current user: public




Query: TM0015 TM0015 281896 PDB-2007-09-14, from T.maritima

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# E-value Template Links and tools%idFirst MPVAKKYFEIRWHGRAGQGAKSASQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIGDEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKICVVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRALRRGYEEVKCSELast
1 8.000e-87METAHIT V1 GL0041605 [Lack both end] locus=scaffold9928_5:2:883:-  ali  21  48.TTPKGTHSCKFWGLGADGTVGANKNIKIIGDNTDMYAQGYFAYDSKKSGGVTTSHLRFGEKPIKSTYLINQADFVACHNPSYVTKYMVEDLKKGGIFLLNCSWDAAQLDEHLPNDIQFYTIDATHIAKELGLGGRVNTILQAAFFKLSGIIPEEKAVQLMKDSYGKK-GEKIVAMNHAAIERGVAGTVKVE 252
2 4.000e-85gi|332799924|ref|YP_004461423.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Tepidanaerobacter acetatoxydans Re1]  clstr ali  23  411.TIPEGTKCCKFWGLGSDGTVGANKAIKIIGDNTDMYAQAYFSYDSKKSGGVTISHLRFGHKPIRSTYLIDKADFVACHNPAYIGKYILSGLKDGGTFLLNCQWSKEEVDEKLPHNIDFYIINAVDIAQEIGLGGRINMIMQAAFFKLTNIIPLDELKEAIVKSYGHK-GEKIVNMNYQAVDKGIEALTKVE 615
3 2.000e-84METAHIT unmapped GL0384064 unmapped_[Lack_both_end]_[mRNA]_locus=scaffold126715_6:1:1113:+  ali  15  12.TEPEGTIRCMFWGLGSDGTVGANKAIKIIGDNTDLYAQGYFSYDSKKSGGITISHLRFGKNKIQSTYLISTADFVACHNPAYVNYDMLKNLKRGGTFLLNCLWNKEELEEHLPNDIDFYTINAVKIGEEIGLGNRINMIMQTAFFALTKVIPIDEAIAHLKESIVKNYGEDIVEMNYKAVDMGATAFEKIE 216
4 5.000e-84gi|302874559|ref|YP_003843192.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Clostridium cellulovorans 743B]  clstr ali  22  410.TTPKGTTACKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFAYDSKKSGGITISHLRFGSNKIKSPYLINKADFVACHNQSYVYKYVLDGLKKNGTFLLNSIWSPEEVEKNLPNDIKFYTIDAVKIAQEIGLGGRINMIMQSAFFKLANIIPVEDLKEAVVKSYGKK-GEKVVNMNNAAIDKGVESIVKI. 613
5 6.000e-84gi|167038236|ref|YP_001665814.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Thermoanaerobacter pseudethanolicus ATCC 33  clstr ali  23  411.TIPEGTTSCKFWGFGSDGTVGANKAIKIIGDNTDLYVQAYFSYDSKKSGGVTVSHLRFGKKPIRSTYLINKADFIACHKQSYYNYDILAGLKDGGTFLLNCNWKVEELDKKLPHNINFYIINAVDIAKEIGLGGRINMIMQSAFFKLTNIIPIEELKEAIVKEYGHK-GEKIVQMNYEAVDRGINSLVKVE 615
6 7.000e-84gi|304317659|ref|YP_003852804.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Thermoanaerobacterium thermosaccharolyticum DSM 571]  clstr ali  22  411.TTPEGTISCKFWGFGSDGTVGANKAIQIIGDNTDMYAQAYFAYDSKKSGGVTISHLRFGKKPIRSTYLINNADFVACHKQAYYNYDVLAGLKKGGTFLLNCTWKPEELDEKLPNNIKFYIINAVDIAKELGLGARINMIMQSAFFKLANIIPIEDLKEAIVKSYGHK-GEKIVNMNYAAVDRGIDALVKV. 614
7 8.000e-84METAHIT unmapped GL0264765 unmapped_[Lack_both_end]_[mRNA]_locus=scaffold252775_1:1:1446:+  ali  24  244.SEPASQVSCKFWGLGSDGTVGANKNVKIIGDNTDKYAQAYFQYDSKKSGGITISHLRFGDEEIKSSYYVKQADFVACHNPSYLHKYMVEDVKPGGTFLLNCSWSDDQLDEKLPDNVKFYTCDAVSIARSLGLRGRTNTVLQAAFFKLINILPIEDMKDAIKKTYGRK-GERIVNMNCDAVDAGVKSVHKV. 447
8 2.000e-83gi|125975598|ref|YP_001039508.1| pyruvate flavodoxin/ferredoxin oxidoreductase-like protein [Clostridium thermocellum ATCC 27405]  clstr ali  22  413.TTPQGTISCKFWGLGSDGTVGANKAIKIIGDNTDLYVQGYFSYDSKKSGGTTISHLRFGPKPLRSPYLVYNADYIACHNKSFYNYDILKGLKKGGTFVLNCPWSEEELDKHLPNDIKFYIIDALKIASDIGLGNRINMVMQSAFFKLANIIPIEDLKDSIEKTYGKK-GHKIVEMNNAAVDKGQEALIKV. 616
9 5.000e-83gi|359414566|ref|ZP_09207031.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Clostridium sp. DL-VIII]  clstr ali  20  411.TTPEGTISCKFWGLGSDGTVGANKAIKIIGDNTDMYAQAYFSYDSKKSGGTTVSHLRFGKKPIKSPYLVYNADYVACHNKSFYNFDILKGLKKNGIFVLNCPWNEDELEEKLPNNIKFYTIDAIAIAGEIGLGNRINMIMQSAFFKLANVIPVEDAVKYLKDSISGKKGDKIVKMNHDAVDRGINSLHEV. 614
10 7.000e-83gi|110801224|ref|YP_696741.1| pyruvate-flavodoxin oxidoreductase [Clostridium perfringens ATCC 13124]  clstr ali  21  412.TTPEGTKACKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFAYDSKKSGGVTISHLRFGKQPIKSPYLINKADFVACHNQSYVNKYFLDGLKKNGTFLLNTIWTPEEVAEHLPNNIKFYTLNAVKIAQEVGLGGRINMIMQSAFFKLANIIPVEDAVKYLKDSYGKK-GEKVVNMNHAAIDKGIDAIVEI. 615
11 7.000e-83gi|429188587|gb|EKY29465.1| pyruvate synthase, partial [Clostridium celatum DSM 1785]  clstr ali  20  423..TPEGTKACKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFSYDSKKSGGITVSHLRFGKKPIKSPYLIDKADFIACHNQSYVYKYVLEGIKDNGKFLLNTIWSPEELEEKLPKNIQFYTLNAVKIAQEIGLGGRINMIMQAAFFKLANIIPVDELKQAVVTSYGKK-GEKVVNMNNAAIDAGVDAVVKIE 626
12 9.000e-83gi|28211392|ref|NP_782336.1| pyruvate-flavodoxin oxidoreductase [Clostridium tetani E88]  clstr ali  19  454.TTPEGTTACKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFAYDSKKSGGITVSHLRFGKEAIKSPYLINSADFIACHNQAYVHKYVLKGLKKGGKFLLNCIWSDEELEQQLPNDIEFYTINAVKIAQEVGLGGRINMIMQSAFFKIANIIPVEDAVKYLKDSYGKK-GEKVVNMNNAAIDKGVEAAHRVE 658
13 1.000e-82gi|385800949|ref|YP_005837353.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Halanaerobium praevalens DSM 2228]  clstr ali  19  411.TSPEGTVRCKFWGLGSDGTVGANKNIKIIGDNTDKYAQAYFSYDSKKSGGVTVSHLRFGEQPIKSTYLIDEADYVACHNESYVDKDMVEDLHDGGSFVLNCTWSEAELSEKLPHDINFYTINAVDLAQEVGLGQRINMVMQTAFFKVADIIPIEYLKEAIQKSYGHK-GDKIVEMNNKAVDKALDALTKIE 615
14 1.000e-82gi|354557887|ref|ZP_08977144.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Desulfitobacterium metallireducens DSM 15288]  clstr ali  20  411.TMPEGTISCKFWGLGSDGTVGANKAIKIIGDNTDLHVQGYFEYDSKKSGGTTISHLRFGKKPIKSSYFVFDADYIACHNKSFLNYDLLKGLKKKGTFVLNCSWKPEEVEDHLPNDINFYIIDAISIAGEIGLGGRINMVMQAAFFKLANVIPVDDLKDSIQKVYGKK-GANIVEMNQKAVDKGIEALHKVE 615
15 2.000e-82gi|374295189|ref|YP_005045380.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Clostridium clariflavum DSM 19732]  clstr ali  23  410.TAPEATTSCRIWGLGSDGTVGANKAIKIIGDNTDMYVQAYFSYDSKKSGGTTVSHLRFGPKPIRSSYLVYNANYVACHNKSFVYYDLLKGLKKGGTFVLNCPWKVEELEEKLPNNIRFYIIDALAIASELGLGNRINMVMQAAFFYLSNIIPVEDALKYLKDSISKKKGQNIVDMNIKAVDRAIEALVKVE 614
16 2.000e-82METAHIT MH0001 GL0001597 [Lack both end] locus=scaffold7097_2:3:2396:+  ali  23  86.PTPEGTKACKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFAYDSKKSGGITVSHLRFGKRPIQEPYLVTDADYVAVHNQSYVHKYVLAGLKEGGNFLLNCSWTVAELDKELPKKINFYLIDAVKIAQEIGLGGRINMIMQSAFFKLADIIPLEDAIKYLKESYGKK-GQNVVDMNNAAIDRGTDAIVKV. 289
17 2.000e-82gi|188584663|ref|YP_001916208.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Natranaerobius thermophilus JW/NM-WN-LF] :_  clstr ali  21  411.TSDEGITRCKFWGFGSDGTVGANKAIKIIGDKTDMYAQGYFSYDSKKSGGVTVSHLRFGKKPIRSTYLIDEADYVACHKETYVDQDLLEGLKPGGTFLLNCTWSVEELESRLPNDIDFYIINAVNIADEIGLGGRINMIMQSAFFKLTEVIPYEDMKEAIEDAYGKK-GEKVVKMNWEAVDRAADALQKVE 615
18 2.000e-82gi|389844762|ref|YP_006346842.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Mesotoga prima MesG1.Ag.4.2]  clstr ali  21  411.TAPEGTIRCKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFAYDSKKSGGVTISHLRFGKKPIKSTYLIDEADYVACHKQSYVNQYLLEGLKKGGTFVLNTSWDSEELDRNLPNNINFYTIDATKIAMEIGLGTRINTIMQSAFFKLANVIPIEELKEAIVKSYGTK-GEKVVQMNYKAVDSGIDALKKI. 614
19 3.000e-82METAHIT MH0044 GL0046163 [Complete] locus=scaffold3297_1:350:3913:+  ali  22  412ITAAKGTVECKFWGLGGDGTVGANKNIKIIGDHTDKYVQAYFQYDSKKTGGITISHLRFGDKPIKSPYYINQADFVACHNPSYVTKGMVQDVKPGGIFLINCQWTDEELNEHMPNNIRLYTINAIDKAIEIGMGKRTNTILQSAFFRLANVMPIEQMKEAAKKSYSKK-GDAVVEMNYKAIDAGVDALHEVK 618
