDGN---GITNHPTRKDISIYRVDATEEAAKMRTTKTFNMIVLGGYLKVKPVVKMENVINGLKKSLPERH-HHLIPMNEKAINRGMDIIIPVE 181
400 6.000e-76gi|500974169|ref|WP_012036589.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanocella arvoryzae]  clstr ali  42  1......MKEIRIHGRGGQGSVTAAELIAVAAFEDGKWSQAFPYFGTERRGAPVTAFARIADRQIRVRSQIYEPDYVIVQDPSLISVDVAGGVRENGLLLINSEKKPSELK--INTKARVRTFDATKLALEVIGLPIVNTALLGAFAGATGEIRLESVNKAIR----GRFAGKVADKNIAAVKKAYELM.... 177
401 7.000e-76METAHIT MH0057 GL0041651 [Complete] locus=scaffold13986_3:7167:7757:-  ali  25  18...MKQ--EIIISGFGGQGVLSMGKILAYAALMEGKEVTWMPAYGPEQRGGTANVTVIISEEPI-SSPILSSYDSAILLNQPSLDK-FQPKVKPGGTLIYDS---FGIIEKPVRTDIESWQIPXXXXXXXXXXXKCFNMFVLGGYLKLHPIVSIESVMKALRKTLPERH-HGLLPMNEQAILKGMEII.... 194
402 7.000e-76gi|551218309|ref|WP_022846247.1| pyruvate synthase [Desulfurobacterium sp. TC5-1]  clstr ali  48  1......MIEIRWHARGGQGAVTASKILASSAIREGKYAQSAPDYGAERAGAPLRSFNRVSENPITLHCLVLHPDIVVVVDPTLLKVPILEGTSEDAVLVINTDKTPQEIRSMLNIEGKIFTVNASAIAMEEFGKPFMNVPMLGALVKVINLVSLDSVKEDIKATFGKKVSKELLEANLRALERAYKEVK... 186
403 7.000e-76gi|651362816|ref|WP_026475166.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Alkaliflexus imshenetskii]  clstr ali  23  1...MNE--EIIIAGFGGQGVLSMGKILAYSGVMQDMEVSWMPSYGPEMRGGTANVTVILSDSRI-SSPILKKYDTAIILNQQSMDK-FEKSIKPGGLLLYDGN---GITRHPERTDINICRVDAAEEASKMNSSKTFNMIVLGAYLKLRPIVTMDNVMEGLKKSLPERH-HHLLPLNRDAIVRGTEIVKSV. 180
404 8.000e-76gi|500169126|ref|WP_011843551.1| pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Methanoculleus marisnigri]  clstr ali  39  1......MRELRIHGRGGQGSVTAAELIAYAAFEGGVFSQAFPAFGVERRGAPVQAFVRFSDEKVRLRSQIYEPDYIIVQDPTLIDVDVFNGMKAGGIAIINTEKSDFDSGVPEG--VKVYTIDATTIALEELGVPITNTTLMGAFAAATGEIGLEPLEHALR----SRFSGSMADKNVRAAERAYNLI.... 177
405 8.000e-76JGI.Meta JGI_HUM.0215084 7004198443 C4204138__gene_269372 hypothetical protein [Human Stool microbiome from visit number 1 of subject 160400887]  ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYAALMNDLEVSWMPAYGPEQRGGTANVTVILSDTPI-SSPVLDSYDIAVVLNQQSLDK-FEPKVKPGGLLIYDS---YGIHRAPQRGDITVHEIKAMDATFDMGNSKAYNMVVLGALLGIRDLVPLDAVMRGLKKTLPERH-HHLLSMNEEAIQLGMTLVNE.. 179
406 1.000e-75gi|502730419|ref|WP_012965403.1| pyruvate/ketoisovalerate oxidoreductase, subunit gamma [Ferroglobus placidus]  clstr ali  37  1..MSFILIEVRFHGRGGQGAVTAADILAIAGFKQGYYTLSFPMFGAEKRGTPVVSFLRISDKPIVVRDEVRNPDYVVVMDPSLLDVDVLAGIKKGGMLIANYPKGSEELKEKLKEDVEIYTINATKMATEILGRPITNTAMVGAFVGATNVVKLEYVEEAIREFFEDK---DIAEKNVQLVRKAYEYMREV. 188
407 1.000e-75METAHIT MH0011 GL0124775 [Complete] locus=scaffold37346_1:10948:11493:+  ali  23  1...MKE--EIIIAGFGGQGVLSMGKILAYSGIMQDQEVAWMPSYGPEMRGGTCNVSVILSDKKI-SSPILSKFDTAIILNQQSLDK-FESRIKPGGLLVYD---PNGITHHPTRTDIQIYKIDAADEAAKMGNAKAYNMIVLGAFLKVKPIVKMENVTAGLKKSLPPRH-HNLIPMNEQAIKVGMEAAVKV. 180
