current user: public

Query: TM0015 TM0015 281896 PDB-2007-09-14, from T.maritima

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
8 3.000e-92T2D.3163546 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  44  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNTPIRIHSNIYEPDYVVVVDDSLLEVDVTAGLKPDGAIVINTTKSGNELKPLLGYTGDVYTIDARKISLETLGKYFPNTPMLAAIVKVSGVIEEKDFLADMEGSFKHKFKPEVIDGNMKALEMALKEVNKV. 192
12 6.000e-92T2D.193631 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  47  1...MENLIEIRWHGRGGQGTKTASLLLADAAFNTGKYIQGFPEYGQERRGAPITAYNRISDDPITVHSNIYEPDYVVVVDDTLLEVDVTAGLKTNGAIVINTTKSEDYLKSVLGYKGKVYTIDARKVSTQALGRYFPNTPMLAAIVKVTGIMNDEDFLKDMEGSFKHKFKPEVIDGNMKALEMALKEVKEI. 192
19 2.000e-91T2D.2239501 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  48  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPMTAYNRISVNPIRVHSNVYEPDYVVVVDDTLLSVPVTDGLKEEGAIIINTTKGIDEIKPLLGYNGNVYTIDAKKISEEALGKYFPNTPMLAAIVKVTEIMEDEAFIKDMEGSFKHKFKPEVIDGNMQAIKEALKQVKKVQ 193
21 4.000e-91T2D.1290647 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  46  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTSPIRVHSNIYEPDYVVVVDDTLLKVDVASGLKEDGAIVINTTKGIDEIAPLLGYKGSVYTIDARKVSEEALGKYFPNTPMLAAIVKVAGIMPEDDFIKDMQDSFKHKFKPEVIDGNMKALKLALEQVKKIQ 193
30 1.000e-90T2D.2303771 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  41  1..MMKDMTEIRWHGRGGQGAKTACLLLADAAFTAGKYVQGFPEYGPERMGAPITAYNRISEERCSIHSNIYEPDYVVVVDETLLEVDVTKGLNPEGAIVINSERSAAELRPMLRYEGRVYTIDARKVSEECLGKYFPNTPMLAAIVEVSRVLEPEQFIADMEASFRHKFKPQVVEGNMQCLKRAMKEVR... 191
33 1.000e-90T2D.101295 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  43  17..LMNDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTKPITIHSNIYEPDYVVVVDDTLIEVDVTAGLKKTGAVVINTTKDGEYLKKHLGYEGEIYKIDARKISMETLGKYFPNTPMLAAIVKVSKVMTDEEFLNDMQGSFKHKFKPEVIEGNMKALEMALKEVERV. 209
35 1.000e-90T2D.2658490 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  46  13...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDCPITIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTTKDENYLKALHGYNGNIYTIDARKVSMETLGKYFPNTPMLAAIVKVSHIMSDEELLNDMEGSFKHKFKPEVIDGNMKALKMALNEVKKI. 204
38 1.000e-90T2D.1076465 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  47  1...MSNLIEIRWHGRGGQGAKTASLLLADAAFNTGKFIQGFPEYGPERMGAPITAYNRISDEPITVHSNIYNPDYVVVVDDTLLEVDVTAGLKETGAIVINTTKDINYLSSVLGYKGKIYTIDARKVSMETLGRYFPNTPMLAAIVKVSNVMPEDAFIQDMEGSFKHKFKPEVIEGNMNALKLALKEIKV.. 191
39 2.000e-90T2D.184081 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  44  1...MSELTEFRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYDRISDTEIRVHSNIYDPDYVVVVDETLLHVHVTEGLKEDGAILVNTAKTSDEIRPLLGYKGRVYTIDAREVCMKTLGKYFPNTPMLAAIVKISKIMEEEKFIQEMEASLSHKFKPEVLEGNMQALRLAMQEVRGDE 193
41 2.000e-90T2D.2969742 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  46  14..FMKEIFEIRWHGRGGQGAKTASLLLADAAFSGGMYVQGFPEYGPERMGAPITAYNRISKERVTVHSNIYEPDFVVVVDETLIEVDVTKGLKEDGAIIINSSKPASEFKALLGYKGRVYTCDARTISEETLGKNFPNTPMLGAVVKVSGVMEEKAFLEAMENSFAHKFKPEVLKGNMAALVRSMNEVKE.. 205