20 3.000e-82METAHIT MH0025 GL0148455 [Lack both end] locus=scaffold13035_5:2:1621:+  ali  27  313....KGTYECKFYGLGSDGTVGANKNIKIIGDHTPKYCQGYFDYDSKKSGGYTCSHLRFGDSPITSPYLVSTPDFVACHVPSYLYKYVLKGIKKNGTFLLNSLWSMEETIKRIPKNLKVYIINATKIAEEIGLGNRTNTILQSAFFKITGIIPYEQMKKAIDKSYGKK-GEKVVSMNYAAVDRGAEY..... 509
21 5.000e-82METAHIT MH0081 GL0153450 [Lack 3`-end] locus=scaffold44531_3:69:2960:+  ali  20  411..TPEGTTACKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFFYDSKKSGGITVSHLRFGKKPIKSPYLINKADFVSCSNQSYVFKYVLEGLKPGSTFLLNTIWSPEEVETHLPNDIKFYTINAVKIAQEIGLGGRTNMIMQSAFFKLANIIPIDDAIKYLKDSVYGKKGQKVVDMNNAAIDQGVQSLVKIE 614
22 5.000e-82gi|158320980|ref|YP_001513487.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Alkaliphilus oremlandii OhILAs]  clstr ali  19  411.TSPEGTIQCKFWGLGSDGTVGANKAIKIIGDKTDLYAQAYFSYDSKKSGGTTVSHLRFGKQPIKSPYLINNADFIACHNSSYYHYDLLHGLKQNGTFVLNCSWKKEELDEKLPKNAKFYIIDAIGIAKEIGLGGRINMIMQSAFFKLAQVIPMEDAIQYLKESIAGKKGDKIVEMNYRAVDKGSEALVKIE 615
23 6.000e-82gi|338812584|ref|ZP_08624754.1| pyruvate ferredoxin oxidoreductase [Acetonema longum DSM 6540]  clstr ali  19  410.TTPTGTTSCKFWGLGSDGTVGANKAIKIIGDHTDMYAQAYFAYDSKKSGGITISHLRFGKKPIKSPYLINKADFVACHNQSYVTKYVLDGLKPGGSFLLNCSWSEKELEEKLPKKINFYIMDAVKIAQDLGLGGRINMIMQSAFFKLANIIPVEELKNAVVDSYGNK-GQKVVDMNNAAIDQGVNAMVKVQ 614
24 8.000e-82METAHIT V1 GL0036625 [Complete] locus=scaffold4567_6:2669:6178:+  ali  23  411..TGEGTKSCKFWGLGSDGTVGANKAIKIIGDYTDMYAQGYFSYDSKKSGGITVSHLRFGKEPIRAPYLINAADFVAVHNQSYVDKYVTAGLKKGGTFLLNCNWSAEELEKHLPNDINFYIIDAVKIAQQIGLGGRINMIMQSAFFKLADIIPLEDLKEAVEHSYGLK-GKDVVDMNNAAIDMGVNAVVKV. 613
25 1.000e-81METAHIT unmapped GL0393568 unmapped_[Lack_3`-end]_[mRNA]_locus=scaffold497318_2:1:2025:-  ali  20  273..EPEGTIKCKFWGLGSDGTVGANKAIKIIGDKTDMYAQGYFAYDSKKSGGLTVSHLRFGEHPIQSTYLINQADFVACHNQAYIRYDMLKDLKKGGTFLLNCLWSDEEIDQMLPKNINFYAIDAWKIAEDVGLGTRINMVMQAAFFKLTGVIPIEKLKEGIEKTY-KKKGQNIVDMNCAAVDQGITAIRKI. 475
26 2.000e-81gi|299143379|ref|ZP_07036459.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Peptoniphilus sp. oral taxon 386 str. F0131]  clstr ali  22  418MTEPKDTIKCKFWGFGSDGTVGANKAIKIIGDGTDMYAQAYFAYDSKKSGGVTISHLRFGKDPIKSTYLITKPDFISCSKQSYYNYHLLEGLKEGGTFLLNTIWNKEELSEKLPKKVNFYTINATDIAQEIGLGSRTNMIMQSAFFKLSEVLPIDDLKDSIKKTYGKK-GDKIVNMNYQAVEMGLEGLVKVE 623
27 2.000e-81gi|404370668|ref|ZP_10975988.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Clostridium sp. 7_2_43FAA]  clstr ali  23  411..TPEGTKACKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFSYDSKKSGGITVSHLRFGKKQIKSPYLVDKADFVACHNQAYVYKYVLEGLKKNGKFLLNTIWTPEEVNEKLPNNIDFYTLNAVKIAQEIGLGGRINMIMQAAFFKIANIIPVEDLKDAVVKSYGKK-GEKVVNMNYAAIDKGVESIVKIE 614
28 2.000e-81gi|220932914|ref|YP_002509822.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Halothermothrix orenii H 168]  clstr ali  20  411.TTPEGTKCCKLWGFGSDGTVGASKNIKIIGDNTDMYAQGYFSYDSKKSGGVTVSHLRFGEKPIKSTYLVEEADYIACHKESYVDKDVLEGLKDGGTFVLNCTWSKDELEEKLPHNIDFYIINAVDIASKVGLGGRINMIMLTAFFKLANIIPVDDLKDAIKKTYGHK-GDKIVKMNWEAVDQALDALVKV. 614
29 2.000e-81gi|225174228|ref|ZP_03728227.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain protein [Dethiobacter alkaliphilus AHT 1]  clstr ali  19  410.TTPEGTVSCKIWGLGSDGTVGANKAIKIIGDNTDLYAQAYFSYDSKKSGGTTVSHLRFGEKPIRSPYLVYDADYIACHNPAFYHYDLLKGLKKGATFVLNCSWQPDELEERLPNNIEFYIINAKAIADKVGLGNRINMVMQAAFFKLAKVLPVDELKKSIEDMYGQK-GQNIVDMNVAAVDRAIEALHKVE 614
30 2.000e-81gi|326790115|ref|YP_004307936.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Clostridium lentocellum DSM 5427]  clstr ali  21  415.....GTVRCKFWGLGSDGTVGANKAIKIIGNHTDKYAQAYFAYDSKKSGGVTISHLRFGDTPIRSTYLIDEADYIACHNQSYVHYDLLKGLKKGGVFVLNCIWDESELEANLPNEIRFYIVNATKIAGEVGLGNRINMVMQSAFFKLANIISEEDLKEAVVKAYGKK-GEKVVNMNYAAIDRGFEAAVKV. 614
31 3.000e-81METAHIT MH0026 GL0064469 [Complete] locus=scaffold15111_2:20858:24367:+  ali  22  410.TTPASTKSCKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFSYDSKKSGGITVSHLRFGHEPIRAPYLITFADFVAVHNQSYVDKYVTAGLKKGGTFLLNCNWSMEELETHLPGNIKFYTIDAVKIAQEIGLGGRINMIMQSAFFKLADIIPLADLKEAVDHSYGLK-GQAILDMNYAAIDRGVDAIVKI. 613
32 3.000e-81gi|397904397|ref|ZP_10505312.1| Pyruvate-flavodoxin oxidoreductase [Caloramator australicus RC3]  clstr ali  21  411.TTPKGTISCKFFGLGSDGTVGANKAIKIIGDHTNLYVQGYFSYDSKKSGGTTVSHLRFGKEPIKAPYLVNTADYIACHNKAFYNYDLLKGLKKGGTFVLNCPWNVNELEEKLPNNINFYIIDAIKIAQEIGLGGRINMIMQSVFFKLSNVIPVEELKESIEKTYGKK-GANIVEMNKKAVDMGIESIVKV. 614
33 4.000e-81METAHIT MH0074 GL0082446 [Lack both end] locus=scaffold21657_2:1:1455:-  ali  28  248......TYEARFIGLGSDGTVGANKNIKIIGGSTDKYCQAYFSYDSKKSGGYTSSHLRFGDEPIRSTYLVTTPNFVACHVPSYLGKYLLKGLKDGGTFLLNAVWDEETTKKHLPDDINFYIINATKIAAELGLGSRTNTIMQSAFFKVSEVIPYEEMKKAIYKSYGKK-GEDVVNKNYAAVDAGGKNVVKVE 447
34 5.000e-81gi|345857038|ref|ZP_08809493.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Desulfosporosinus sp. OT]  clstr ali  21  411.TTPAGTISCKFWGLGSDGTVGANKAIKIIGDNTDLYAQGYFEYDSKKSGGTTISHLRFGKTPIKSSYLVFSADYVACHNKSFLYYDLIKGLKKNGIFVLNCPWTEVELEEHLPNNIQFYTIDAISIARKIGLGGRINMIMQSAFFKLSNVIPVDDLKDSIVKTYGKK-GQKIVDMNWSAVDQGVGALHKV. 614
35 6.000e-81gi|421052352|ref|ZP_15515343.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Pelosinus fermentans B4]  clstr ali  21  411.TTPEGTISCKFWGLGSDGTVGANKAIKIIGDNTDLYAQGYFEYDSKKSGGTTISHLRFGKKPIKSSYLVSDADYIACHNRSFLHYNLLKGLKKNGNFVLNCPWGSEELEDHLPNNINFYTIDAISIAEEIGLGGRINMVMQAAFFKLANVIPVEELKDSIEKMYGKK-GANIVAMNQKAVDRGVDGLYHVK 615
36 6.000e-81gi|350565346|ref|ZP_08934121.1| pyruvate-ferredoxin oxidoreductase [Peptoniphilus indolicus ATCC 29427]  clstr ali  21  35.TEPEDIIKCKFWGFGSDGTVGANKAIKIIGDETEMYAQAYFAYDSKKSGGVTISHLRFGNKPIRSTYLITKPDFISCSKQSYYNYDLLEGIKDGGKFLLNTLWTEEELKQNLPKKVEFYTINATGIAEEIGLGSRTNMIMQSAFFKLAEVLPIEELKESIKKTYGKK-GDKIVQMNYAAVDAGIEKLQKIE 239
37 7.000e-81gi|300854120|ref|YP_003779104.1| pyruvate:ferredoxin oxidoreductase [Clostridium ljungdahlii DSM 13528]  clstr ali  22  410.TTPEGTTACKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFAYDSKKSGGITVSHLRFGKSPIKSPYLIDKADFVAVHNQSYVHKYVLAGLKKGGNFLLNTVWTQEELEKELPNDIKFYTLNAVKIAQEIGLGGRINMICQSAFFKIANIIPIDDAVKYLKESYGKK-GQKVVDMNNAAIDKGVNAVVKI. 613
38 8.000e-81gi|402838063|ref|ZP_10886578.1| pyruvate synthase [Eubacteriaceae bacterium OBRC8]  clstr ali  21  414....EGTIRCKFWGLGSDGTVGANKAIKIIGDHTNKYAQAYFAYDSKKSGGVTVSHLRFGSKPIRSTYLIDEADFIACHTPSYVKYDVVKGLKEGGSFVLNCPWSDDQLEEELPNNIKFYTIDASKIAFDIGLGTRINMIMQSAFFKLADVIPYDELKDSIVKSYGKK-GQEILDMNFKAVDLGANAIHEVK 615
39 1.000e-80gi|150389463|ref|YP_001319512.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Alkaliphilus metalliredigens QYMF]  clstr ali  19  413...PEGTINCKFWGLGSDGTVGANKAIKIIGDRTDLFAQAYFSYDSKKSGGTTISHLRFGKKPIKSPYLIYHADYIACHNKSYVYYNLLKGLKEGGIFVLNCPWTSEELEEKLPTKAKFYIIDAVKVAGEIGLGARINMIMQAAFFKLAQVIPVEELKEGIEDAYGKK-GEKIVEMNNKAVDQGVNALTQVE 615
40 1.000e-80gi|402573942|ref|YP_006623285.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Desulfosporosinus meridiei DSM 13257]  clstr ali  22  413...PEGTIRCKFWGLGSDGTVGANKAIKIIGDNTDLNVQGYFEYDSKKSGGTTISHLRFGKELIKSSYLVFDADYIACHNKSFYHYDILKGLKKGGTFVLNCPWQAKELEDHLPNNISFYTIDAIAIARDIGLGGRINMVMQAAFFKLAKVIPVEELKKSIEKVYGKK-GSNIVEMNYKAVDRGIEALHKVE 615
41 1.000e-80gi|2052278|emb|CAA59455.1| gamma subunit of pyruvate ferredoxin oxidoreductase [Thermotoga maritima MSB8]  clstr ali  99  22MPVAKKYFEIRWHGRAGQGAKSVSQMLAEAALEAGKYVQAFPEYGAERTGAPMRAFNRIGDEYIRVRSAVENPDVVVVIDETLLSPAIVEGLSEDGILLVNTVKDFEFVRKKTGFNGKICVVDATDIALQEIKRGIPNTPMLGALVRVTGIVPLEAIEKRIEKMFGKKFPQEVIDANKRALRRGYEEVKCSE 213