408 1.000e-75T2D.189941 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  23  1...MKE--EIIIAGFGGQGVLSMGKILAYSGIMQDQEVAWMPSYGPEMRGGTCNVSVILSDKKI-SSPILSKFDTAIILNQQSLDK-FESRIKPGGLLVYD---PNGITHHPTRTDIQIYKIDAADEAAKMGNAKAYNMIVLGAFLKVKPIVKMENVTAGLKKSLPPRH-HNLIPMNEQAIKVGMEAAVKV. 180
409 1.000e-75JGI.Meta JGI_HUM.0206034 7004166933 C4167179__gene_237862 hypothetical protein [Human Stool microbiome from visit number 1 of subject 160400887]  ali  27  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMDDKEVTWMPSYGPEQRGGTANVTVILSDEKI-SSPVLDKYDIVIALNQQSLDK-FGPRVKEGGILIYDT---DGIHNPCRREDISIYPVDAMGATLQMGNSKAYNMIVMGALLEVMPYLPMENVVKGLKKSLPERH-HKLIPMNEQAIEKGRELVRK.. 180
410 1.000e-75gi|545043913|ref|WP_021418780.1| pyruvate ferredoxin/flavodoxin oxidoreductase family protein [Peptoclostridium difficile]  clstr ali  22  6.........VICAGFGGQGVMSMGQLLTYAGMLEGKEVSWLPSYGPEMRGGTANCAVTVSNEPVGSPLITDDATAAILLNIPAFEK-FKDDVIPGGKIIVNSSLIKE---KVDRTDVDVYYIPANELAAELGNDKVANMIMLGAYLKVSDTVDIESVLEAFKKVFGPR-KEKFVPLNREALQKGMDAT.... 179
411 1.000e-75T2D.1977978 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  22  1...........MAGFGGQGVLSMGKILAYSGIMQDQEVAWMPSYGPEMRGGTANVTVILSDERI-SSPILTKYDTAIVLNQQSMDK-FESMVKPGGTLIYD---PNGITHEPTRKDINIYKIEGTAIAAEQGNPKVFNMIVLGGFLKVKPIVKLDNVEKGLQKSLPPRH-HKMIPMNIEAIQTGMNSVEVV. 174
412 1.000e-75JGI.Meta JGI_HUM.5704856 7011083964 SRS024625_LANL_scaffold_5217__gene_7521 ketoisovalerate oxidoreductase subunit vorA [Human Stool microbiome from visit n  ali  24  197.........IIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPILSQYDTAIILNQPSLEK-FEGKIKPGGILIYDG---YGIIEPPTRKDIQIYRIDAMDAANEKGMAKTFNMIVLGGLLKLRPVVSIESVIKALRKTLPERH-HHLIPMNEEAXKE......... 364
413 1.000e-75gi|511308260|ref|WP_016359004.1| pyruvate ferredoxin oxidoreductase gamma subunit PorC [Methanobrevibacter sp. AbM4]  clstr ali  43  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYSQAFPSFGVERRGAPVSAFTRIDEKPIELRYQIYNPDHILVLDDGLANVDIYSGIKENSDVVINTHKDISSDKIP------VHKIDATKIALDVLGRPIVNTIILGYFAKKSGVVSIESLEKVIKDVFPGK----VGEKNVRAVREAYE...... 171
414 1.000e-75gi|501770080|ref|WP_012635625.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Halothermothrix orenii]  clstr ali  23  1...MKE--EMIIAGFGGQGVMLMGKLLAYAGMKEGIEVSWMPSYGPEMRGGTANCTVIMSSNKIP-SPLSSKPDTIIVMNLPSLEK-FAPRVKPGGTIFVNSSLIEKEV---DRDDVEVIKVPANELANELGNSKVANMVMLGAYLSKKDVVDLNTVKDSLKSVLSRRH-HKLIPINEKALDTG........ 173
415 2.000e-75METAHIT unmapped GL0452654 unmapped_[Lack_3`-end]_[mRNA]_locus=scaffold221710_1:208:678:+  ali  46  1...MSNHTEIRWHGRGGQGAKTAALLLADVAFQTGKYVQGFPEYGPERMGAPITAYNRISDTKIRVHSNIYDPQYVVVVDESLLEVDVTSGLKKDGAILVNTQRTKEEIIPHLGYEGEVYIIDAHKVSMEAMGKYFPNTPLLAAIVKVAGIMDEETFL.................................. 157