43 3.000e-90T2D.3909153 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  47  1...MSNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDTPITIHSNIYEPDYVVVVDDTLLEVNVTAGLKKEGAIVINTTKSPDEVRLLKGYEGKVCTIDAKTISIDTLGKYFPNTPMLAAIVKVSGIMSDEEFLNDMIGSFKHKFKPEVIDGNMAALKRSLNEI.... 189
49 8.000e-90T2D.3085761 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  48  20...MKDTLEIRWHGRGGQGAKTAALLLAEVAFKTGKNAQGFPEYGPERMGAPITAYDRISDQPIRVHSNIYDPQYVVVVDETLIEVDVTKGLREDGAILINTARPKEEIIPHLGYKGKVYTVDARKIAMETLGKNFPNTPMLAAIVKVTGVIDDETFLNEMEGSFKHKFKPEVIKGNMDALRIALREVK... 209
58 2.000e-89T2D.2151568 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  44  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGKNVQGFPEYGPERMGAPITAYNRISSDEIRVHSNIYHPDYVVVVDETLLHVDVTAGLKEQGAIVVNTPKSPQEIAPLNGYKGKVYTVDARKISVETLGKNFPNSPMLAAIVAVSKVMDKDTFIREMKNSYQHKFKPEVIDGNMKALEVAYDAVIAHE 193
64 3.000e-89T2D.2210046 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  49  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDTPIRIHSNIYEPDYVVVVDDSLIAVDVTSGLKDNGAIVINTNEDIDSLRKKLGFSGKIYTIDASKISLECLKANFPNTAMLAAVVNITKIMSKEELVDNMKDAFSHKFKPEVIEPNMEALLRGYDEIK... 187
68 6.000e-89T2D.3027663 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  49  1...MKDIVEIRWHGRGGQGAKTASLLLADAAFNTGKYVQGFPEYGPERMGAPITAYNRISSERSTVHSNIYFPDYVVVVDETLLSVDVTAGLKKEGAIVINSSKSPAELRPLLGYEGRVCTIDAGKISEEELGKNFPNTPMLAAIVRVSGVIGEEEFIKDMEGSFKHKFKPQVIEGNMRALKRSLEEVQV.. 191
72 8.000e-89T2D.610645 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  44  1...MNKTVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEPITVHSNIYEPDYVVVVDESLLEIDVTKGLKREGAVIINSERSKEELRKHLGYEGSVYTVNAKQISMRTLGKNYPNSPMLAAAVAVSNVMERKAFLQEMRASFQHKFKPEVIDGNMQALELAFEEA.... 189
77 1.000e-88T2D.1153464 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  47  20...MDNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGAERMGAPITAYNRISTAPIRIHCNIYNPDYVVVVDDTLLSVDVTSGLKESGAIIINTTKDGETLKRLLGYKGHIYTIDARTVSVEALGKYFPNTPMLAAVVKVTGIIPEEDFLKDMEGSFKHKFKPEVIEGNMKALEIALQKVIKVQ 212
80 4.000e-88T2D.2370172 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  46  6....NEAVEIRWHGRGGQGAKTACLLLADVAFSSGKHVQGFPEYGPERMGAPITAYNRITDEHCKVHSNIYKPDYVVVVDETLLSVDVTKGLKEKGALIINSKKSPEEIRPLLGYKGKVCTIDAEKISMDALGKNFPNTPMLGAVVKVSHVIDQERFIQDMKESFQHKFKENLIEGNMSALKKSMEEVKV.. 195
84 6.000e-88T2D.2257056 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  42  1...MKDLIEIRWHGRGGQGAKTAALLLADVAFNNGLYVQGFPEYGPERMGAPITAYNRLSRNPIRVHSNIYEPDYVVVVDESLIEVDVTAGIKEGGAIIINSHKSSNELKPLLGYHGHIYTIDARKISIETLGKYFPNSPMLAAVVKITGVMEEKAFLEDMRKSYAHKFKPSVIDGNMKALEIALKEV.... 191
89 9.000e-88T2D.1820182 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  46  1...MQNCVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISPAPIRVHSNIYHPDYVVVVDEGLLDVHVTEGLSEDGAILINTSRDKSELEKLHGYKGAVYTIDAKKVSKACLGKYFPNTPMLAGIVKVSGVMDWDEFYNEMRASFLHKFKPEVIDGNMNALKMAFDEVK... 190
93 2.000e-87T2D.4179805 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  43  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDKIRVHSNIYHPDYVVVVDETLLDVDVTAGLKANGAIIINTAKSRAEIEKHLGYTGRVYTIDARKISMDTLGKNFPNSPMLAATVAVSEVMPREDFFREMRASYQHKFKPEVIDGNMQALEMAFEELEE.. 191