42 1.000e-80gi|376297642|ref|YP_005168872.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Desulfovibrio desulfuricans ND132]  clstr ali  20  410.TTPKGTVQCKFWGLGSDGTVGANKAIKIIGDNTDMYAQGYFAYDSKKSGGITISHLRFGDEPIQSTYLVAAADYVACHNPSYVHYDVLEGIKDGGTFVLNCPWTGGEIENQLPKNLKFYTIDAVKIAGEVGLGGRINMVMQTAFFKLADVIPFEQLKDGIDKAYGKK-GPKIVEMNCAAVDKAPAALVKV. 613
43 1.000e-80gi|258513452|ref|YP_003189674.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Desulfotomaculum acetoxidans DSM 771]  clstr ali  19  411.TTPQGTINCKFWGLGSDGTVGANKAIKIIGDNTNLYAQGYFSYDSKKSGGTTVSHLRFGKQPIRSTYLVYNADYIACHNSSFIHYDLLKGLKKNGTFVLNCHWKTNELEEKLPNHINFYIINAIDIASEIGLGARINMIMQAAFFKLANVIPLENAVKYLKDSYGHK-GQNIVDMNNKAVDKGISSLVKVE 615
44 1.000e-80gi|188585715|ref|YP_001917260.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Natranaerobius thermophilus JW/NM-WN-LF] :_  clstr ali  21  412..TPSDTISCKFWGLGSDGTVGANQAVKIIGDHTDLYAQAYFSYDSKKSGGTTVSHLRFGKQPIRAPYLVYNADYVACHNPAFVNYDLLQGLKAGGTFVLNCPWSKEDLEEKLPNDINFYIIDAISIAGEIGLGNRINMIMQSAFFKLADVIPIEDAVKYLKESYGDK-GQKVVDMNNLAIDKGIDSLIKV. 614
45 1.000e-80gi|153955946|ref|YP_001396711.1| hypothetical protein CKL_3337 [Clostridium kluyveri DSM 555]  clstr ali  21  411.TTPEGTISCKFWGLGSDGTVGANKAIKIIGDNTDLYVQAYFSYDSKKSGGTTVSHLRFGKKFIKSPYLVHSADYVACHNKSFYNYNILKGLKKNGTFVLNCPWEERELEEKLPNNIEFYIIDAVKIAREIGLGGRINMVMQAAFFKLAKVIPIDELKESVEKTYGRK-GKNIVEMNKMAVDRAIEALKKV. 614
46 1.000e-80gi|338813147|ref|ZP_08625283.1| pyruvate ferredoxin oxidoreductase [Acetonema longum DSM 6540]  clstr ali  20  412.TTARGTKACKFWGLGSDGTVGANKAIKIIGDHTDMYAQAYFAYDSKKSGGVTISHLRFGQQPIRSPYLINKADFIACHNQSYYNYDVLAGLKPGGSFLLNCRWNREELEQNLPSKIRFYTIDAVKIAREIGLGGRINMIMQSAFFKIADIIPANDLKQAVEKSYGRK-GEQIVAMNHAAIDKGMEAIVKI. 615
47 2.000e-80gi|407474484|ref|YP_006788884.1| pyruvate:ferredoxin oxidoreductase Por [Clostridium acidurici 9a]  clstr ali  22  416.TEPAGTVRCKFWGLGSDGTVGANKAIKIIGDNTDMYAQAYFAYDSKKSGGITVSHLRFGKEKIRSTYLIEESDFVSCSNQSYVNYDLLKGLKKGGSFLLNCIWSKEEVEAHLPNDINFYTVNATGIAREIGLGNRINMVMQSAFFKLADVIPVDELKDAIVKSYGKK-GEKVVNMNYEAVDKGIEALVKI. 619
48 2.000e-80gi|392962728|ref|ZP_10328157.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Pelosinus fermentans DSM 17108]  clstr ali  22  410.TTPEGTKACKFWGLGSDGTVGANKAIKIIGDKTDMYAQAYFAYDSKKSGGITVSHLRFGKKPIKSPYLINKADFVACHNQSYVDKYVLVGLKPNGSFLLNCIWDQEELETKLPNNINFYTLNAVKIAQEIGLGGRINMIMQSAFFKIAHIIPVEDLKDAVVGSYGNK-GQKVIDMNNAAIDKGVESIVKV. 613
49 2.000e-80gi|325288356|ref|YP_004264537.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Syntrophobotulus glycolicus DSM 8271]  clstr ali  21  410.TTPEGTINCQFWGLGADGTVGANKAIKIIGDHTDLYSQAYFAYDSKKSGGTTVSHLRFGKKEIKAPYLVQNANYVACHNQAYVDKYLLKSLKPGGSFVLNTQWTVEELDEKLPKKANFYIVDAIKIAKEIGLGGRINMIMQSAFFKLANVIPIDDAIKYLKKTYGKK-GQEIVDMNYKAIDAGVNAIVKV. 613
50 2.000e-80gi|320115140|ref|YP_004185299.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Thermoanaerobacter brockii subsp. finnii Ako-1]  clstr ali  20  437.TTPEGTVSCKFWGLGSDGTVGANKAIKIIGDNTDLYVQAYFQYDSKKSGGTTISHLRFGKKPIKSSYLVNHADYIACHNKSFYNYDVLKGLKKGGTFVLNCPWSKEELDDKLPNSINFYIIDAVSIAQEVGLGGRINMIMQTVFFKLINIIPFEEAVKYLKDSIQKKKGQDIVEMNLRAVDKSIEALVKVE 641
51 3.000e-80METAHIT V1 GL0082445 [Lack both end] locus=scaffold21308_1:1:1236:+  ali  18  21...PAGAISCKFYGLGSDGTVGANKNIKIIGDHTDRYAQAYFAYDSKKSGGLTVSHLRFGKTPIQSPYQIDAADFTACHNPAYVTYDMLSTLKDGGTFLLNCQWSDEELDANLPKHIKFYAIDAIDLAAKVGMGNRINTIMQAAFFKLADVIPYEQADEYMKKTYGKK-GDAVVQKNWDAIDIAISGLREVK 223
52 3.000e-80gi|210622303|ref|ZP_03293072.1| hypothetical protein CLOHIR_01020 [Clostridium hiranonis DSM 13275]  clstr ali  21  431....KGTVRCKFWGLGSDGTVGANKAIKIIGDNTDKYAQAYFDYDSKKSGGITMSHLRFGDTPIRSTYLIDEADYIACHNQSYVYYDLLKGLKKGGTFVLNTIWDQEGIEANLPNDIQFYTVNAVELGKEIGLGSRINMIMQAAFFKLAEIIPVDELKESIVKTYGKK-GQKILDMNFKAVDAGINALVKVE 632
53 4.000e-80METAHIT MH0016 GL0102585 [Complete] locus=scaffold1927_2:1612:5166:-  ali  20  412.TTPAGTSSCKFWGLGADGTVGANKNIKIIGDHTDMYAQGYFAYDSKKSGGLTVSHLRFGHQPIKSTYYISKADFVACHNPSYVDKYMVEDLKEGGSFLLNCPWSDEELEERLPKNINFYTIDGIDIGKEIGLGGRINTVLQAAFFKIAGIIPEEDAKQYMKKSYSKK-GEKIVAMNHAAIDKGMESFHKV. 615
54 5.000e-80gi|258405160|ref|YP_003197902.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Desulfohalobium retbaense DSM 5692]  clstr ali  18  411.TTPEGTVQCKFWGLGSDGTVGANKAIKIIGDNTDLFAQGYFSYDSKKSGGITVSHLRFGKNPIQSTYLVTDADYVACHKDSYVRYDILEGIKDGGTFVLNSHWSLEDLEKELPKKLKFYNIDAVKIASEVGLGGRINMIMQTAFFKLANVIPFEELKDSIKKTYGNK-GEKIVNMNIAAVDNAIAGLEEV. 614
55 6.000e-80gi|150392337|ref|YP_001322386.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Alkaliphilus metalliredigens QYMF]  clstr ali  21  411.TASKGTIRCKFWGLGSDGTVGANKAIKIIGDNTDMYAQAYFSYDSKKSGGVTISHLRFGKQPIRSTYLIDQADFVACHNQSYVYYDLLKGLKPGGIFLLNCIWSPEELDAKLPNNINFYTLNATKIATEIGLGGRINMVMQSAFFKLAEVIPVEDLKEAIVDAYGIK-GEKIVNMNQEAVNQGVNALVKI. 614
56 7.000e-80gi|89897634|ref|YP_521121.1| pyruvate ferredoxin oxidoreductase [Desulfitobacterium hafniense Y51]  clstr ali  21  413...PEGTIRCKFWGLGSDGTVGANKAIKIIGDNTELNVQGYFEYDSKKSGGTTISHLRFGKQPIKSSYLVFDADYIACHNKSFYNYDIVKGLKKGGTFVLNCSWTPEEVEDHLPHDIKFYLIDAISIAGEIGLGGRINMVMQSAFFKLANVIPIDDLKDSIHKVYGKK-GAKIVEMNEKAVDKGIESLIKV. 614
57 7.000e-80gi|374295069|ref|YP_005045260.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Clostridium clariflavum DSM 19732]  clstr ali  26  411..VPKGTVSCKFWGLGSDGTVGANKNIKIIGDHTDKYVQGYFSYDSKKSGGVTISHLRFGDKPIRSSYLIKKADFVACHNPSYIGKYIVSDLKENGTFLLNCSWKGKELDEKLPNNINMYTIDAFDIAGKIGLGGRINVIMQAAFFKLTNIIPIKDAVKYMKKSYGKK-GDKVVSMNYEAIDAGVESLVKVE 614
58 9.000e-80gi|83588937|ref|YP_428946.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Moorella thermoacetica ATCC 39073]  clstr ali  20  409.TSPKGTFRCKFFGLGSDGTVGANKNIKIIGDHTDMYAQGYFVYDSKKSGGVTISHLRFGKQPIQSAYLIDQADLIACHNPSYVRYNLLEGIKPGGIFLLNSTWSAEEMDSRLPKKLKFYNIDAVKIAQEIGLGSRINVIMQTAFFKIANVIPVDEAIKYIKKTYGKK-GDKILNMNFAAVDRALEALEEIK 613
59 9.000e-80gi|338813715|ref|ZP_08625807.1| pyruvate ferredoxin oxidoreductase [Acetonema longum DSM 6540]  clstr ali  18  414.TTPAGTKACKFWGLGSDGTVGANKAIKIIGDHTDMYAQAYFAYDSKKSGGVTVSHLRFGRQPIKAPYLIDKADFIACHNQSYVTKYVLAGLKPGGRFLLNCAWNDRELDQHLPNKIEFYTIDAVGIAQKLGLGGRINMIMQAAFFKIADIIPVEALKEAVAKSYGNK-GEKVVAMNNAAIDTGVNSLVKI. 617
60 1.000e-79gi|4972238|emb|CAB43933.1| pyruvate ferredoxin oxidoreductase [Clostridium pasteurianum DSM 525]  clstr ali  22  411.TTPEGTINCKFWGLGSDGTVGANKAIKIIGDNTGLYAQAYFSYDSKKSGGTTISHLRFGKKPIKSPYLVYNADYIACHNKSFYNYDLLLGLKKNSTFVLNCPWSEEELTDKIPNNINFYTIDAISIASKIGLGGRINMIMQAAFFKLANVIPVEELKTSVEKTYGKK-GQKIVDMNKAAIDQGVGALVKV. 614
61 1.000e-79gi|376295779|ref|YP_005167009.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Desulfovibrio desulfuricans ND132]  clstr ali  18  410.TTPEGTVQCKFWGLGSDGTVGANKAIKIIGDNTDMYAQGYFAYDSKKSGGITISHLRFGHKPIQSTYLVTSADYVACHNPSYVHYDVLDGIKDGGTFVLNSPWSAEQMDQELPKNLKFYTIDAVKIAGEVGLGGRINMVMQTAFFKLADVIPFEQLKDGIDKAYGKK-GPKIVEMNCAAVDKAPAALVEI. 613