416 2.000e-75T2D.2334400 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  46  1...MSNHTEIRWHGRGGQGAKTAALLLADVAFQTGKYVQGFPEYGPERMGAPITAYNRISDTKIRVHSNIYDPQYVVVVDESLLEVDVTSGLKKDGAILVNTQRTKEEIIPHLGYEGEVYIIDAHKVSMEAMGKYFPNTPLLAAIVKVAGIMDEETFL.................................. 157
417 2.000e-75JGI.Meta JGI_HUM.4386876 7076108670 C3787997__gene_199418 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Tongue  ali  46  1...MKDLIEIRWHGRGGQGAKTASLLFADAAFNTGKYIQGFPEYGPERTGAPLTAYNRISTKPIRSHYNVYYPDYVVVVDDTLLDVSVTQGLKADGAIVINTTKNLEDFEKSLGYTGNVFTIDARKISEETIGKYFPNTAMLAAIVKITGIMNDEDFLNDMQDSFKHKFKPEVISGNVKAIERALTEV.... 189
418 2.000e-75gi|653089496|ref|WP_027339735.1| pyruvate synthase [Halonatronum saccharophilum]  clstr ali  44  1...MRKILEIRWHGRGGQGSKTASILLGKVAAKTGKNIQAFPEYGPERMGAPVLAYNRISDDLITLHCQVTEPSIVAVLDPTLLEVDVTEGVPDDGIIIVNVGMEPKELKEKLEFKGEVYTVDAYGISTEEIGAPFPNTPMLGALIKAADLLDFDKFLEEVKKEFKKKHKPEVVDGNMNSIKRAYEEVR... 189
419 2.000e-75T2D.968500 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  18...MKQ--EIIISGFGGQGVLSMGKILAYAALMEGKEVTWMPAYGPEQRGGTANVTVIISEEPI-SSPILSSYDSAILLNQPSLDK-FQPKVKPGGTLIYDS---FGIIEKPVRTDIESWQIPXXXXXXXXXXXKCFNMFVLGGYLKLHPIVSIESVMKALRKTLPERH-HGLLPMNEQAILKGMEII.... 194
420 2.000e-75gi|490131938|ref|WP_004032310.1| MULTISPECIES: pyruvic-ferredoxin oxidoreductase, gamma subunit [Methanobrevibacter]  clstr ali  39  1......MIEIRFHGRGGQGSVTAAEILAKAAFKDGKYVQSFPFFGVERRGAPVMAFTRIDDKPIDIRYQVYNPDYVLVLDDGLMNVDVFSGIKENTEVIIN---IAEEFKGSGEHP--VHSIDATGIALDLLGRNIVNTIILGYFAKKTNVVSIESLIEVIKETFPGK----VGELNAEATKKAYD...... 172
421 2.000e-75METAHIT MH0011 GL0109236 [Complete] locus=scaffold92833_2:9352:9876:+  ali  39  1......MIEIRFHGRGGQGSVTAAEILAKAAFKDGKYVQSFPFFGVERRGAPVMAFTRIDDKPIDIRYQVYNPDYVLVLDDGLMNVDVFSGIKENTEVIIN---IAEEFKGSGEHP--VHSIDATGIALDLLGRNIVNTIILGYFAKKTNVVSIESLIEVIKETFPGK----VGELNAEATKKAYD...... 172
422 2.000e-75T2D.3217250 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  39  1......MIEIRFHGRGGQGSVTAAEILAKAAFKDGKYVQSFPFFGVERRGAPVMAFTRIDDKPIDIRYQVYNPDYVLVLDDGLMNVDVFSGIKENTEVIIN---IAEEFKGSGEHP--VHSIDATGIALDLLGRNIVNTIILGYFAKKTNVVSIESLIEVIKETFPGK----VGELNAEATKKAYD...... 172
423 2.000e-75JGI.Meta JGI_HUM.1205807 7037945222 SRS014923_WUGC_scaffold_59854__gene_128973 pyruvate synthase subunit porC [Human Stool microbiome from visit number 1 of  ali  39  1......MIEIRFHGRGGQGSVTAAEILAKAAFKDGKYVQSFPFFGVERRGAPVMAFTRIDDKPIDIRYQVYNPDYVLVLDDGLMNVDVFSGIKENTEVIIN---IAEEFKGSGEHP--VHSIDATGIALDLLGRNIVNTIILGYFAKKTNVVSIESLIEVIKETFPGK----VGELNAEATKKAYD...... 172
424 2.000e-75gi|651337688|ref|WP_026460680.1| 2-oxoacid:acceptor oxidoreductase [Actinomyces suimastitidis]  clstr ali  38  1......MVEVRIHGRGGQGVVTASDLLAMAAFTDGHHAQAFPSFGSERTGAPVVSFCRITDTEIRTREPVLEPDVVVVQDPTLLPVDVFAGLKANGYALVNSTKSLDELGQQAHPHGHVLTLPAFDIARKHLGRPVPNVVMLGGVAALTGLIRLDSMAEAIRRRFPGR----LGEANVAAATEAFDTI.... 183