96 2.000e-87gi|499179806|ref|WP_010877346.1| pyruvate ferredoxin oxidoreductase subunit gamma/delta [Methanothermobacter thermautotrophicus]  clstr ali  47  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYSQAFPFFGVERRGAPVMAFTRIDDSPVRRRYQVYNPDYVVVLDEGLVDVDVFSGLKDDGVVVLNKSGDF------QGGDVKVHTIDATGIALETLGRPIVNTVMLGAFAGVTGLVSIDSLIKIIKETFPGK----IGEKNAEAARMAYEEIEK.. 175
97 3.000e-87T2D.2834806 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  48  1...MNNGLEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEVIRVHSNIYTPGLVVVVDETLLHVDVTAGLKEDGAIIVNTPKSADEIKPLNGYQGKVYTVDARKISVQALGKYFPNSPMLAAAVAVSGIMKKDAFISEMRASYQHKFKPEVIDGNMQALELTYEELKDV. 192
108 6.000e-87T2D.1248742 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  43  1...MNNGIEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAYNRISEDKIRIHSNIYTPDYVVVVDETLLDVDVTAGLKKDGAIIINTPKSRDEIKKLNGYEGKVYTVDARHISVKTLGKNFPNSPMLAAVVAVSNVMPRDTFIREMRASYQHKFKPEVIDGNMEALEMTFD...... 187
109 7.000e-87T2D.2680910 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  45  14...MKKNIEIRWHGRGGQGAKTAALLLADVAFNTGMHVQGFPEYGPERMGAPITAYNRIGESEIRVHSNIYHPDYVVVVDETLLHVDVTNGLKEDGAIVINTPRPKEEILPLLGYKGSVYTIDAHKVSMETLGKYFPNSPMLAAIVKVADIMDKDVFLSQMQASYEHKFKPEVIDGNMRALKMAFEEVK... 203
115 1.000e-86T2D.307054 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  46  1...MNDLIEIRWHGRGGQGAKTACLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSAIYEPNYVVVVDDTLLDVDVTAGLKEDGAIVINTTNDAETLKKKLGYKGGIYTIDARSISIDALGKYFPNTPMLAAIVKVSGVIPEDQFLADMEGSFKHKFKPEVIDGNMKALKNTLEKVNKIQ 193
120 2.000e-86T2D.1798775 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  45  9...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDTIRVHSNIYHPDYVVVVDETLLSVDVTAGLKKTGAIIINTPKSKEEVMDELGYEGRVYTVDARKISVETLGKNFPNSPMLAAAVAVSDIMPRDKFIHEMRASYEHKFKPEVIDGNMKALERAYDVVEEA. 200
131 4.000e-86T2D.2174313 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  45  8....ENLVEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPIVIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTVKDADYLKKLKGYKGGIYCIDARKVSEEALGRYFPNTPMLAAIVKVANIMDEKDFLNDMKGSFKHKFKPEVIEGNMKALEMALNEVKKI. 198
134 5.000e-86T2D.1741630 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  45  15....KDTIEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISSEPIRVHSNIYDPQYVVVVDESLIEVHVTAGLAEDGAIIINTPKTPDEVRPLLGYKGRVYTLDAKEISLKTLGKNFPNSPMLAAIVAVSGIMEEGPFLEDMRQSYQHKFKPEVIEGNMEALKLAFREVMK.. 204
142 2.000e-85T2D.2319690 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  43  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYNRISSDVIRVHSNIYDPDFVAVVDETLLHVDVTAGLKKEGAIIVNTAKSKEEIMPLNGYEGRVVTIDARTISEEALGKYFPNSPMLAAVVATTGVMPKETFLHEMRASYKHKFKPEVIDGNMKALEMAFAAVEEA. 192
148 4.000e-85T2D.1119968 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  45  1...MSHTIEIRWHGRGGQGAKTAALLLADVAFKTGMHVQGFPEYGPERMGAPITAYNRISDAPIRVHSNIYTPQYVAVVDETLLEVDVTAGLREDGAIIVNTSRPKEILPHLKGYKGSVYTVDAHKISMATLGKYYPNSPMLAAVVAITKVMEPEAFLREMELSFQHKFKPEVIAGNMEALRMTFKEVQ... 190