62 1.000e-79METAHIT MH0061 GL0045791 [Lack 3`-end] locus=scaffold27095_1:19862:22780:+  ali  19  408.TTPAGTTSCKFWGLGADGTVGANKNIKIIGDHTDMYAQGYFAYDSKKSGGLTVSHLRFGHKPIKSTYYISKADFVACHNPSYVDKYIVEDLKEGGSFLLNCPWSGEELDHRLPKHINFYTIDGIKLGKEIGLGTRINTILQSAFFKIADIIPAEDAKQYLKKSYSKK-GQAIVDMNHKAIDMGMENFVKVE 612
63 1.000e-79gi|150016726|ref|YP_001308980.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Clostridium beijerinckii NCIMB 8052]  clstr ali  20  411..TPDGITSCKFWGLGSDGTVGANKAIKIIGDNTDMYAQGYFDYDSRKSGGLTVSHLRFGDKPIKSRYPIDRPDFVACHNQSYVYKYVIRGLKKNGKFILNTIWTPEELDERLPNHIEFYIINAVKIAQDVGLGGRINMIMQAAFFKIANIIPVEDLKEAVVKSYGNK-GEKIVNMNHAAIDAGLEGITKIK 614
64 1.000e-79gi|284047868|ref|YP_003398207.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Acidaminococcus fermentans DSM 20731]  clstr ali  22  411..TPKGTISCKFWGLGSDGTVGANKAIKIIGDKTDMYAQGYFAYDSKKSGGITVSHLRFGHTPIHMPFLINFADYVAVHNPSYVHRYVASGLKKGGVFLLNCPWNAEELDKELPNDIKFYTIDAVKIASEIGLGGRINMIMQAAFFKLTGVIPVDDAVKYLKESIYGKKGQKVVDMNNAAVDQGVNAINKVE 614
65 1.000e-79gi|403386692|ref|ZP_10928749.1| pyruvate ferredoxin oxidoreductase [Clostridium sp. JC122]  clstr ali  21  413....KGTTACKFWGLGSDGTVGANKAIKIIGDNTDMYAQAYFAYDSKKSGGITVSHLRFGKKPIKSPYLINAADYVGCHNQSYVNKYVLAGIKDNGTFLLNCIWNQEDLEKHLPHNINFYTINAVKIAQDLGLGGRINMIMQAAFFELSKIIPTEELKDAVIKSYGKK-GEKVVKMNHDAIDKGIESIVKVE 614
66 1.000e-79gi|188588165|ref|YP_001921458.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Clostridium botulinum E3 str. Alaska E43]  clstr ali  21  412..TPEGTTSCKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFDYDSKKSGGITVSHLRFGKELIKSRYLIDKADFIACHNQSYVYKYVLKGLKKNARFLLNTIWDKDELDEKLPNDIEFYTINAIKIAQEIGLGGRINMIMQAAFFKITNIIPVEDLKEAVVNSYGKK-GEKVVRMNNDAIEAGVEGVVKIE 615
67 1.000e-79gi|397906219|ref|ZP_10507037.1| Pyruvate:ferredoxin oxidoreductase, gamma subunit [Caloramator australicus RC3]  clstr ali  49  1...MGKLVEIRWHGRGGQGAKTASLLLAEVAFNTGKYIQGFPEYGPERMGAPITAYNRISDEPITIHSNIYEPDYVVVVDETLISVPVTAGLKEGGAVIVNTAKSPEEIKKELNFNGKVYTIDARKISEETLGAYFPNTPMLAAVVKITGVIPVDVFLNDIEASFKHKFKPHVVPKNMEAVKRALEEVKGNE 192
68 2.000e-79gi|423075839|ref|ZP_17064553.1| pyruvate synthase [Desulfitobacterium hafniense DP7]  clstr ali  20  413.TAPEGTIACKFWGLGSDGTVGANKAIKIIGDHTTMYAQAYFQYDSKKSGGITISHVRFGKKPIKSPYYVSDANYVACHNQAYVQYDLTKGLKKGGTFVLNCQWQPEELADKLPNDIKLYIIDAVSIAREIGLGSRINMVMQSAFFKLANVIPVEELKESVVKTYGKK-GQNIVDMNNAAIDRGADSLVKVE 617
69 2.000e-79gi|255525208|ref|ZP_05392150.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain protein [Clostridium carboxidivorans P7]  clstr ali  21  412.TTPEGTVSCKFWGLGSDGTVGANKAIKIIGDNTQLYAQAYFSYDSKKSGGTTVSHLRFGKKPIKSPYLVYSADYIACHNKSFIYQDVLQGLKKGGSFVLNCPWDANDLEEKLPNNINFYTIDAVSIARNIGLGGRINMIMQSAFFKLSNIISIENLKDSIEKIYGKK-GEKIVEMNKAAVDKGIESLIKV. 615
70 2.000e-79METAHIT MH0011 GL0166136 [Lack both end] locus=scaffold16656_1:1:2202:-  ali  27  240....KGTYECKFYGLGSDGTVGANKNIKIIGDHTPKYCQGYFDYDSKKSGGYTFSHLRFGDSPMTSPYLVSTPDFVACHVPSYLNKYVLKGIKRGGTFLLNSLWSVEETIKRIPKNLKVYIINATKIAEEIGLGNRTNTILQSAFFKITGIIPYEQMKKAIDKSYGKK-GEKVVSMNYAAVDRGAEY..... 436
71 2.000e-79gi|4972241|emb|CAB43935.1| pyruvate ferredoxin oxidoreductase [Clostridium pasteurianum DSM 525]  clstr ali  21  410.TTPEGTKACKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFAYDSKKSGGITISHLRFGKKPIKSPYLINTADFVAVHNQSYVYKYVLEGLKDGGNFLLNTIWSPEEVETHLPAKIKFYTLNAVKIAQSIGLGGRINMIMQSAFFKIANIIPVDDAIKYLKESYGKK-GEKVVKMNHDAIDLGVNAIVKI. 613
72 2.000e-79gi|28210852|ref|NP_781796.1| pyruvate-flavodoxin oxidoreductase [Clostridium tetani E88]  clstr ali  20  411.TTPEGTISCKFWGLGSDGTVGANKAVKIIGDNTDLYAQAYFSYDSKKSGGTTVSHLRFGKKPIKSPYLVYNADYIACHNRSFLNYDLLKGLKNGGNFVLNCPWNERELEYKLPNNINFYTIDAIDIARNIGLGGRINMIMQAAFFKIANVIPIEDAIKYLKKTYGRK-GEKIVQMNYTAVDEGVQKLVKV. 614
73 2.000e-79gi|323142033|ref|ZP_08076881.1| pyruvate synthase [Phascolarctobacterium succinatutens YIT 12067]  clstr ali  21  411..TPAGTKGCKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFSYDSKKSGGVTVSHLRFGHTPIMAPYLIDAADFVAVHNQSYVHKYVTAGLKKGGTFLLNCNWSAEELDAQLPNDIKFYIIDAVKIAQEIGLGGRINMIMQSAFFKLADIIPLADLKDAVEHSYGKK-GQNIVDMNNAAIDKGIDAIVAV. 613
74 2.000e-79gi|256828845|ref|YP_003157573.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Desulfomicrobium baculatum DSM 4028]  clstr ali  19  411.TTPAGTVQCKFWGLGSDGTVGANKAIKIIGDNTDMYAQGYFAYDSKKSGGITVSHLRFGKEPIQSTYLVNAADYIACHKASYVHYDVLDGIKDGGTFVLNSNWTAEDMEKELPKNLKFYNIDAVKIAAEAGLGNRINMVMQTAFFKLANVMPFEELKKAIKKAYGKK-GDKIVNMNIAAVDQASANLIEIK 615
75 2.000e-79gi|261368692|ref|ZP_05981575.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, partial [Subdoligranulum variabile DSM 15176]  clstr ali  21  405ITSAPGTKECKFWGLGGDGTVGANKNTKIIGDHTDKYIQAYFQYDSKKTGGVTISHLRFGDKPIRSPYYINQADFVACHNPAYIHMGMVQDVKPGGVFMINCQWTDEELDQHLDNNIQLYTINAIDKAIEIGMGKRTNTILQSAFFKLADVMPIDEAVEYMKKSYGKK-GDAVVEMNWKAIDAGVDAVHKVE 611
76 3.000e-79METAHIT MH0012 GL0206458 [Lack both end] locus=scaffold157856_1:3:830:-  ali  19  20..EPEGTIKCKFWGLGSDGTVGANKAVKIIGNHTNMYAQAYFAYDSKKSGGITVSHLRFGKTPITSSYLINKANFVSCSQQTYVHKYVLAGIKDGGTFLLNTIWDAAELEQNLPKHIQFYTINAVKIAQDIGLGGRFNMIMQSAFFKLADIIPVEDAVKYLKDAVYGKKGQKVVDMNNAAIDQGVSQIVKI. 222
77 3.000e-79gi|306821256|ref|ZP_07454869.1| pyruvate:ferredoxin oxidoreductase [Eubacterium yurii subsp. margaretiae ATCC 43715]  clstr ali  20  413....AGTVRCKFWGLGSDGTVGANKAIKVIGDYTNKYAQGYFSYDSKKSGGVTVSHLRFGDKPIRSTYLIVEADFIACHTPSYVKYDVIKGLKDGGTFVLNSPWEVDQLDDELPDNINFYIINANKIASEIGLGSRINMIMQSAFFKLADVMPYDELKDSIVKSYGKK-GQEILDKNFKAVDMGADALVKVE 614
78 3.000e-79gi|429184377|gb|EKY25396.1| pyruvate synthase [Clostridium celatum DSM 1785]  clstr ali  21  413....EGTTACKFWGLGSDGTVGANKNIKIIGDHTNMYAQGYFAYDSKKSGGITVSHLRFGKNPIKSHYEIDKADFVACHNQSYYSYNVLEGLRKNGVFVLNTIWNEEELNDRLPNNINFYTINAVKIAQEIGLGGRINMIMQAAFFKVANIIPVDEAVKYLKDSYGKK-GEKVVNMNFAAIDKGLESLVKV. 613
79 4.000e-79gi|317133642|ref|YP_004092956.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Ethanoligenens harbinense YUAN-3]  clstr ali  21  412.TTPEGTTSCKFWGLGSDGTVGANKNIKIIGDHTDMYAQGYFAYDSKKSGGVTISHLRFGKKPIKSTYLVSKADFVACHNPSYVDKYIVEDLKDGGTFLLNTQWTEDELEANLPHNINFYIINGIQIGKDIGLGGRINTVLQSAFFKLTGIIPAEDAVKFMKDSYGRK-GEKVVKMNHDAIDAGAGAVKKV. 615
80 4.000e-79gi|160944252|ref|ZP_02091481.1| hypothetical protein FAEPRAM212_01761 [Faecalibacterium prausnitzii M21/2]  clstr ali  22  437ITAAAGTKECKFWGLGGDGTVGANKNVKIIGDHTDKYVQAYFQYDSKKTGGVTISHLRFGDKPIRSPYYINQADFVACHNPAYIHMGMVQDVKPGGVFMINCQWSDEELGQHLDNNIQLYTINAIDKAIEIGMGKRTNTILQSAFFKLADVMPIEDMKQAAQKSYGKK-GQDVVEMNWKAIDAGVDAIHKV. 642
81 4.000e-79METAHIT V1 GL0110032 [Complete] locus=scaffold23049_1:346:3885:+  ali  21  405.TTPKGTHSCKFWGLGADGTVGANKNIKIIGDNTDMYAQGYFAYDSKKSGGLTVSHLRFGKTPIKSTYYISKADFVACHNPSYVDKYIVDDLKEGGSFLLNCPWDTEELSERLPGKINFYTIDGIKIGKEIGLGGRINTVLQSAFFKIADIIPADKAKELMKAAAKKKKGQAIVDMNYAAIDRGMEDLKKVE 609
82 5.000e-79gi|420155736|ref|ZP_14662591.1| pyruvate synthase [Clostridium sp. MSTE9]  clstr ali  20  412.TVPKGTHSCKFWGLGADGTVGANKNIKIIGDHTDMFAQGYFDYDSKKSGGLTVSHLRFGDKPIKSTYYISQADFVACHNPSYIDKYIVEDLKKGGSFLLNCPWDVEELDHRLPNDIHFYTIDGIKIGKELGLGGRINTILQAAFFKIANIIPIEQAVEFMKKSYSKK-GDKVVAMNHAAIDRGVDGFVEVQ 616
83 5.000e-79METAHIT O2 GL0049018 [Lack both end] locus=scaffold13147_2:2:1393:-  ali  28  245....EGIFEAKFYGLGADGTVGANKNIKIIGDNTDKYCQAYFSYDSKKSGGFTCSHLRFGDHPIRSTYQIKTPNFVACHVQAYLHYDVLRGLRDGGTFLLNTIWEGDELVHNLPNNVKVYYINATKIAQEIGLGNRTNTILQSAFFRITQVIPVEQMKKFIVKSYGKK-GQDVVDKNYQAVDRGGEY..... 441