425 2.000e-75gi|501051727|ref|WP_012103342.1| pyruvate synthase [Clostridium kluyveri]  clstr ali  43  1...MTQLTEIRWHGRGGQGAKTASLLLADVAFSIGKYVQGFPEYGPERMGAPITAYNRISGEKILVHSNIYEPDYXXXXXXXXXXXXXXKGLKKEGAIIINTEKSQEEVKKHLGYSGNVYIINAREISEACLGKYFPNTPMLAAVVKVSEVMDENTFIEQMRASFKHKFKSEVIEGNMKALERSLKEVRK.. 191
426 3.000e-75gi|647586360|ref|WP_025863526.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Prolixibacter bellariivorans]  clstr ali  25  2......TEEIIIAGFGGQGVLSMGKILAYSGVMQDQEVTWFPSYGPEMRGGTANVSVIISDERI-SSPILHEFDTAIILNQQSLDK-FEEQVKPGGVLLYD---PNGIVHPPTRKDINIYKVEGARLAAEMGNPKTFNMIVMGAYLKVKPIFGMEKVKKGLEKSLPERH-HKLIPLNLEAIEVGMETV.... 180
427 4.000e-75gi|492782633|ref|WP_005962661.1| pyruvic-ferredoxin oxidoreductase, gamma subunit [Actinomyces cardiffensis]  clstr ali  41  1......MVEVRIHGRGGQGVVTASDLLAMAAFTDGHHAQAFPSFGSERTGAPVVAFCRIAETEIRTREPVLEPDVVVVQDPTLLSVDVFAGLKPEGYALLNSTKSFEELGLSELVKGHAITLPAFDLAREHVGRPVPNAVMLGGIAALTGLIRLQSVTDAIRHRFPGK----VGDANVSAATAAYDLV.... 183
428 4.000e-75gi|496182881|ref|WP_008907388.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Caloramator australicus]  clstr ali  30  5........EIIFAGFGGQGILSMGKFLAHAGLEENLNVSWFPSYGPEMRGGTSNCSVIVSDEPIGA-PLVTDATAVVVMNRPSLDK-FERYVVKGGLLIMDSDLVN---REPERTDIEVIKIPAQRIAEEVGSKKIANMVLLGALVEKTKIVSMESLLKALK----EHGKEQFYELNKKALERGAEFAK... 176
429 4.000e-75METAHIT MH0025 GL0012835 [Complete] locus=scaffold64011_2:991:1545:-  ali  30  2.....KTERIIFAGFGGQGVMSMGQMLAYAGMIENKHVTWCPSYGPEMRGGTANCSVVVSDELVGSPLISHDATAAVIMNLPSLTK-FEKDILPGGVLLINSSLIE---KKSERDDIKVAYVEANKIAGDLGNSRAANMVMLGALLSLDNIVSFESIQQAFIKVFGER-KKEFLPGNEKALNAGAESVK... 180
430 4.000e-75T2D.486692 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  30  2.....KTERIIFAGFGGQGVMSMGQMLAYAGMIENKHVTWCPSYGPEMRGGTANCSVVVSDELVGSPLISHDATAAVIMNLPSLTK-FEKDILPGGVLLINSSLIE---KKSERDDIKVAYVEANKIAGDLGNSRAANMVMLGALLSLDNIVSFESIQQAFIKVFGER-KKEFLPGNEKALNAGAESVK... 180
431 4.000e-75JGI.Meta JGI_HUM.4076297 7031876347 SRS056259_LANL_scaffold_52211__gene_115897 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate  ali  30  2.....KTERIIFAGFGGQGVMSMGQMLAYAGMIENKHVTWCPSYGPEMRGGTANCSVVVSDELVGSPLISHDATAAVIMNLPSLTK-FEKDILPGGVLLINSSLIE---KKSERDDIKVAYVEANKIAGDLGNSRAANMVMLGALLSLDNIVSFESIQQAFIKVFGER-KKEFLPGNEKALNAGAESVK... 180
432 5.000e-75JGI.Meta JGI_HUM.0388946 7049017410 C5091961__gene_253407 putative 2-oxoglutarate synthase subunit [Human Stool microbiome from visit number 1 of subject 15  ali  27  1...MKD--EIIIAGFGGQGVLSMGKILAYAALENDQEVTWMPSYGPEQRGGTANVTVILSTDPI-SSPVLDSYDTAVILNQQSLDK-FESHVKPGGVLIYD---PYDIHRAPTRTDIKVVPVNAMEATIAMGQSKAYNMILLGALLAMRPDVPVEAVVRGLKKALPERH-HHLIPVNEQAIRKGMELV.... 177