149 6.000e-85T2D.3518144 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  26...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVSWMPAYGPEQRGGTANVTVIVSDEKI-SSPILSKYDAAIILNQPSLEK-FESKVKTGGILIYDG---YGIINPPTRKDIKVYRIDAMDAANEMNNAKAFNMIVLGGLLKLKPMVTLDSVLRGLKKTLPERH-HHLIPMNEEAIKKGMELIKEV. 205
157 2.000e-84T2D.352728 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  44  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDVIRVHSNIYHPDYVVVVDETLLDVDVTAGLKETGAIIINTPKKREDIPKLNGYKGRVYAIDARHISVETLGKNFPNSPMLAATVAVSEVMEKETFIHEMRASYEHKFKPEVIDGNMEALERAFDVV.... 189
162 4.000e-84T2D.2080951 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  44  1...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDKPITIHSNIYEPDYVVVVDDTLLTVPVTAGLKKEGAIVINTTKKPEELKELLGYDGSVYTIDARKVSEEALGRYFPNTPMLAAIVKVAGVMTDEELLEDMKTSFKHKFA...................... 169
169 9.000e-84T2D.1295159 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  4........EIIIAGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDDPV-SSPILSSYDIAIVLNQPSLEK-FEPKVKPGGIIIYDGYGINE---PPTRKDIKVYRIDAMDAAAEMNLIKTFNMIVLGGLLKIRPVVKIESVLAALRKTLPERH-HHLIPKNEEAIRKGMEIIKEVQ 181
182 1.000e-82T2D.2160303 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  43  15...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISQDVIRVHSNIYHPDYVVVVDETLLEVDVTAGLKKEGAIIVNTPKSKEEIEHLKGYEGDVYTVDGRKISVDALGKNFPNSPMLAAIVAVSKVMPRDKFITEMRASYEHKFKPEVIDGNMKALEMAFDAVE... 204
185 2.000e-82T2D.425829 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  24  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPSYGPEQRGGTANVTVILSDERI-SSPVLNAFDVAVILNQPSLEK-FESKVKPGGILIYDG---YGIHHPPTRTDINVYCINAMEAAIEMNNTKAFNMIVLGGLLKLRPMVSMENVLKGLKKSLPERH-HHLIPMNEQAILKGMEIIRKV. 180
190 3.000e-82T2D.1729697 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIISDDPI-SSPILNQYDVAVVLNQQSLDK-FESKVKPGGILIYD---NYGIHRAPERTDIRVYNVEAMEASFDMQNAKTYNMIVLGALLKVCPMVKMESVLAGLRKSLPERH-HKLIPMNEEAIRKGMALIKE.. 179
193 3.000e-82T2D.872003 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  4........EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPILSHYDVAIVLNQPSLDK-FEPKVKPGGILIYDG---FGIINPPTRKDINVYRIDAMDKAAELKNSKVFNMIVLGGLLKVCPIVSTDGLNKALFKTLPERH-HGLIPLNMQAVEEGMKIMTKMQ 181
197 3.000e-82gi|505138643|ref|WP_015325745.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Methanomethylovorans hollandica  clstr ali  42  1......MKEIRIHGRGGQGSVTAAELLAVAAFADGKFSQAFPAFGVERRGAPVQAFTRMDDTPIRLRSQVYEPDYVIVQDPTLIEVDVASGLKEDGIIIINSEFDPSTFK--LNTKAKVVTVNATKIALEIIGRPIVNTVLLGAFAGATGNIRPESIKEAVKERFPGK----VGERNAEAIQQAYDMMKEA. 180
201 9.000e-82T2D.3631868 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  26  53...MKQ--EIIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPILSQYDTAIILNQPSLEK-FEGKIKPGGILIYDG---YGIIEPPTRRDIQIYRIDAMDAANEKGMAKTFNMIVLGGLLKLRPVVSIESVIKALRKTLPERH-HHLIPMNEEAIRIGMEIIK... 230