84 5.000e-79METAHIT MH0020 GL0111776 [Lack 5`-end] locus=scaffold8639_1:355:3336:-  ali  21  240..TPEGTTSCLFWGLGSDGTVGANKNIKIIGDHTDMYAQAYFAYDSKKSGGITNSHLRFGKSPIRSPYLINTADFVACHQQAYLKKYMTSNLKDGGSFLLNTVWSDEELDKHLPKNINFYTINAVKIGKELGLGSKFNMVLQSAFFMITEIIPKDDAIKYMKKSYGKK-GEKIVNMNYNAVDAGSTGFHKVE 443
85 6.000e-79gi|404372551|ref|ZP_10977846.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Clostridium sp. 7_2_43FAA]  clstr ali  22  412...PEGTTACKFWGLGSDGTVSANKAIKIIGDHTNMYAQGYFAYDSKKSGGITVSHLRFGKTPIRSHYEIDQADFVACHNQSYYNYNLLKGLRKNGTFVLNTIWTEEELNEKLPNNIDFYIINAIKIAQQIGLGGRINMIMQSAFFKLANIIPLEDLKQAVVTSYGKK-GEKVVNMNYEAIDKGIESLVKI. 613
86 6.000e-79gi|312622835|ref|YP_004024448.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Caldicellulosiruptor kronotskyensis 2002]  clstr ali  50  1...MGKMIEIRWHGRGGQGAKTASLLLAEAAFNTGKYVQGFPEYGPERMGAPITAYNRISDEKITIHSNIYEPDYVVVVDETLISVDVTKGLKKDGAIIVNTSKSPEEVKKMLGNDGKVYTIDARKISMECLGKYFPNIPVLGAVIKVTGIIPEEEAIKDMEGSLKHKFKPDVIEGNLKAFVRGMQEVQ... 190
87 6.000e-79gi|169334180|ref|ZP_02861373.1| hypothetical protein ANASTE_00576 [Anaerofustis stercorihominis DSM 17244]  clstr ali  19  411.TAPEGTISCKFWGLGSDGTVGANKAIKIIGDNTDMYAQGYFAYDSKKSGGVTVSHLRFGEEPIKSTYLIADADFVSCSTQAYAEYDMVSDVKPGGIFLLNTVWNMDQLERHLPKNIRFYTINATKVAEEIGLGRRTNMIMQAAFFKLSEVIPYDELKESVRKTYGKK-GDKIVNMNIAAIENGVSELVKIE 615
88 6.000e-79gi|355576604|ref|ZP_09045859.1| pyruvate:ferredoxin oxidoreductase [Olsenella sp. oral taxon 809 str. F0356]  clstr ali  25  413.TAAPGTIECKFWGLGGDGTVGANKNIKIIGDHTDKYVQAYFQYDSKKTGGVTVSHLRFGDSPIRSPYYVTKADFVACHNPSYITKGFVRDVKPGGTFLINCQWDLEELSQHLKNDIQVYTIDAIDLAIEVGMGKRTNTILQSAFFALAKVLPAEDALKYMKKSYSKK-GEAVVAANHKAIDAGATAFKKLE 618
89 7.000e-79METAHIT V1 GL0029427 [Lack both end] locus=scaffold54787_1:3:1304:+  ali  23  41....DGTISCKFWGLGADGTGGANKNIKIIGDHTDKYAQAYFSYDSKKSGGITQSHLRFGDTPIRSTYLVKTADFVACHKQEYVHYDMVTELNPNGTFLLNTTWTVDELDEKLPKNANFYIINGTAIAGEIGLGNRINTVLQAAFFKLANIIPIEYMKAAITKSYGKK-GDTILNMNYAAVDRGVDGAVKVE 242
90 7.000e-79gi|118443355|ref|YP_877927.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Clostridium novyi NT]  clstr ali  22  411..VAEGTTACKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFAYDSKKSGGITISHLRFGKSPIKSPYLIQTPHFVACHNQSYVNKYVLEGLRDNGNFLLNCIWNQEEVEEHLPHNINFYTIDAVKIAQEIGLGGRINMIMQAAFFKLANIIPIEDAVKYLKDSYGKK-GEKVVNMNHAAIDQGVGAIVKVE 614
91 7.000e-79gi|167629261|ref|YP_001679760.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Heliobacterium modesticaldum Ice1]  clstr ali  21  411.TAPEGTIQCKFWGLGSDGTVGANKAVEIIGDHTDMYAQAYFAYDSKKSGGVTVSHLRFGHKPIKSPYLIHKADFISCSNQSYYNYDLLAGLKEGGVFLLNTVWSPEELEEKLPKRIRFYTIDAVHIAKKLGLGNRTNMVMQSAFFKLANVIPIEELKEGIKKAYGKK-GESVVAMNAAAVDQGIEALVKI. 614
92 7.000e-79METAHIT O2 GL0027090 [Complete] locus=scaffold9853_6:1209:3674:+  ali  17  408.TAPAGTTSCKFWGLGSDGTVGANKNIKIIGDHTELYAQAYFSYDSKKSGGVTVSHLRFGKTPIKSTYLINKADFVACHNQSYIDKYMVSDIKPGGTFLLNTIWDMDGLEKHLPNNINFYTINGVKLGEETGMGTRINTILQSAFFKLADIIPFEDAVKYMKASYSKK-GQDIVEKNWNAIDAGHQNIVKI. 611
93 8.000e-79gi|158319289|ref|YP_001511796.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Alkaliphilus oremlandii OhILAs]  clstr ali  18  411.TAPEGAIRCKFWGLGSDGTVGANKAIKIIGDHTDMYAQAYFDYDSKKSGGITMSHLRFGKKPIKSTYLIDEADFIACHNQGYVYYDLLKGLKKGGNFLLNCIWTPEELEEKLPNDINFYTINATKIASELGLGGRINMIMQSAFFKLANIIPVEEAMKYLKESYGLK-GDKIVQMNYASIDRGVDALVKI. 614
94 8.000e-79gi|282857992|ref|ZP_06267193.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Pyramidobacter piscolens W5455]  clstr ali  22  415...PEGTIRCKFWGLGSDGTVGANKNIKIIGDNTDLYAQGYFSYDSKKSGGITVSHLRFGKKPIKSTYLIENADFVACHKQEYLHYDVTAGLKKGGVFLLNTQWSMDALEANVPAKVKFYVIDGTDIAQKIGLGNRTNMVMMSAFFKLANVIPMEDMKDAIQKSYGRK-GEDIINMNNAAVDQGYGALKKI. 617
95 9.000e-79gi|150019130|ref|YP_001311384.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Clostridium beijerinckii NCIMB 8052]  clstr ali  21  411..TPEGTTSCKFWGLGSDGTVGANKAIKIIGDNTDMYAQAYFFYDSKKSGGITVSHLRFGKKAIKSPYLINKADFVSCSNQSYIHKYVLEGLKPGSTFLLNTIWSPEDLEEKLPNNIKFYTINAVGIAQEIGLGGRINMIMQSAFFKLANIIPVEDAIKHLKDSVYGKKGEKVVNMNNAAIDKGVESIVAI. 613
96 1.000e-78gi|375085658|ref|ZP_09732288.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Megamonas funiformis YIT 11815]  clstr ali  21  429..TPEGTTACKFWGLGSDGTVGANKAVKIIGDKTDMYAQAYFAYDSKKSGGVTMSHLRFGKKPIMSPYLINKANFISCSQQSYVDKYLLAGLKPNGTFLLNTLWTDEELTEKLPNNINFYTVNAVKIAQELGLGGRFNMVMQSAFFKLANIIPIDEAVKYLKDSYGKK-GQHIVDMNNGAIDKGIEALHKVE 632
97 1.000e-78gi|410656849|ref|YP_006909220.1| Pyruvate-flavodoxin oxidoreductase [Dehalobacter sp. DCA]  clstr ali  20  410.TTPEGTISCQFWGLGADGTVGANKAIKIIGDFTELYAQAYFAYDSKKSGGTTVSHLRFGKTPIKAPYLVNTANYIACHNQSYVDKYLLKGLKPGGTFVLNCQWPVEELDEKLPDNAKFYIIDAGKIAREIGLGSRINMIMQSAFFKLAKVIPLEDALQYLKDSVVKKKGQEVVDMNNKAIDAGCNALVQVE 614
98 1.000e-78gi|148380718|ref|YP_001255259.1| pyruvate-flavodoxin oxidoreductase [Clostridium botulinum A str. ATCC 3502]  clstr ali  20  410.TTPAGTTACKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFAYDSKKSGGITISHLRFGKSPIQSPYLINQADFVACHNQSYVYKYVLEGLKKGGRFLLNTIWTPEEVEEHLPNDIEFYTLNAVKIAQGIGLGGRINMICQAAFFKIANIIPVEDAVKYLKDAVYGKKGQKIIDMNNAAIDEGVNAIVKIE 614
99 1.000e-78gi|304315847|ref|YP_003850992.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Thermoanaerobacterium thermosaccharolyticum DSM 571]  clstr ali  23  411.TVPQGTISCKFFGLGSDGTVGANKAIKIIGDNTNLYVQGYFQYDSKKSGGTTISHLRFGQKPIKSSYLVYHADYIACHNKSFYNYDILKGLKNGGTFVLNCPWSEAELDEKLPNNINFYTIDAISIAREVGLGGRINMIMQTAFFRLINIIPFENLKESIQKTYGKK-GQNIVDMNIKAVDRSLESLKKV. 614
100 1.000e-78gi|302875667|ref|YP_003844300.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Clostridium cellulovorans 743B]  clstr ali  20  411.TTPQGNISCKFWGLGSDGTVGANKAVKIIGDNTNLYAQAYFSYDSKKSGGTTVSHLRFGKNPIKAPYLIYEADYIACHNKSFYNYDLLKGLKKNGIFVLNCPWTEDELEDKMPNNINFYIIDAVKIAYDLGLGARINMIMQSAFFKLSEVIPVDELKKSIEKSYGKK-GEHIVKMNKDAVDKGADALIKV. 614
101 1.000e-78gi|289450210|ref|YP_003474936.1| pyruvate synthase [Clostridiales genomosp. BVAB3 str. UPII9-5]  clstr ali  21  413.TVPAGTVSCRFWGLGSDGTVGANKNIKIIGDHTDMYAQAYFSYDSKKSGGITISDLRFGKSPIHSTYLIDMADFASCSQQSYVDKYMLSSLKDNGVFLLNTLWTDEELNTFLPKKIRFYTIDAVEIAKGLGLGGRTNTVMQAAFFKLSNIIPIEEMKKAIVKSYSKK-GDEIVKMNYGAVDAGCEKIHEVK 617
102 1.000e-78gi|225026034|ref|ZP_03715226.1| hypothetical protein EUBHAL_00273 [Eubacterium hallii DSM 3353]  clstr ali  22  412ITSAPGTVECKFWGLGGDGTVGANKNTKIIGDHTDKYIQAYFQYDSKKTGGITISHLRFGDNPIRSPYYINQADFVACHNPSYVVKGMVQDVKPGGIFMINCQWSDEELDHHMPNNIQLYTINAIDKAIEIGMGKRTNTILQSAFFKLANIMPIDEMKAAAKKSYSKK-GDAVVEMNYKAIDAGVDAVHKVE 618
103 1.000e-78gi|363893251|ref|ZP_09320389.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Eubacteriaceae bacterium CM2]  clstr ali  20  410.TEPKDTIKCKFWGFGSDGTVGANKAIKIIGDGTDMYAQAYFAYDSKKSGGVTISHLRFGSKPIQSTYLITKPDFISCSMQSYVDNYLLEGIKEGGTFLLNTIWNIDELSKNLPKKINFYTINATHIAEEIGLGTRTNMIMQSAFFKLSNVIPIEELKESIKKTYGKK-GDAIVNMNYLAVDKGKDDLVKIE 614
104 2.000e-78gi|345860257|ref|ZP_08812577.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Desulfosporosinus sp. OT]  clstr ali  20  411.TAPQGTIGCKFYGLGSDGTVGANKAIKIIGDKTPLYAQGYFSYDSKKSGGTTISHLRFGQKPIKSTYLVLHADYVACHNKSFYNYDLLNGLKPNGAFVLNCPWKSEELDRELPNKINLYIIDAVKIASEIGLGGRINMIMQAAFFKLANVIPVNDLKESIAKTYGKK-GQKIVDMNIAAVDRGIESLQKV. 614