433 5.000e-75METAHIT V1 GL0047589 [Complete] locus=scaffold11154_35:1586:2158:+  ali  47  1...MSQLTEIRWHARAGQGAVTAAKLVADTALLQGNYIQAMPEYGPERTGAPLKAYTRVSSEPIEVHNNIQNPDIVIILDDTLLSTDVMEGMNENGILLFNTTMTPEEARAAVNAPVRVATIDASGIALATIKKDMPNTPIVGALAKITGLFPLDLVKERLVITFGKKFSQEMIDANLASVERAYQEVQE.. 190
434 5.000e-75T2D.2190281 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  47  1...MSQLTEIRWHARAGQGAVTAAKLVADTALLQGNYIQAMPEYGPERTGAPLKAYTRVSSEPIEVHNNIQNPDIVIILDDTLLSTDVMEGMNENGILLFNTTMTPEEARAAVNAPVRVATIDASGIALATIKKDMPNTPIVGALAKITGLFPLDLVKERLVITFGKKFSQEMIDANLASVERAYQEVQE.. 190
435 5.000e-75gi|504626178|ref|WP_014813280.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Desulfomonile tiedjei]  clstr ali  42  1......MIEMRFHGRGGQGAVTCAELVAQAAIDTGRYATAFPSFGPERRGAPVIAFARVDEQPIRLRSKIYAPDVVVVLDPSLLDISPAVGLRDNGILIVNSPYDPETLKKHLGYQNRIAVVDAGRIAREVLGLPITNTTMVGALVKGTGIMDVESLKAPFRKRFG-----KIADRNIQAMERAFNETLVV. 181
436 6.000e-75gi|545428058|ref|WP_021666420.1| 2-oxoacid:ferredoxin/flavodoxin oxidoreductase, gamma subunit [Porphyromonas sp. oral taxon 278]  clstr ali  25  2......TYELVIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPSYGPEQRGGTSNVTVIISDTAV-SSPLVQNYDVVIALNQPSLDK-FCPRVKPGGILLFDTNGIHSI---PRRDDIEYYEIPAMDEAMAMGNAKVFNMLILGALLKLRPMISVDSIRRGLEKSLPPRH-HGMIPMNIEAVERGGAIVRPH. 180
437 6.000e-75gi|500835983|ref|WP_012003788.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Thermotoga lettingae]  clstr ali  28  2......MHSIIFAGFGGQGVMLMGQVLAQAAMNEGKHTTWFPSYGPEMRGGTANCTVVVSDEPV-ASPVVDTPLEVVAMNIPSLLK-FEPKLKKDGYLFINTSVID---RKPQRNDVKVIEIPANDIAEKLGNVKVANMVVLGAFVYTTKCTEVDSLIEAMKYKLSAKNS-EIIELNVKAIFEGVKHV.... 177
438 6.000e-75gi|502720366|ref|WP_012955350.1| pyruvate ferredoxin oxidoreductase gamma subunit PorC [Methanobrevibacter ruminantium]  clstr ali  41  1......MIEIRFHGRGGQGAVTAAEILAKAAFKDGKYSQAFPFFGVERRGAPVMAFTRIDTEPINLRYQVYNPDHVIVLDDGLLNVDVYSGLKENGEVIINTH------EKVESESHKVFDVDATGIALEILGVNIVNTIILGYFAKKTGEVSINSLIEVIKETFPG----PIGEKNAVAAQKAYDMA.... 173
439 6.000e-75gi|503031040|ref|WP_013266016.1| Pyruvate:ferredoxin oxidoreductase (POR) and 2-oxoglutarate:ferredoxin oxidoreductase (KGOR), gamma subunitubunit [A  clstr ali  43  8......MLEIRWHGRGGQGAVTASEVIASASIIEGKYALAFPEFGAERRGAPVRAYTRVTDSPLIPRTPIEHPDVVVVLDRSLLKPSYIEGLKDGGILVANSPLKPDELLQKLGFAYRAATVDATSVAMKWLKANIVNTAILGALVKSTEIVKLDTVLDVIR----SRFHGKIAEANVMAVKEAYDLTQLS. 190
440 6.000e-75gi|557424280|ref|WP_023426318.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [uncultured Acidilobus sp. CIS]  clstr ali  46  3......MLEIRWHGRGGQGAVTASEVIASASILEGKYALAFPEFGAERRGAPVRAYTRVTDTPLIPRTPVERPDVVVILDRSLIKQNYVEGLKEGGIVVANTPAKPSELLEKLGLRGRAATVDATSIALKWLKANIVNTAILGALVRSTGVVKLDTVLEVIKSRFHGR----VAEANVMAIKEAYESTQLS. 185
441 7.000e-75JGI.Meta JGI_HUM.1510244 7054094332 C2738654__gene_265582 hypothetical protein [Human Stool microbiome from visit number 1 of subject 160502038]  ali  20  1...MKETL--IIAGFGGQGVLSMGKILAYSGVMQDFEVTWMPSYGPEMRGGTANVTVILSDRKI-SSPIAYQYDTAIILNQQSMDK-FEAKVRPGGTLIYDTN---GITHHPTRTDIRIYTINAAEESAKLGNSKLFNTMILGGYLKVCPVVTLENVALGLKKSLPER-AWKMLPENEKAIRHGAEIIRQV. 180