224 2.000e-80T2D.1334984 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  1...MKQ--EIIAAGFGGQGVLSMGKILAYAGLIDDLEVTWMPSYGPEQRGGTANVTVVLSDSPI-SSPVLDSYDTAVILNQQSLDK-FESKVKPGGTLIYD---PYGIHHAPTRTDINIYPVNAMDVALELKNAKSYNMIILGALLKINPIVSVDSVMTGLKKTLPERH-HHLLPANREAIMRGMDLVEV.. 179
225 2.000e-80JGI.Meta JGI_HUM.1933051 7068837476 C2300718__gene_188973 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  44  3...MQDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNKPITIHSNIYEPDYVVVVDDTLLEVDVTAGLKATGAIVINTTKTPEYLKKLKDFKGEIYTIDARKVSMETLGRYFPNTPMLAAIVKVSKIMDEQDFINDMKGSFK.......................... 167
243 5.000e-80T2D.3912864 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYAGLMDDLEVTWMPSYGPEQRGGTANVTVILSDKPI-SSPVLDEYDCVVALNQQSLDK-FEPKVKKGGTLLYD---PYGIHRAPTRPDINAVAVPAMEATFEMGNSKTFNMIVLGGLLGVRPMVPVESVLKGLKKVLPERH-HHLIPLNEEALRKGISLTKK.. 179
251 7.000e-80T2D.3199182 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  24  6..........IFAGFGGQGVLLIGQLLAYAGMYEGKNVSWLPSYGPEMRGGTANCSVVVSDEPV-ASPVINKCDCVIAMNRPSLDK-FEQNVLPGGKLFINSSIID---KKATRTDIDVYYVPCNEIADKLNNPKVANMAMLGAYLEATKAVQTKSVLDALLYKLGEK-KAALIPLNEEAIEAGAASIRK.. 179
259 1.000e-79gi|521284011|ref|WP_020448279.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family protein [Candidatus Methanomassi  clstr ali  45  3......TLEVRWHGRGGQGIVTANEILAGAALYEGKFMKAFPEFGPERMGAPIRAFARVSDEPIKVHSQVYFPDYVAVLDPTLININVLEGLKETGSLIVNNTASVSELKKTLDTDMDVHVVDASKIALETIGKPLANTAMLGALVKISGIVGLDSIIAEMQIKLGGKLPAPVVEKNVLSVKRAYEEVQ... 186
260 1.000e-79T2D.299916 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  45  3......TLEVRWHGRGGQGIVTANEILAGAALYEGKFMKAFPEFGPERMGAPIRAFARVSDEPIKVHSQVYFPDYVAVLDPTLININVLEGLKETGSLIVNNTASVSELKKTLDTDMDVHVVDASKIALETIGKPLANTAMLGALVKISGIVGLDSIIAEMQIKLGGKLPAPVVEKNVLSVKRAYEEVQ... 186
267 3.000e-79T2D.2026735 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  1...MKQ--EIIISGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEKI-SSPILSKYDTAIVLNQPSLDK-FQPKVKVGGDIIYDS---FGILDKPTREDIEAYHIPAMETAAEMKMMKCFNMFVLGGLLKIHPIVSLESVMKALKKTLPERH-HDLLPLNEQAILKGMEIISK.. 179
273 5.000e-79T2D.1268329 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  1...MKE--EIIIAGFGGQGVLSMGKILAYSGVMQGQEVSWIPSYGPEMRGGTANVTVILSDRKI-SSPVVQEFDTGIVLNQQSLDK-FEDSIKPGGTLLYD---PNGITHPPHRTDLDVYTIDAAVEAARSGNAKVFNMFVLGAFLKIKPLVTVENVIEGLRHSLPER-AHKMIPANEEALRKGMELVKKAE 181
283 7.000e-79T2D.1448615 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  28  1...MKK--EIIAAGFGGQGVLSMGKILAYAGLMDDLEVTWMPSYGPEQRGGTANVTVVLSDTPI-SSPVLDAFDTAVILNQQSLDK-FESKVKPGGVLIYD---PYGIHRKPTREDITIVPVEAMEAAIEMKNAKTYNMIILGALLKVNPVVDIESVMKGLKKALPERH-HHLLPLNREAILRGMELVK... 178
294 1.000e-78T2D.1314607 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  23  1...MKQ--EIIIAGFGGQGVLSMGKILAYSGLMEGKEVSWMPSYGPEQRGGTANVTVILSDDRI-SSPVLNEYDIAIILNQPSMDK-FENKVKKGGIIIYDG---YGIHTPVKRTDVSVYRVDAMDAATEMKNEKAFNMLILGGLLKIVPMVKLENVLLGLKKSLPERH-HKLIPMNEAAIKKGMEIIQ... 178
298 1.000e-78T2D.637028 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  22  1...MKE--EMIIAGFGGQGVLSMGKILAYSGLMDDKEVTWMPSYGPEQRGGTANVTVILSDDRI-SSPILNMYDTAIVLNQQSLD-RFESQVKPGGVLIYDS---YGIHNPPTRTDINVYCINAMEASFEMKNGKAFNMIVLGAYLKIKPVVSIENVLAGLKKAIPERHW-NLIPLNEEALKKGMSLVKE.. 179