105 2.000e-78gi|148379176|ref|YP_001253717.1| pyruvate-flavodoxin oxidoreductase [Clostridium botulinum A str. ATCC 3502]  clstr ali  21  411.TTPEGTINCKFWGLGSDGTVGANKAVKIIGDNTDLYAQAYFSYDSKKSGGSTISHLRFGKDKIKSPYLIYNADYIACHNKSFYNFDVLKGLKKDGTFVLNCPWDEAELEEKLPNNINFYIIDGISIAQNIGLGGRINMIMQSAFFKLANVIPVELLKNSVEKTYGKK-GEKIVEMNKAAIDTGIDAVHKV. 614
106 2.000e-78METAHIT O2 GL0059510 [Lack both end] locus=scaffold39139_1:3:1637:-  ali  20  145.TTPEGTTNCKFWGLGADGTVGANKNIKIIGDNTDMYAQAYFDYDSKKSGGVTMSHLRFGHKKIKSTYLIHRANFVACHNPAYVRKYMVQELVDGGTFLLNCAWNAEELEKHLPHNINFYTIDGVKIGIETGMGPRINTILQSAFFKLTGIIPEEKMKEAAQKTYGRK-GEDVVKKNWAAIDAGANGVVKVE 350
107 2.000e-78gi|227498924|ref|ZP_03929063.1| pyruvate ferredoxin oxidoreductase [Acidaminococcus sp. D21]  clstr ali  22  412..TPKGTTSCMFWGLGSDGTVGANKAIKIIGDKTDMYAQGYFAYDSKKSGGITVSHLRFGHTPIHMPFLINTADYVAVHNSSYVHRYVMAGLKDGGTFLLNSPWTDAELDKELPHKINFYTIDAVKIAESIGLGGRINMIMQAAFFKLTGIIPVEDAVKYLKESIYGKKGQKVVDMNNAAVDQGVNAIHKVE 615
108 3.000e-78METAHIT MH0006 GL0072845 [Complete] locus=scaffold22019_2:4412:7831:-  ali  23  377..VAEGTISCKFWGLGSDGAVGANKNIKIIGDHTDMYVQAYFEYDTKKSGGVTRSHLRFGHKPIRGSYLVSHADFVACHNQSYIQKYIVQECKPGGTFLLNCIWNEDELDKHLPNHIKFYIINAVKIGKEIGLGNRTNAVLQSAFFKLANVIPFDDMKKAILKSYGKK-GEKVVNMNYQAVDCGYQRLVEVK 580
109 3.000e-78gi|257791889|ref|YP_003182495.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Eggerthella lenta DSM 2243]  clstr ali  23  413.TAAEGTIECKFWGLGGDGTVGANKNIKIIGDHTDKYVQAYFQYDSKKTGGVTISHLRFGDSPIRSTYYVNKADFVACHNPSYVTKRMVNDVKPGGAFMINCQWTPEELEHHLNNDIKLYTINAIDLAAEIGMGKRTNTILQSAFFTLANVIPQDEALQYMKDAATKKKGQDVVDMNHRAIDAGATAFVQVE 618
110 4.000e-78METAHIT V1 GL0042386 [Lack both end] locus=scaffold39474_1:3:2006:-  ali  25  78....NGAYECMFYGLGSDGTVGANKNIKIIGDNTNKYVQAYFQYDSKKSGGFTCSHLRFGDKKIRSTYYVNQPHFLACHVPAYLRYDLTKGLRRGGTFLLNSIWDVNEVEKHLPNKINFYMINATQIAQEIGLGNRTNTILQSAFFKITGVIPYEQMKKFIMKSYGHK-GDAVVSKNYQAVDKGGELLVKV. 278
111 4.000e-78METAHIT MH0079 GL0030775 [Lack both end] locus=scaffold19367_1:3:1577:+  ali  20  237.TTPEGTTSCKFWGLGSDGTVGANKNIKIIGDHTDMYAQAYFDYDSKKSGGVTVSHLRFGKKPIRSSYLINKADFVACHNPAYVGKYMVEDIKDGGTFLLNASWNMDELNAHMPHHVKLYMIDAQSIDRELHLRGRINTVLQSAFFKLANIIPEADAIRYMKKSYGHK-GEDVVKMNHDAIDRGANGAHLVE 441
112 4.000e-78gi|160933601|ref|ZP_02080989.1| hypothetical protein CLOLEP_02455 [Clostridium leptum DSM 753]  clstr ali  20  412.TTPAGTHSCKFWGLGADGTVGANKNIKIIGDHTDMYAQGYFAYDSKKSGGLTVSHLRFGHKPIKSTYYISKADFVACHNPSYVDKYIVEDLKKGGNFLLNCPWDVEELDKRLPNDINLYTIDGIKIGKEIGLGGRINTILQAAFFKIANIIPEADAVQYMKKSYSKK-GEKIVAMNHAAIERGVSDVHKVE 616
113 4.000e-78gi|220903579|ref|YP_002478891.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Desulfovibrio desulfuricans subsp. desulfur  clstr ali  19  410.TVPAGTVQCKFFGLGADGTVGANKAIKIIGDNTDLYAQAYFAYDSKKSGGFTVSHLRFGKAPITSSYLITSADYVACHKSAYVTYDILEGIKEGGTFVLNSNWSLADLEKHLPKKLKFYNVDAVKVAQEVGLGGRINMIMQTAFFKLANVLDFDKLKESIKKTYGSK-GDKIVNMNIAAVDKGMDALEEIK 614
114 5.000e-78gi|15895764|ref|NP_349113.1| pyruvate ferredoxin oxidoreductase [Clostridium acetobutylicum ATCC 824]  clstr ali  20  411.TTPQGTIRCKFYGLGSDGTVGANKAIKIIGDNTDMYCQAYFSYDSKKSGGSTVSHLRFGNKPIKSPYLVYEADYIACHNKSFYNINVLKGLKKNGIFVLNCPFKDNELDEHLPNNIQFYTIDAVSIAQEVGLGSRINMIMQSAFFKLANIIPVDKLKDSIEYTYGKK-GATIVDANKKAVDAGVNAAHKV. 614
115 6.000e-78gi|225016302|ref|ZP_03705494.1| hypothetical protein CLOSTMETH_00205 [Clostridium methylpentosum DSM 5476]  clstr ali  18  408.TAPEGTTSCKFWGLGADGTVGANKNIKIIGDNTDMYAQAYFAYDSKKSGGVTISHLRFGEKPIKSTYLISKADFVACHNPSYMNKYIVQDVKPGGTFLLNCSWDADQLETHLPNNIKFYTIDGVKIGKEIGLGGRINTILQSAFFKLANIIPIDRAVQLMKDSYSKK-GDAVVKMNHEAIEKGVNAVVEVK 612
116 6.000e-78gi|126700296|ref|YP_001089193.1| pyruvate-ferredoxin oxidoreductase [Clostridium difficile 630]  clstr ali  20  414....KGTIRCKFWGLGSDGTVGANKAIKIIGDHTEKYAQAYFDYDSKKSGGITMSHLRFGDTPIRATYLIDEADYIACHKQSYVYYDLLKGLKKGGTFVLNTIWDQAGLEEHLPNDIKFYTVNAVKLGQEIGLGNRINMIMQSAFFKLAEIIPEEDAVKYLKDSIVKKKGEKIVNMNYAAVDAGINALVKVE 615
117 6.000e-78gi|379012267|ref|YP_005270079.1| pyruvate:ferredoxin oxidoreductase NifJ [Acetobacterium woodii DSM 1030]  clstr ali  22  411.TVPEGTKGCKFWGLGSDGTVGANKAIKIIGDHTDLYAQGYFSYDSKKSGGVTVSHLRFGKKPIKSTYLIVNSDFVSCSTQAYVHYDLLKGLKKGGTFLLNTVWEVSELEEKLPNDINFYIINATKIAEEIGLGRRTNMIMQSAFFKLADIIPIEDAKAGIQKSYGKK-GQKIVDMNNEAVDQGINALVKV. 614
118 6.000e-78METAHIT O2 GL0071880 [Complete] locus=scaffold5424_2:41349:44855:-  ali  23  407...PEGTKACKFWGLGADGTVGANKNVKIIGDHTDKKVQAYFQYDSKKSGGITISHLRFGDEPIKSSYYVNQADFVACHNAAYIYKYMVEDVKPGGFFLLNCVWNDEELEEHLPNNIQFYTCDAVDIAKKIGLGRRTNSVLQAAFFKLTDIIPIDDMKEAIKKTYGKK-GEKIVNMNLAAVDAGISHIHKVE 610
119 6.000e-78METAHIT MH0081 GL0051865 [Complete] locus=scaffold6029_3:1253:4786:+  ali  23  419..TPQGTKGCKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFAYDSKKSGGITVSHLRFGKEPIMEPYLITDADYVAVHNQSYVYKYIMSGLREGGNFLLNCNWSPAELEDKLPKHVNFYIIDAVKIAQAIGLGGRINMIMQSAFFKLADIIPLEDLKDAVEESYGKK-GQNVVDMNNAAIDQGIEAIVKI. 621
120 6.000e-78Oral.Meta HOMD psto_c_4_17 Peptostreptococcus stomatis DSM 17678, W2278 [16826 - 20491] pyruvate synthase  ali  22  460.....GTVRCKFWGLGSDGTVGANKAIKIIGDNTDKYVQAYFDYDSKKSGGITMSHLRFGDTPIRSTYLLDEADYIACHKQSYVHYDVIKGLRKGGIFVLNTIWTPEELDTHLPNEIQFYTIDAVDIAKEIGLGNRINMICQSAFFKLADIIPVEDLKDSIKKTYGKK-GDKIVNMNNEAVDKGIDALVKI. 659
121 6.000e-78gi|206900800|ref|YP_002251791.1| pyruvate synthase subunit PorC [Dictyoglomus thermophilum H-6-12]  clstr ali  56  1...MKDMLEIRWHARAGQGAKTASYLLAETAMEAGKYIQAFPEYGPERTGAPMKAYTRISDKPIRIHSQIYNPDVVVVLDKTLIGKNVLEGLPSDGIIIVNTTQPPEEIREQLGSDRKIYTVDATGIALETIGRPIPNTPMLGALIRVVPIISLDEVLNQFRKKFEGRFKPEVIEGNLQAIKRAYEEVK... 188
122 7.000e-78gi|220928592|ref|YP_002505501.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Clostridium cellulolyticum H10]  clstr ali  20  412..EPKSTIRCKFWGLGSDGTVGANKAIKIIGDHTEKFAQGYFAYDSKKSGGVTMSHLRFGDERIKSAYLINEADYIACHNQSYVNYDLLKGIKKGGIFVLNCLWDEKELEDHLPNNIQFYTVDATKIAESIGLGNRINMIMQAAFFKLANIIPMEDLKDAVVKSYGQK-GENIVKVNHEAIDKGINAIVKV. 614
123 7.000e-78gi|313202859|ref|YP_004041516.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Paludibacter propionicigenes WB4]  clstr ali  28  416....AGTIEAKFYGLGADGTVGANKNIKIIGDNTDKYCQAYFAYDSKKSGGFTCSHLRFGETPIRSTYLVTTPDFVACHVQAYLNYDVTKGLKKNGTFLLNTIWSPEEVQKNLPAKVKFYIINATKIAEEIGLGNRTNTILQSAFFKITNVVPYEKMKYAINKSYGKK-GEDVVKKNYAAVDRGGEYTK... 614
124 9.000e-78gi|317054762|ref|YP_004103229.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Ruminococcus albus 7]  clstr ali  20  414.SAPAGTTACKFWGLGADGTVGANKNIKIIGDHTDLYAQAYFAYDSKKSGGVTVSHLRFGKTPIKSTYLINQADFVACHNESYISKYIVNDIKPGGTFLLNCQWDEADLEKHLPNNIKFYTINGVKIGKEIGLGNRINTVLQSAFFKLSGIIPMEDAIKYMKDSYSKK-GEAIVKMNHDAIDAGCQQVVEVK 618
125 9.000e-78gi|345861513|ref|ZP_08813773.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Desulfosporosinus sp. OT]  clstr ali  20  412..TPEGTISCMFWGLGSDGTVGANKAIKIIGDNTTMFAQGYFSYDSKKSGGTTISHLRFGKQPIKSTYLVYSADYVACHNRAFIHYDLLKGIKNGGTFVLNCPWTQAELEEKLPKKVKFYVIDAINIASEIGLGNRINMIMQSAFFKLANVIPIDDLKGSIEKAYGKK-GQKIVDMNKDAVDQGVNALV... 612
