current user: public

Query: TM0015 TM0015 281896 PDB-2007-09-14, from T.maritima

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
96 2.000e-87gi|499179806|ref|WP_010877346.1| pyruvate ferredoxin oxidoreductase subunit gamma/delta [Methanothermobacter thermautotrophicus]  clstr ali  47  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYSQAFPFFGVERRGAPVMAFTRIDDSPVRRRYQVYNPDYVVVLDEGLVDVDVFSGLKDDGVVVLNKSGDF------QGGDVKVHTIDATGIALETLGRPIVNTVMLGAFAGVTGLVSIDSLIKIIKETFPGK----IGEKNAEAARMAYEEIEK.. 175
197 3.000e-82gi|505138643|ref|WP_015325745.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Methanomethylovorans hollandica  clstr ali  42  1......MKEIRIHGRGGQGSVTAAELLAVAAFADGKFSQAFPAFGVERRGAPVQAFTRMDDTPIRLRSQVYEPDYVIVQDPTLIEVDVASGLKEDGIIIINSEFDPSTFK--LNTKAKVVTVNATKIALEIIGRPIVNTVLLGAFAGATGNIRPESIKEAVKERFPGK----VGERNAEAIQQAYDMMKEA. 180
225 2.000e-80JGI.Meta 7068837476 C2300718__gene_188973 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  44  3...MQDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNKPITIHSNIYEPDYVVVVDDTLLEVDVTAGLKATGAIVINTTKTPEYLKKLKDFKGEIYTIDARKVSMETLGRYFPNTPMLAAIVKVSKIMDEQDFINDMKGSFK.......................... 167
259 1.000e-79gi|521284011|ref|WP_020448279.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family protein [Candidatus Methanomassi  clstr ali  45  3......TLEVRWHGRGGQGIVTANEILAGAALYEGKFMKAFPEFGPERMGAPIRAFARVSDEPIKVHSQVYFPDYVAVLDPTLININVLEGLKETGSLIVNNTASVSELKKTLDTDMDVHVVDASKIALETIGKPLANTAMLGALVKISGIVGLDSIIAEMQIKLGGKLPAPVVEKNVLSVKRAYEEVQ... 186
338 9.000e-78JGI.Meta 7045753154 C3039935__gene_176366 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  45  1..................GAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSNIYEPDYVVVVDDTLLEVEVTAGLKEDGAIIINTTKNYDYLKNVLGYNGKVYTIDAREISMEALGKYFPNTPMLAAVVKVTGIMTDEEFLNDMQGSFKHKFKPEVIDGNMKALQLALNQV.... 174
341 1.000e-77gi|630829780|gb|KCZ71493.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Candidatus Methanoperedens nitroredu  clstr ali  39  1......MKEIRIHGRGGQGSVTAAELLAVAAFEDGKYSQAFPAFGVERRGAPVTAFVRLSDKPIRLRSQIYEPDYVIVQDATLVDVDVEKGAKCDGIILINTEKNPSSFKFDTKASIK--TLDATKLAMDFIGKPIVNTTLIGAFAGVSGLIRPESIINAVMERFPG----PIGEKNAKAIQAAYDLME... 178
397 4.000e-76JGI.Meta 7007347930 SRS016095_WUGC_scaffold_29363__gene_72915 hypothetical protein [Human Stool microbiome from visit number 1 of subject 76  ali  27  2...............GGQGVLSMGKILAYAALMEGKEVSWMPSYGPEQRGGTANVTVIISDQRI-SSPILSRYDTAVILNQPSLEK-FEPCIKPGGTLIYDGYGITE---PPRRKDIAVYRIDAMDTAAELHNPKGFNMIVLGGLIKVRPLVETENVIQALKKTLPERH-HALIPMNEEALRRGMEVI.... 168
435 5.000e-75gi|504626178|ref|WP_014813280.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Desulfomonile tiedjei]  clstr ali  42  1......MIEMRFHGRGGQGAVTCAELVAQAAIDTGRYATAFPSFGPERRGAPVIAFARVDEQPIRLRSKIYAPDVVVVLDPSLLDISPAVGLRDNGILIVNSPYDPETLKKHLGYQNRIAVVDAGRIAREVLGLPITNTTMVGALVKGTGIMDVESLKAPFRKRFG-----KIADRNIQAMERAFNETLVV. 181
440 6.000e-75gi|557424280|ref|WP_023426318.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [uncultured Acidilobus sp. CIS]  clstr ali  46  3......MLEIRWHGRGGQGAVTASEVIASASILEGKYALAFPEFGAERRGAPVRAYTRVTDTPLIPRTPVERPDVVVILDRSLIKQNYVEGLKEGGIVVANTPAKPSELLEKLGLRGRAATVDATSIALKWLKANIVNTAILGALVRSTGVVKLDTVLEVIKSRFHGR----VAEANVMAIKEAYESTQLS. 185
461 2.000e-74gi|502945486|ref|WP_013180462.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanococcus voltae]  clstr ali  44  1......MIEVRFHGRGGQGAVTAAQILAKASFYDGKFCQAFPFFGVERRGAPVMAFTRINDEKIRLRTQIYAPNFVIVQDPTLLDIDVTSGLQKGGLILINTLKDID----LNGYDVK--TIDATGISLDVLGVPIVNTTMVGAFAGLTNQVSLESLKKAIKETFPGKL....................... 158
467 3.000e-74gi|503062058|ref|WP_013297034.1| 2-oxoglutarate ferredoxin oxidoreductase subunit gamma [Thermoanaerobacterium thermosaccharolyticum]  clstr ali  30  1......MDEIIFAGFGGQGIMSMGLIMAYAGMMDGKNVSWLPSYGPEMRGGTANCHVTISDEPVG-SPIINEATVVVAMNRPSLE-RFEKHLVKGGILLINSSLIDI---GPQRSDIEVYRIPANDIANQMGNLKIANSIMIGALMSLKNIVSEDAVINAFKKVFEGK--EKLIPINIQAYNRGKESI.... 176
480 8.000e-74gi|490110693|ref|WP_004011387.1| 2-oxoacid:acceptor oxidoreductase subunit gamma [Mobiluncus curtisii]  clstr ali  40