301 1.000e-78T2D.3597867 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYAAMLEGKEVSWMPSYGPEQRGGTANVTVIISDERI-SSPILSKYDTAVILNQPSLDK-FESQIKPGGTLIYDG---YGITIPPSRKDIRIYRIDAMDAAAELKLGPAYNMVVLGGLLKARPIIQTEHVTNALRKTLPARH-QHLIPVNEKALLKGMSIITEI. 180
310 3.000e-78T2D.475342 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  26  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTCNVTVIVSDERV-SSPIVSEYDVAIVLNQPSLDK-FEPKVKKGGFLIYDTS---GIINPPKRTDITVCPIAALDKAVEMKNSKVFNMIVLGGLLKVCPVVSDKGVEKALYKTLPERH-HGLIPLNMEAIKAGREIIK... 178
315 4.000e-78T2D.1165054 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  46  1...MNDMIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNTPIRIHSNIYDPDYVVVVDDTLLGVDVTAGLKPNGAIVINTTKDIDYLRKVLGYSGAIYTIDARKVSMETLGKYFPNTPMLAAIVKVANIMEENDFLKDMEGSFKHKFKPEVIDGNMKALEVALKEVKK.. 191
330 6.000e-78T2D.1380583 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  1...MKE--EIVIAGFGGQGVLSMGKILAYAGLMDNLEVSWMPSYGPEQRGGTANVTVILSDSRI-SSPVLDTFDTAVILNQQSLDK-FESRVKPGGTLIYD---PYGIHHAPTRTDIRIVPVEAMEATFEMKNAKTYNMILLGALLACRPVVSLDAVIRGLRKTLPERH-HHLIPLNEEALRKGMALVK... 178
331 6.000e-78T2D.101500 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  1...MKK--EIIISGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPVLSKFDIAIVLNQPSLDK-FESRVKPGGILIY---EGNGIINPPTRTDIDIYRIDAMDKAAELKNTKVFNMIVLGGMLKVSPVVSENGVEKALFKTLPERH-HKLIPLNMEAIKIGGDIMQK.. 179
338 9.000e-78JGI.Meta JGI_HUM.1908395 7045753154 C3039935__gene_176366 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Stool m  ali  45  1..................GAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSNIYEPDYVVVVDDTLLEVEVTAGLKEDGAIIINTTKNYDYLKNVLGYNGKVYTIDAREISMEALGKYFPNTPMLAAVVKVTGIMTDEEFLNDMQGSFKHKFKPEVIDGNMKALQLALNQV.... 174
341 1.000e-77gi|630829780|gb|KCZ71493.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Candidatus Methanoperedens nitroredu  clstr ali  39  1......MKEIRIHGRGGQGSVTAAELLAVAAFEDGKYSQAFPAFGVERRGAPVTAFVRLSDKPIRLRSQIYEPDYVIVQDATLVDVDVEKGAKCDGIILINTEKNPSSFKFDTKASIK--TLDATKLAMDFIGKPIVNTTLIGAFAGVSGLIRPESIINAVMERFPG----PIGEKNAKAIQAAYDLME... 178
345 1.000e-77T2D.2107049 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  1...MKE--ELIIAGFGGQGVLSTGKILAYSGVMQDYEVSWLPSYGPEMRGGTANVTVIISDKPI-SSPTLQTFDTAIILNQQSMDK-FESQVKPGGVLIYDTN---GITRHPQRKDIKIYVIDATEEAAKRGNSRIFNTLILGGYLKVRPIVTLENVYKGLKKSLPERAWKSL-PMNEEAIRIGMDIIKEIQ 181
358 3.000e-77T2D.1938853 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  23  5........EIIIAGFGGQGVLSMGKILAYSGVMQGLEVSWMPSYGPEMRGGTANVTVILSDRQI-SSPIVHDYDTAIILNQQSMDK-FEPRVKPGGVLIYD---PNGVVRPPQRKDIRVYAIPATEEAARLGNIRVFNTMILGGYLKVKPVVSLDNVFRGLAKSLPERM-ASLIPANEAAIQKGMEIIRVPE 182
363 4.000e-77T2D.989050 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  2......TNELIISGFGGQGVLSMGKILAYAGLMEGKEVTWMPAYGPEQRGGTANVTVIVSDEKI-SSPILSTFDTAILLNQPSLEK-FENKIKPGGTLIYD---AFGISEPPTRTDISIYRINAMDVAAELKMMKAFNMVVLGSFLKVHPIVTIENVIKALKKTLPLRH-HNLIPLNEQAIKKGMEII.... 177