126 1.000e-77gi|164686402|ref|ZP_02210432.1| hypothetical protein CLOBAR_02840 [Clostridium bartlettii DSM 16795]  clstr ali  20  414....KGTVRCKFWGLGSDGTVGANKAIKIIGDHTDKYAQAYFDYDSKKSGGITMSHLRFGDTPIRSTYLLDEADYIACHNQSYVYKYLLKGLRKGGTFVLNTIWDAEGLEEHLPNDIQFYTLNAVKIGQEIGLGNRINMICQAAFFKLADIIPVEDLKESIVKAYGKK-GEAIVNMNYKAVDAGIDSLVKV. 614
127 2.000e-77gi|383192397|ref|YP_005202524.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Rahnella aquatilis CIP 78.65 = ATCC 33071]  clstr ali  22  412.TSSSGTTACKFWGLGSDGTVGANKAIKIIGDKTDMYAQAYFAYDSKKSGGVTMSHLRFGHNPIRSPYLIDKADFISCSQQSYVNKYLLAGLKPGGTFLLNCSWDVAELDEKLPNDIQFYIVNAVGIAQKLGLGGRFNMIMQSAFFKLADIIPLEYLKHSIEHAYGNK-GQKIVDMNNLAVDSGIESVVKI. 615
128 2.000e-77gi|229816103|ref|ZP_04446422.1| hypothetical protein COLINT_03157 [Collinsella intestinalis DSM 13280]  clstr ali  24  414.TAAEGTIECKFWGLGGDGTVGANKNIKIIGDHTDKYVQAYFQYDSKKTGGVTTSHLRFGDSPIRSPYYVNKADFVACHNPSYIIKGFVRDVKPGGTFLVNCQWTPEEFASHMPNNINVYLIDAIDLAAKVGMGKRTNTVLQSAFFALAGVLPQEDAIRYMKKSYAKK-GEAIVEANHKAIDAGATAFVK.. 617
129 2.000e-77METAHIT V1 GL0002710 [Lack both end] locus=scaffold41716_4:2:619:+  ali  19  10...PAGTTRCKFYGLGSDGTVGANKNIKIIGDHTDLYAQGYFEYDSKKSGGLTISHLRFGKNPIKSSYLIDQAEFIACHNPSYVTYDILADAKDGGTFLLNCSWTDEELNNELPKHLKFYTIDGLHIAMAAGSAKSTNMVMQAAFFKLANIIPYEQAEEYMKKSYGKK-GQKVVEANWAAIDGAIA...... 206
130 2.000e-77gi|220927475|ref|YP_002504384.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Clostridium cellulolyticum H10]  clstr ali  20  412ITAAAGTVECKFWGLGGDGTVGANKNTKIIGDHTDKYIQAYFQYDSKKTGGVTISHLRFGDKPIKSPYYVNQADFVACHNPSYIVKGFVQDVKPGGIFMINCQWSDEELKYIADNNIQLYTINAIDKAAEIGMGKRTNTILQSAFFKLANVMPIDDMKEAAKKSYGKK-GDAIVEMNYKAIDAGVSALHKV. 617
131 2.000e-77METAHIT unmapped GL0502941 unmapped_[Lack_both_end]_[mRNA]_locus=scaffold502889_2:2:1771:-  ali  21  196..MPENVYSCKFYGLGADGTVGANKNIKIIGDHTDKYVQAYFEYDSKKSGGLTVSHLRFGKQPIRSAYLVQRANFVACHNPSYLWKYMVQELVEGGTFLLNCPWEEQEIAEHLPNKIRFYVIDAAKIGMETGMGARINTILQAAFFKLADILPMELLKDAVRRTYGKK-GEDIVEKNCAAIDAGMQGIRKIE 401
132 2.000e-77gi|346225932|ref|ZP_08847074.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Anaerophaga thermohalophila DSM 12881]  clstr ali  27  415...PKGTFAGKFYGIGSDGTVGANKNIKIIGDNTDKFAQAYFAYDSKKSGGITISHLRFGDEPIRSPYLVNTPDFVACHVPSYLGKYMLKGLKKGGTFLLNSIWDAEETKKRIPNNINFYIINATQIAKEIGLGNRTNTIMQSAFFKIAEVIPYEEMKKFIVKSFGKK-GEDIVNMNFKAVDEGGN-VTKVE 616
133 2.000e-77gi|258513460|ref|YP_003189682.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Desulfotomaculum acetoxidans DSM 771]  clstr ali  22  411.TSAEGTICCKFWGLGSDGTVGANKAIKIIGDHTDLYAQGYFAYDSKKSGGSTISHLRFGKNPIKSTYLVINSDYTACHNSAYIYKYVLKGLKKNGTFVLNCQWSQEELEEKLPNNINFYIIDAVKIAQEIGLGGHINMIMQSAFFKLANVIPVEDLKDSIEKSYGKK-GDNIVDMNFAAVDRGIDALVKV. 614
134 2.000e-77METAHIT V1 GL0032658 [Complete] locus=scaffold19175_2:2067:5627:+  ali  19  412ITSAAGTKECKFWGLGGDGTVGANKNTKIIGDHTDKYIQAYFQYDSKKTGGITISHLRFGDNPIKSPYYINQADFVACHNPAYVTMKMVQDVKPGGVFMINCQWTDEELGHHLDNKIQLYTINAIDKAIEIGMGKRTNTILQSAFFKLADVMPIDDMKEAAKKSYSKK-GDAVVEMNYKAIDAGVDAIHKVE 618
135 2.000e-77gi|310659217|ref|YP_003936938.1| hypothetical protein CLOST_1913 [Clostridium sticklandii DSM 519]  clstr ali  19  413...PEGTVRCKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFSYDSKKSGGVTISHLRFGKTPIRSTYLIDEADFVACHNQAYVTQYLLRGLKKGGTFVLNCKWSDAELEENLPNEIKFYTINATDIAAEIGLGNRINMIMQSAFFKLADVIPMADAEKYLKDSIVKKKGQKILDMNFLAVGKGADALHMVE 615
136 2.000e-77METAHIT MH0053 GL0093516 [Lack both end] locus=scaffold3464_4:1:2868:+  ali  20  366...PAGTTPCKFWGFGSDGTVGANKAIKIIGDNTDLYAQAYFDYDSKKSGGVTMSHLRFGHKPIKSTYLLDEADYIACHKPSYIYYDVLEGLKKGGTFLLNCVWTPEELEKRLPNDIHFYTINAVKIASEIGLGGRINMVTQAAFFKLSAVIPLDQLKEAINRTYGKK-GQNIVDMNCQAVDRALDALVKI. 567
137 2.000e-77METAHIT V1 GL0074626 [Lack 3`-end] locus=scaffold10005_1:346:2799:+  ali  21  407.TTPEATVCCKFWGLGSDGTVGANKNIKIIGDHTDLYAQGYFSYDSKKSGGLTVSHLRFGREPIKSTYLVTKADFVACHNPAYLGKYMVHDIKPGGIFLLNCGWSMEELERRAKNNIHLYTIDAGAIGKELGLGGRVNTVLQAAFFRLTGIIPEEDALQFMKDAYGAK-GDDIVAMNHAAIERGFTDAREV. 610
138 2.000e-77gi|326790113|ref|YP_004307934.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Clostridium lentocellum DSM 5427]  clstr ali  21  415.....DLVRCKFWGLGSDGTVGANKAIKIIGNYTDMYAQAYFDYDSKKSGGLTMSHLRFGKEPINAPYLIDEADYIACHNQSYIHYDVLKGLKKGGIFVLNCLWDEKELEENLENDIQFYTVNAVKIASEIGLGNRINMIMQAAFFKLTDIIPEQYLKEAVVKAYGKK-GEKVINMNYAAIDRGLEAAIKV. 614
139 3.000e-77gi|410659371|ref|YP_006911742.1| Pyruvate-flavodoxin oxidoreductase [Dehalobacter sp. DCA]  clstr ali  22  420..TPEGTISCKFWGLGSDGTVGANKAVKIIGDNTDLYVQAYFSYDSKKSGGTTVSHLRFGRSPIKSRYLVFSADYIACHNQSFYHYDLLKGIKKNGTFVLNCPWSLHELEEHLPNNIHFYVIDAIDIASQIGLGGRINMVMQAAFFKLANVIPIEDLKNSIEKTYGRK-GQKIVEMNKAAVDQSISRLIRIE 624
140 3.000e-77gi|78358277|ref|YP_389726.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Desulfovibrio alaskensis G20]  clstr ali  19  411.TVPEGTVQCKFFGLGADGTVGANKAIKIIGDNTDMYAQGYFAYDSKKSGGFTVSHLRFGKSPIQSTYLVNRADYVACHKSAYVNYDVLEGIKDGGVFVLNSHWSLEDMEKELPKKLKFYNIDAVKIAGEVGLGGRINMVMQTAFFKLANVMPFEQLKDSIKKAYGKK-GDKIVNMNVAAVDKAMDALTEVQ 615
141 4.000e-77gi|182417629|ref|ZP_02948948.1| pyruvate:ferredoxin oxidoreductase [Clostridium butyricum 5521]  clstr ali  22  413.....GTTACKFWGLGSDGTVGANKNIKIIGDHTDMYAQGYFHYDSKKSGGITVSHLRFGKEQIKSPYLIDKADFVACHNQAYVYKYVLAGLKKNGKFLLNTIWSKEEVESKLPNEIEFYTLNAVKIAQEIGLGGRINMIMQSAFFKIADIIPLEDLKDAVVKSYGKK-GEKVVSMNHDAIDTGINSIVKIE 613
142 4.000e-77Oral.Meta HOMD adef_c_7_161 Abiotrophia defectiva ATCC 49176 [115001 - 118585] pyruvate flavodoxin/ferredoxin oxidoreductase domain-containingsprotei  ali  18  424.TAPEGTTSCKFWGLGADGTVGANKNVKIIGDHTDKYAQAYFDYDSKKSGGVTISHLRFGDKKINSTYLINKADFVACHNPSYIHKYMVQDIKDGGTFLLNCPWDVNELSERLPHGIKLYTIDGIKIGKEIGLGGRINTVLQAAFFKLANIIPIEDAVEYMKAAAKAKKGDDVVQMNYNAIDAGVSGVVEVQ 628
143 4.000e-77gi|15679732|ref|NP_276850.1| pyruvate ferredoxin oxidoreductase subunit gamma/delta [Methanothermobacter thermautotrophicus str. Delta H]  clstr ali  46  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYSQAFPFFGVERRGAPVMAFTRIDDSPVRRRYQVYNPDYVVVLDEGLVDVDVFSGLKDDGVVVLNKS------GDFQGGDVKVHTIDATGIALETLGRPIVNTVMLGAFAGVTGLVSIDSLIKIIKETFPGKIG----EKNAEAARMAYEEIEK.. 175
144 4.000e-77gi|354603835|ref|ZP_09021828.1| pyruvate:ferredoxin oxidoreductase [Alistipes indistinctus YIT 12060]  clstr ali  26  416.....GTFEALFFGLGADGTVGANKNIKIIGGSTDKYCQAYFSYDSKKSGGYTSSHLRFGDKPITSPYLVTTPDFVACHVPSYVDKYVLKGLKKGGSFLLNSIHDAETTKETLPDHINFYIINATKIAMDLGLGSRTNTIMQSAFFKIANVIPFEEMKKAIYKTYGKK-GEEIVSMNYAAVDKGGAEVHKVE 616
145 4.000e-77Oral.Meta HOMD avag_c_1_1305 Atopobium vaginae DSM 15829 [548462 - 552025] pyruvate-ferredoxin oxidoreductase  ali  24  422.TADPSTIECKFWGLGGDGTVGANKNIKIIGNHTNKYVQAYFQYDSKKTGGVTVSHLRFGDAPIRSSYYVTKANFVACHNPSYIIKRMVRDVKPGGTFLVNCQWDFAEFDRHLKNKIKVYLINAIDLARQVGMGKRTNTVLQSAFFALSGVLPFDDAIKYMKKSYSKK-GQAIVEANHKAIDAGASAFTQIE 627
146 5.000e-77gi|153954756|ref|YP_001395521.1| pyruvate-flavodoxin oxidoreductase [Clostridium kluyveri DSM 555]  clstr ali  18  410.TTPEGTTACKFWGLGSDGTVGANKAIKIIGDHTNMYAQGYFAYDSKKSGGITVSHLRFGKSQIKSPYLIDKADFIAVHNKSYVHKYVLEGLKKGGKFLLNTNWTEKELEGELPNDIEFYILDAVKIAEEIGLGGRINMICQAAFFKLANIIPVEDAVKYLKDAVEGKKGQKIVDMNNAAIDKGVNALVKV. 613