442 7.000e-75gi|502607998|ref|WP_012845066.1| pyruvate oxidoreductase subunit gamma [Rhodothermus marinus]  clstr ali  48  1......MLEIRWHGRGGQGAITVSKILALAALRSGKYAQAFPEYGPERSGAPVRAYNRLDDRPIVLHSGVYTPHRVAVLDETLLEEDVCEGLAPDGVLVINTTRPPEAIREQTGYPGRIVCVDAAAIAEET-GSRFANVPLLGALASTLEFIQLPTLEGALQAFLGKR-RPEVVEANLEALRRGYRETVALE 185
443 8.000e-75JGI.Meta JGI_HUM.0020299 7029977670 SRS023595_Baylor_scaffold_97879__gene_112428 2-oxoglutarate oxidoreductase, gamma subunit [Human Supragingival plaque mi  ali  25  2......TYELVIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPSYGPEQRGGTSNVTVIISDTAV-SSPLVQNYDVVIALNQPSLDK-FCPRVKPGGVLLFDTNGIHSI---PRRDDIEYYEIPAMDEAMAMGNAKVFNMLILGALLKLRPMISVDSIRRGLEKSLPPRH-HGMIPMNIEAVERGGAIVRPH. 180
444 8.000e-75gi|495791294|ref|WP_008515873.1| pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Dethiobacter alkaliphilus]  clstr ali  41  1..MGSKVTEIRWHARGGQGAVTAAKMLAEMALSKDLYFQAFPEYGPERMGAPIQCFNRLSKEPIHMYCGVASPEIVIVVDPSLCDVDFTAGLPKGSQIAINTGECPATVTEKYNLDYKVSTVDATRISMDALGRAMPNVPMLGALLKLTGLLSEKEALSFIEDSFGHKFSAKVVKGNVTALQKAFEEVQTVE 192
445 9.000e-75gi|530785554|ref|WP_020962320.1| hypothetical protein [Thermofilum sp. 1910b]  clstr ali  38  1..MEREFYEVRWHGRGGQGVVTSSELLALAALKEGKHVYHAPEFGPERRGAPVRAYTRIGNVPLELHSGIYEPDIVVVIDPSMQNEPFFAGLKKNGTLVINAKTPSEKLENVKNLGLNLWIVDAYKIAMEVFGRPFYNTPMLGALVKASNIVNLDSVLSAVSERFSK--DSKIAQLNVLAIKRAYEEVKKYE 190
446 9.000e-75gi|649360500|gb|KDR94468.1| ketoisovalerate oxidoreductase subunit VorA [ [[Clostridium] litorale DSM 5388]  clstr ali  24  6.........IISAGFGGQGVMSLGMLITYAGMLEKKEVSWLPSYGPEMRGGTANCSVIVSDQPVGSPIITNDATTAVIMNLPSL-VKFEKDVAPGGKIFINSSLIS---QKVERDDVEVYYVPCNDIAIELGNPKVANMVMLGAYLEVTGIVATDSILEAFKKVFGPS-KEKFIPLNTEAIKKGQEAIKVA. 182
447 1.000e-74gi|503378685|ref|WP_013613346.1| MULTISPECIES: 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Odoribacter]  clstr ali  23  2......TEEIIIAGFGGQGVLSMGKILAYSGIMQDQEVSWMPSYGPEMRGGTANVTVIISDERI-SSPVLNAFDSAIVLNQQSMDK-FEPLVKAGGTLIYD---PNGITHHPTRKDINIYQIEGARLAAEGGNPKIFNMIILGGFLKVKPIINLDNLEKGLKKSLPARH-HNLIPMNIEAVQTGMAELK... 178
448 1.000e-74METAHIT MH0012 GL0304210 [Complete] locus=scaffold47114_3:81468:82019:-  ali  23  2......TEEIIIAGFGGQGVLSMGKILAYSGIMQDQEVSWMPSYGPEMRGGTANVTVIISDERI-SSPVLNAFDSAIVLNQQSMDK-FEPLVKAGGTLIYD---PNGITHHPTRKDINIYQIEGARLAAEGGNPKIFNMIILGGFLKVKPIINLDNLEKGLKKSLPARH-HNLIPMNIEAVQTGMAELK... 178
449 1.000e-74T2D.3588380 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  23  2......TEEIIIAGFGGQGVLSMGKILAYSGIMQDQEVSWMPSYGPEMRGGTANVTVIISDERI-SSPVLNAFDSAIVLNQQSMDK-FEPLVKAGGTLIYD---PNGITHHPTRKDINIYQIEGARLAAEGGNPKIFNMIILGGFLKVKPIINLDNLEKGLKKSLPARH-HNLIPMNIEAVQTGMAELK... 178