365 5.000e-77JGI.Meta JGI_HUM.2309765 7004858999 C3838891__gene_227259 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Human Tongue  ali  25  6.........VICAGFGGQGVMSMGQLMTYAGMLENKEVSWLPSYGPEMRGGTANCAVTISDQPVGSPIITDDATAAVIMNSPSLTK-FEGDVVPGGVILINSSLVHE---KCSRDDIEAYYIDANELSNELGGPKFANMVMLGAFLAVDDSVNIESVLEAFKKVFGKR-KEKFIPVNRQALEAGYNAV.... 179
380 1.000e-76T2D.2092127 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  27  1...MKKSYEIVISGFGGQGVLSMGKILAYSGLMGGKEVSWMPSYGPEQRGGTANVTVIISEEGI-SSPILNEYDVAIVLNQPSMDK-FLPMVKKGGIVLYDSNGVS---HVPERDDINVFRVDAVDESVKMNNTKVFNIIVLGGLLKVAPMVDINNIEAGLKKSLPERH-HKLIPLNLDALKRGMEIV.... 179
383 1.000e-76T2D.284961 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  43  10.......TEICWHGRGGQGVVTANEILAESAIYSGKYVKAFPEFGPERMGAPIRAFSRISDGPVRVHTQVYEPDIVIVIDPTLIKVDVAKGLKKGGFILANYEGTPAELQKAIGTTAECHSVNASKIALEEIGKPLVNTAMLGALIKIRPIITYSEMEDNITDKFTGKLSDKLIVKNLSALKRAYEEVE... 192
397 4.000e-76JGI.Meta JGI_HUM.2827226 7007347930 SRS016095_WUGC_scaffold_29363__gene_72915 hypothetical protein [Human Stool microbiome from visit number 1 of subject 76  ali  27  2...............GGQGVLSMGKILAYAALMEGKEVSWMPSYGPEQRGGTANVTVIISDQRI-SSPILSRYDTAVILNQPSLEK-FEPCIKPGGTLIYDGYGITE---PPRRKDIAVYRIDAMDTAAELHNPKGFNMIVLGGLIKVRPLVETENVIQALKKTLPERH-HALIPMNEEALRRGMEVI.... 168
408 1.000e-75T2D.189941 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  23  1...MKE--EIIIAGFGGQGVLSMGKILAYSGIMQDQEVAWMPSYGPEMRGGTCNVSVILSDKKI-SSPILSKFDTAIILNQQSLDK-FESRIKPGGLLVYD---PNGITHHPTRTDIQIYKIDAADEAAKMGNAKAYNMIVLGAFLKVKPIVKMENVTAGLKKSLPPRH-HNLIPMNEQAIKVGMEAAVKV. 180
411 1.000e-75T2D.1977978 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  22  1...........MAGFGGQGVLSMGKILAYSGIMQDQEVAWMPSYGPEMRGGTANVTVILSDERI-SSPILTKYDTAIVLNQQSMDK-FESMVKPGGTLIYD---PNGITHEPTRKDINIYKIEGTAIAAEQGNPKVFNMIVLGGFLKVKPIVKLDNVEKGLQKSLPPRH-HKMIPMNIEAIQTGMNSVEVV. 174
412 1.000e-75JGI.Meta JGI_HUM.5704856 7011083964 SRS024625_LANL_scaffold_5217__gene_7521 ketoisovalerate oxidoreductase subunit vorA [Human Stool microbiome from visit n  ali  24  197.........IIIAGFGGQGVLSMGKILAYSGLMEDKEVTWMPAYGPEQRGGTANVTVIVSDERI-SSPILSQYDTAIILNQPSLEK-FEGKIKPGGILIYDG---YGIIEPPTRKDIQIYRIDAMDAANEKGMAKTFNMIVLGGLLKLRPVVSIESVIKALRKTLPERH-HHLIPMNEEAXKE......... 364
416 2.000e-75T2D.2334400 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  46  1...MSNHTEIRWHGRGGQGAKTAALLLADVAFQTGKYVQGFPEYGPERMGAPITAYNRISDTKIRVHSNIYDPQYVVVVDESLLEVDVTSGLKKDGAILVNTQRTKEEIIPHLGYEGEVYIIDAHKVSMEAMGKYFPNTPLLAAIVKVAGIMDEETFL.................................. 157
419 2.000e-75T2D.968500 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  25  18...MKQ--EIIISGFGGQGVLSMGKILAYAALMEGKEVTWMPAYGPEQRGGTANVTVIISEEPI-SSPILSSYDSAILLNQPSLDK-FQPKVKPGGTLIYDS---FGIIEKPVRTDIESWQIPXXXXXXXXXXXKCFNMFVLGGYLKLHPIVSIESVMKALRKTLPERH-HGLLPMNEQAILKGMEII.... 194
422 2.000e-75T2D.3217250 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  39  1......MIEIRFHGRGGQGSVTAAEILAKAAFKDGKYVQSFPFFGVERRGAPVMAFTRIDDKPIDIRYQVYNPDYVLVLDDGLMNVDVFSGIKENTEVIIN---IAEEFKGSGEHP--VHSIDATGIALDLLGRNIVNTIILGYFAKKTNVVSIESLIEVIKETFPGK----VGELNAEATKKAYD...... 172
430 4.000e-75T2D.486692 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  30  2.....KTERIIFAGFGGQGVMSMGQMLAYAGMIENKHVTWCPSYGPEMRGGTANCSVVVSDELVGSPLISHDATAAVIMNLPSLTK-FEKDILPGGVLLINSSLIE---KKSERDDIKVAYVEANKIAGDLGNSRAANMVMLGALLSLDNIVSFESIQQAFIKVFGER-KKEFLPGNEKALNAGAESVK... 180
434 5.000e-75T2D.2190281 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  47  1...MSQLTEIRWHARAGQGAVTAAKLVADTALLQGNYIQAMPEYGPERTGAPLKAYTRVSSEPIEVHNNIQNPDIVIILDDTLLSTDVMEGMNENGILLFNTTMTPEEARAAVNAPVRVATIDASGIALATIKKDMPNTPIVGALAKITGLFPLDLVKERLVITFGKKFSQEMIDANLASVERAYQEVQE.. 190
435 5.000e-75gi|504626178|ref|WP_014813280.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Desulfomonile tiedjei]  clstr ali  42  1......MIEMRFHGRGGQGAVTCAELVAQAAIDTGRYATAFPSFGPERRGAPVIAFARVDEQPIRLRSKIYAPDVVVVLDPSLLDISPAVGLRDNGILIVNSPYDPETLKKHLGYQNRIAVVDAGRIAREVLGLPITNTTMVGALVKGTGIMDVESLKAPFRKRFG-----KIADRNIQAMERAFNETLVV. 181
440 6.000e-75gi|557424280|ref|WP_023426318.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [uncultured Acidilobus sp. CIS]  clstr ali  46  3......MLEIRWHGRGGQGAVTASEVIASASILEGKYALAFPEFGAERRGAPVRAYTRVTDTPLIPRTPVERPDVVVILDRSLIKQNYVEGLKEGGIVVANTPAKPSELLEKLGLRGRAATVDATSIALKWLKANIVNTAILGALVRSTGVVKLDTVLEVIKSRFHGR----VAEANVMAIKEAYESTQLS. 185
449 1.000e-74T2D.3588380 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  23  2......TEEIIIAGFGGQGVLSMGKILAYSGIMQDQEVSWMPSYGPEMRGGTANVTVIISDERI-SSPVLNAFDSAIVLNQQSMDK-FEPLVKAGGTLIYD---PNGITHHPTRKDINIYQIEGARLAAEGGNPKIFNMIILGGFLKVKPIINLDNLEKGLKKSLPARH-HNLIPMNIEAVQTGMAELK... 178
452 1.000e-74T2D.1943799 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  26  1...MKE--EIIIAGFGGQGVLSMGKILAYSGLMDDKEVTWMPSHGPEQRGGTANVTVILSDEKI-SSPVLDKYDVVIALNQQSLDK-FGPKVKPGGILIYDT---DGIHNPCHRDDITIYPIDAMGATLAIGNSKAYNMIVMGALLEVMPYLPMENVIKGLKKSLPERH-HKLIPMNEQAIEKGRELVK... 179
461 2.000e-74gi|502945486|ref|WP_013180462.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanococcus voltae]  clstr ali  44  1......MIEVRFHGRGGQGAVTAAQILAKASFYDGKFCQAFPFFGVERRGAPVMAFTRINDEKIRLRTQIYAPNFVIVQDPTLLDIDVTSGLQKGGLILINTLKDID----LNGYDVK--TIDATGISLDVLGVPIVNTTMVGAFAGLTNQVSLESLKKAIKETFPGKL....................... 158
462 2.000e-74T2D.2855432 [EC:][KEGG:K00172] pyruvate ferredoxin oxidoreductase, gamma subunit;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  41  1......MIEVRWHGRGGQGAFTAARLLGQAAIHEHKYVQAFPSFGPERRGAPVLAFTRIDDKKITDRSEVETCDYVVVLDDTLYGENVTKGLKDGGVLVINTTK--EASAFPKVGDYQVITIDATALALDILGRPITNVPMLAALAAASGNVSVDSVLAAIDDQLAPRIR----EKNKKLFVAAYNAVK... 178
465 2.000e-74T2D.2275720 [EC:][KEGG:K00177] 2-oxoglutarate ferredoxin oxidoreductase subunit gamma;|[COG1014] Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali  23  5........EIIIAGFGGQGVLSMGKILAYSGVMQDMEVSWMPSYGPEMRGGTANVTVILSDKPV-SSPISHEYDTAIILNQQSLDK-FEPLVKRGGVLIYD---PNGISRHPVRKDIAVYAIDATAEAARMGNMRVFNTMILGGYLKVRPQVLVENVMKGLAKSLPERL-HKLLPANEEAIRHGMEIIRKVE 182
467 3.000e-74gi|