450 1.000e-74JGI.Meta JGI_HUM.0224960 7004227206 C4232188__gene_298135 hypothetical protein [Human Stool microbiome from visit number 1 of subject 160400887]  ali  23  2......TEEIIIAGFGGQGVLSMGKILAYSGIMQDQEVSWMPSYGPEMRGGTANVTVIISDERI-SSPVLNAFDSAIVLNQQSMDK-FEPLVKAGGTLIYD---PNGITHHPTRKDINIYQIEGARLAAEGGNPKIFNMIILGGFLKVKPIINLDNLEKGLKKSLPARH-HNLIPMNIEAVQTGMAELK... 178
451 1.000e-74METAHIT V1 GL0072581 [Complete] locus=scaffold21428_3:463:1002:+  ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMDDKEVTWMPSHGPEQRGGTANVTVILSDEKI-SSPVLDKYDVVIALNQQSLDK-FGPKVKPGGILIYDT---DGIHNPCHRDDITIYPIDAMGATLAIGNSKAYNMIVMGALLEVMPYLPMENVIKGLKKSLPERH-HKLIPMNEQAIEKGRELVK... 179
452 1.000e-74T2D.1943799 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMDDKEVTWMPSHGPEQRGGTANVTVILSDEKI-SSPVLDKYDVVIALNQQSLDK-FGPKVKPGGILIYDT---DGIHNPCHRDDITIYPIDAMGATLAIGNSKAYNMIVMGALLEVMPYLPMENVIKGLKKSLPERH-HKLIPMNEQAIEKGRELVK... 179
453 1.000e-74JGI.Meta JGI_HUM.0089651 7063742597 SRS049318_LANL_scaffold_51016__gene_63684 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate f  ali  48  2....KDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERTGAPLTAYNRISTTPIRSHSNVYYPDYVVVVDDTLLEVPVAQGIREGGAIVINTKKSLEEIEKSLKYNGEIYTIDAKTISVETIGRYFPNTAMLAAIVKITGIMSDEDFLRDMEGSFKHKFKPEVIEGNMKAIERALKEI.... 189
454 1.000e-74gi|547218159|ref|WP_021958325.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Brachyspira sp. CAG:700]  clstr ali  29  2.....KTERIIFAGFGGQGVMSMGQMLAYAGMIENKHVTWCPSYGPEMRGGTANCSVVVSDELVGSPLISHDATAAVIMNLPSFTK-FEKDILPGGVLLINSSLIE---KKSERDDIKVAYVEANKIAGDLGNSRAANMVMLGALLSLDNIVSFESIQQAFIKVFGER-KKEFLPGNEKALNAGAESVK... 180
455 1.000e-74gi|503699018|ref|WP_013933094.1| 2-oxoacid:ferredoxin oxidoreductase subunit gamma [Thermotoga thermarum]  clstr ali  31  6..........IIAGFGGQGVMLMGQILAQAAMIEGKNVTWFPSYGPEMRGGTANCTVVISDEPV-ASPVVENPLELVVMNIPSLLK-FEPKVKPSGYLFVNSSVVD---RKPTRNDIQVFEIPVNDLAEKLGNARVANMVMLGAVVQVTKCVKLDAVVEAIKYKLSSR-GEQIVDLNIKAIYEGVRHV.... 177
456 1.000e-74gi|493484106|ref|WP_006438929.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [[Clostridium] hiranonis]  clstr ali  23  6.........VICAGFGGQGVMSMGQLLTYAGMLENKEVAWLPSYGPEMRGGTANCAVTVSDHEVGSPLITDDATAAVLMNLPAFHK-FQNDVIPGGKILVNSSLIKE---KVARDDVDVYYIPANELAVELGNPKVANMIMLGAYLGVSGTVSVDSVLEAFKKVFGER-KAKFIPLNRAALEKGIEATQK.. 181
457 1.000e-74gi|505402853|ref|WP_015589955.1| pyruvate ferredoxin oxidoreductase, gamma subunit [Archaeoglobus sulfaticallidus]  clstr ali  32  1..MSDILVEVRFHGRGGQGVVTAADMLAVAGFKDGYYTLSFPTFGAEKRGTPVASFLRLSDEPIVSRDEIYYPDYVVVMDPTVIGVKVDAGIKSDGKIIANYPKGPEELKESMGVDVEVYTINATRMAMEHLGRPITNTAMVGAFVGATGIIKIDSVLETVREWFSG----ELAEKNAKLITEAYNYMKEV. 186
458 1.000e-74gi|499783745|ref|WP_011464479.1| 2-oxoacid:acceptor oxidoreductase subunit gamma [Rhodoferax ferrireducens]  clstr ali  38  1......MFQVRIHGRGGQGVVTGAEMLSIAGFLGGRHAQAFPSFGSERTGAPVVAYCRMDDQEIRLREPVMEPDAIIIQDPTLLNVDVFSGLKKDGYILINTTRTFGELGRDFQRD-HLLTVGATELSIKHVGRPVPNVPLLGAFAAATGLITLEAVQAAI----SQKFKGAVAQGNKDAARDAYEIVKQH. 186
459 2.000e-74gi|644488350|ref|WP_025323797.1| hypothetical protein [Deferrisoma camini]  clstr ali  40  1......MVEIRFHGRGGQGAVVASNILAAACFLEGRYVQAFPAFGVERRGAPVEAYIRIDHQKIHLRTNVYTPDHVVVLDPTLIEVDVTRGLKPGATLLLNTDKSPDAF--PRFASFRVATVDASRIALRHLGSPIVNTAILGAFARATGLVSVDAVCEAIREEVPSHH-----EANIAAAREAYDSV.... 180
460 2.000e-74JGI.Meta JGI_HUM.2858020 7007510965 C2590260__gene_235950 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  43  10.MSMNGLTEIRWHGRGGQGAKTAALLLADVAFSIGKHVQGFPEYGPERMGAPITAYDRISDTDIRVHSNIYDPDFVVVVDDTLLHVDVTKGLKKEGAILINTEKDKEEILPLLGYEGEVHVINARKVCMETLGKYFPNTPMLAAIVKISKVMEKEVFLKEMESSLKHKFKPEVLEGNMRALQLAFEEV.... 200
461 2.000e-74gi|502945486|ref|WP_013180462.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanococcus voltae]  clstr ali  44  1......MIEVRFHGRGGQGAVTAAQILAKASFYDGKFCQAFPFFGVERRGAPVMAFTRINDEKIRLRTQIYAPNFVIVQDPTLLDIDVTSGLQKGGLILINTLKDID----LNGYDVK--TIDATGISLDVLGVPIVNTTMVGAFAGLTNQVSLESLKKAIKETFPGKL....................... 158
462 2.000e-74T2D.2855432 [EC:1.2.7.1][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  41  1......MIEVRWHGRGGQGAFTAARLLGQAAIHEHKYVQAFPSFGPERRGAPVLAFTRIDDKKITDRSEVETCDYVVVLDDTLYGENVTKGLKDGGVLVINTTK--EASAFPKVGDYQVITIDATALALDILGRPITNVPMLAALAAASGNVSVDSVLAAIDDQLAPRIR----EKNKKLFVAAYNAVK... 178
463 2.000e-74gi|496426105|ref|WP_009134952.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Alistipes indistinctus]  clstr ali  23  5........EIIIAGFGGQGVLSMGKILAYSGVMQDMEVSWMPSYGPEMRGGTANVTVILSDKPV-SSPISHEYDTAIILNQQSLDK-FEPLVKRGGVLIYD---PNGISRHPVRKDIAVYAIDATAEAARMGNMRVFNTMILGGYLKVRPQVLVENVMKGLAKSLPERL-HKLLPANEEAIRHGMEIIRKVE 182
464 2.000e-74METAHIT unmapped GL0636769 unmapped_[Complete]_[mRNA]_locus=scaffold63370_4:268:816:+  ali  23  5........EIIIAGFGGQGVLSMGKILAYSGVMQDMEVSWMPSYGPEMRGGTANVTVILSDKPV-SSPISHEYDTAIILNQQSLDK-FEPLVKRGGVLIYD---PNGISRHPVRKDIAVYAIDATAEAARMGNMRVFNTMILGGYLKVRPQVLVENVMKGLAKSLPERL-HKLLPANEEAIRHGMEIIRKVE 182
465 2.000e-74T2D.2275720 [EC:1.2.7.3][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  23  5........EIIIAGFGGQGVLSMGKILAYSGVMQDMEVSWMPSYGPEMRGGTANVTVILSDKPV-SSPISHEYDTAIILNQQSLDK-FEPLVKRGGVLIYD---PNGISRHPVRKDIAVYAIDATAEAARMGNMRVFNTMILGGYLKVRPQVLVENVMKGLAKSLPERL-HKLLPANEEAIRHGMEIIRKVE 182
466 2.000e-74JGI.Meta JGI_HUM.2780499 7056396474 SRS049995_LANL_scaffold_16787__gene_43523 2-oxoglutarate ferredoxin oxidoreductase, gamma subunit [Human Stool microbiom  ali  23  5........EIIIAGFGGQGVLSMGKILAYSGVMQDMEVSWMPSYGPEMRGGTANVTVILSDKPV-SSPISHEYDTAIILNQQSLDK-FEPLVKRGGVLIYD---PNGIS