147 5.000e-77METAHIT O2 GL0085221 [Complete] locus=scaffold12404_3:2287:5703:-  ali  27  380.....GTTECKFYGLGSDGTVGANKNIKIIGNHTNKYCQGYFDYDSKKSGGYTCSHLRFGDAQIKAPYLVSTPDFVACHVPSYLRKYVLKGIKDGGTFLLNSLWNAEETVKRLPKHIKFYIIDATKIASEIGLGGRTNTILQSAFFKITGIIPYEDMKDAIVKSYGKK-GEKVVNMNYAAVDRGGEY..... 575
148 5.000e-77gi|381181728|ref|ZP_09890561.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Treponema saccharophilum DSM 2985]  clstr ali  24  412ITSAEGTVECKFWGIGGDGTVGANKSTKIIGDHTDKYIQAYFQYDSKKTGGITISHLRFGDKPIRSPYYINQADLVACHNQSYIIKGMVQDVKDGGTFLINCQWSDEELDKHLPHNIKVYTVDAVDIATKIGLGKRTSTVLQSAFFKLAGVLPAEEAIKYMKEKVVAKFGQDIVDMNCQAIDQGAGALHEVK 618
149 6.000e-77gi|147677704|ref|YP_001211919.1| pyruvate:ferredoxin oxidoreductase [Pelotomaculum thermopropionicum SI]  clstr ali  20  412.TTPEGTIQCKFYGLGSDGTVGANKAVEIIGDTTDLYSQAYFAYDSKKSGGFTVSHLRFGKKPIKSPYLINSADFVSCSNQSYYTLDMLSGLKKGGTFLLNCVWKPEELDERLPNNINFYIINAVDIARELGLGNRYNMIMQSAFFKLANVIPVEELKRTIKKTYGKK-GEKIVNMNFAAVDKGVDALIKI. 615
150 6.000e-77METAHIT MH0054 GL0019867 [Lack both end] locus=scaffold22319_2:1:2553:-  ali  22  301.....GTTACKFWGLGSDGTVGANKAVKIIGDNTDKYAQAYFAYDSKKSGGITVSHLRFGDTPIRSTYLIDKADFISCSQQSYVSKYILDGLKDGGIFLLNTMWDDTALEENLPHHIRFYTIDAVDIARNLGLGNRTNMIMQSAFFKLADIIPIEDAVKYLKDSIAGKKGDDVVAMNCDAVDQGITGLHEV. 500
151 6.000e-77gi|298373183|ref|ZP_06983173.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Bacteroidetes oral taxon 274 str. F0058]  clstr ali  27  411ITLNEDVYEAKFYGLGSDGTVGANKNVKIIGDNTDKYCQAYFSYDSKKSGGFTCSHLRFGDHPIRSTYLVNTPNFVACHNQAYLRYDVTRGLRKNGTFLLNTIWTEEELHKHLPNKVKVYYINATKIASEIGLGNRTNTILQSAFFRIANIIPIEEMKKFITKSYGKK-GQAILDKNFAAVDRGGEY..... 612
152 6.000e-77gi|405983713|ref|ZP_11042018.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Slackia piriformis YIT 12062]  clstr ali  23  413.TAAPGTIECKFWGLGGDGTVGANKNIKIIGDHTDKYVQAYFQYDSKKTGGVTISHLRFGDSPIRSPYYVNKADFVACHNPSYITKDFVKDVKPGGTFMINCQWTPEELEHHLQNNINLYTINAIDLAIEIGMGKRTNTILQSAFFSLAGVLPQEEAIRYMKDAATKKKGQDVVDTNHRAIDAGATAYVKI. 617
153 6.000e-77gi|43863|emb|CAA31501.1| unnamed protein product [Klebsiella pneumoniae]  clstr ali  20  415....DGITACKFWGMGSDGTVGANKAIKIIGDKTPLYAQAYFSYDSKKSGGITVSHLRFGDRPINSPYLIHRADFISCSQQSYVEYDLLDGLKPGGTFLLNCSWSDAELEQHLPENIHFYTLNAVDIARELGLGGRFNMLMQAAFFKLAAIIDPDYLKQAVEKSYGSK-GAAVIEMNQRAIELGMASLHQV. 615
154 6.000e-77gi|306490885|gb|ADM95003.1| hypothetical protein [uncultured candidate division JS1 bacterium]  clstr ali  53  1...MKKIIEVRWHGRGGQGAVTASKLLATSALAEDKYIQAFPEYGPERMGAPIQSFTRISDEPIKIHCHVTNPDMVVVLDPTLITVDITEGLSEDGIIVVNTSESPAQIRKKLNKGRKIFTVDASKIALEELGRSLPNTPMIGALIRATGLLKLENVINDIKDKFSGKFSQKIVDGNVNAIKRAYQEVK... 188
155 6.000e-77gi|160881678|ref|YP_001560646.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Clostridium phytofermentans ISDg]  clstr ali  21  408.TANKGTTACKFWGLGADGTVGANKNIKIIGDHTDKYAQAYFDYDSKKSGGVTISHLRFGDSPIKSTYLINKADFVACHMPAYVRRYMVQDLKKGGTFLLNCSWNMEEIEKNLPNNIKFYTIDGIQIGKEVGLGGRINTILQAAFFKLANIIPIEDAVKYMKDSYSKK-GDDIVKMNHTAIDRGVDGLVEIK 612
156 7.000e-77gi|227499151|ref|ZP_03929286.1| pyruvate-flavodoxin oxidoreductase [Acidaminococcus sp. D21]  clstr ali  21  411..TPKGTRSCLFWGLGSDGTVGANKAIKIIGDKTDMYAQGYFAYDSKKSGGITISHLRFGHDPIHMPFLINFADYIAVHNPSYVRYNVLNGIKEGGTFLLNCGWSGEELDTRLPKKVNFYTIDAVKIAREIGLGGRINMIMQAAFFKLADIIPIDDLKESIEHTYGKK-GQDVVDMNGRAVEAGVKNLVKV. 613
157 8.000e-77gi|326791118|ref|YP_004308939.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Clostridium lentocellum DSM 5427]  clstr ali  22  414....EGTVRCKFWGLGSDGTVGANKAVKIIGEHTNKYVQAYFAYDSKKSGGITMSHLRFGNEPIRSTYLIDEADYIACSQQAYVEYDLLKGLKKGGNFVLNCLWSAEELETKLPNKINFYTIDAVGIAASIGLGKRVNMIMQAAFFKLAHIISEEDLKQSIEKTYGKK-GQDVVEMNYKAVEAGFTSLVKI. 614
158 8.000e-77gi|317152782|ref|YP_004120830.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Desulfovibrio aespoeensis Aspo-2]  clstr ali  18  410.TTPEGTVQCKFWGLGADGTVGANKAIKIIGDNTNLYAQGYFAYDSKKSGGITISHLRFGEKPIQSSYLVTAADYIACHNPSYVHYDVLDGIKEGGTFVLNCPWTAAQMEIELPKGLKFYTVDAVKIAQQAGLGGRINMIMQTAFFKLADVIPFDQLKDGIKKAYGKK-GDKIVNMNNAAVDNAVDAIVEI. 613
159 8.000e-77METAHIT MH0026 GL0049234 [Lack 3`-end] locus=scaffold1968_4:1:2049:-  ali  23  415....DGTISCKFWGLGADGTVGANKNIKIIGDHTDKYAQAYFSYDSKKSGGITQSHLRFGDTPIRSTYLVKTADFVACHKQEYVHYDMVTELNPNGTFLLNTTWTVDELDEKLPKNANFYIINGTAIAGEIGLGNRINTVLQAAFFKLANIIPIEYMKAAITKSYGKK-GDTILNMNYAAVDRGVDGAVKVE 616
160 8.000e-77METAHIT V1 GL0080526 [Complete] locus=scaffold4334_1:1133:4672:-  ali  25  416.....GTFEALFFGLGADGTVGANKNIKIIGETTDKYCQAYFSYDSKKSGGYTSSHLRFGDCPITSPYLVTTPDFVACHVPSYVDKYVLKGLKKGGSFLLNSLQDVDAIKESLPNHINFYIINATKIAAELGLGNRTNTIMQAAFFKIANVIPYEQMKKFIYKSYGKK-GEDIVNMNYAAVDKGGEMVHKVE 616
161 8.000e-77gi|332982567|ref|YP_004464008.1| pyruvate ferredoxin oxidoreductase subunit gamma [Mahella australiensis 50-1 BON]  clstr ali  53  1...MGKMIEIRWHGRGGQGAKTASLLLAEALFNTGKYIQGFPEYGPERSGAPLTAYNRISDEPIRVHSNIYEPDYVVVVDETLLSVDVTAGLKETGGIVVNTPKSPEEIRHYLKDKGKVGTVDAKKISEEELGRYFPNVPMLGAIMAMTGLVEKEQFIKSMEESFHHKFKPEVIDGNVRALKRAMEEVR... 190
162 9.000e-77METAHIT MH0012 GL0223022 [Lack 3`-end] locus=scaffold12130_5:2:2695:-  ali  21  354...PKGTKACKFWGLGADGTVGANKNVKIIGDHTDMKAQAYFQYDSKKSGGVTISHLRFGHEPIRSTYYVKQADFVACHNEAYLYKYMVQDVKPGGFFLLNCTWSDDELEEKLPNNVQFYTCDAVSLAKEIGLGRRTNSILQAAFFKLADIIPIDEMKDAIKKTYGRK-GQNIVDMNCAAVDAGITHIHKVE 557
163 1.000e-76gi|374340516|ref|YP_005097252.1| 2-oxoacid:acceptor oxidoreductase subunit gamma, pyruvate/2-ketoisovalerate family [Marinitoga piezophila KA3]  clstr ali  66  1..MPEKYFEIRWHGRAGQGAKSASQFLTEAAVEAGKYSTAFPEYGAERSGAPMKAFNRIADVPIRIRSGIENPDVVVVFDDTMLGLDITAGLGEDKIMLVNTVMSPEEVREKTGFKGKIYTIPATDIALEEIKRGIPNTVMIGALVKLTNVVPMEVVKEKVRKTFEKKFSEEVVQANLRAVDRGYQEVK... 188
164 1.000e-76METAHIT MH0009 GL0134219 [Complete] locus=scaffold14125_1:14189:17713:+  ali  27  416....KGTTECKFYGLGSDGTVGANKNIKIIGTHTDLYSQAYFDYDSKKSGGYTCSHLRFGKSPIKAPYLVNTPDFVACHVPSYLEKYVLKGIKEGGSLLLNSLWNEEETLERIPKKIKLYIINATKIAAEIGLGGRTNTILQSAFFRITGIIPVEDAVKYMKKSYGKK-GENVVNMNYAAIDRGGEYV-EVK 616
165 1.000e-76METAHIT MH0052 GL0084500 [Lack both end] locus=scaffold31526_1:3:1691:-  ali  26  260..MKPGTTECKFFGLGSDGTVGANKNIKIIGDHTQKYAQGYFDYDSKKSGGYTCSHLRFGDLPIKAPYLVSTPDFVACHVPSYLSKYVLAGIKQNGTLLLNSLWDEKETLDRIPEHVKLYIINATKIAAEIGLGGRTNTILQSAFFKITNIIPYEDMKQAILKSYGKK-GENVVNMNYAAVDRGGEYTK... 460
166 1.000e-76gi|139438746|ref|ZP_01772230.1| Hypothetical protein COLAER_01233 [Collinsella aerofaciens ATCC 25986]  clstr ali  24  419.TAAPGTIECKFWGLGGDGTVGANKNIKIIGDHTDKYVQAYFQYDSKKTGGVTVSHLRFGDSPIRSPYYVTKADFVACHNPSYIVKGFVRDVKPGGTFLVNCQWSDEEFAEHMPNNVNVYLIDAIDLAAKVGMGKRTNTVLQSAFFALAKVLPAEDALQYMKDAATKKKGQAIVDANHKAIDAGATAFRKFE 624
167 1.000e-76gi|255994291|ref|ZP_05427426.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Eubacterium saphenum ATCC 49989]  clstr ali  19  422..EPEGTIRCMFWGLGSDGTVGANKAIKIIGDNTDMYAQGYFAYDSKKSGGVTISHLRFGKERIKSTYLINNADFVACHNQAYLTYDMLKNLKKGGTFLLNTTWEGPEIEANIPKKAKLYTINAVKIAEEIGLGHRINMVMQAAFFKLSKVLNLDDAVKYLKETYGRK-GQNIVDMNCKAVDMGINALSEHE 625
168 1.000e-76Oral.Meta HOMD NCBIABWK_c_1_1708 Mitsuokella multacida A 405-1, DSM 20544, ATCC 27723, NCTC 10 [347858 - 344220] pyruvate:ferredoxin (flavodoxin) oxi  ali  21  452..TPEGTTACKFWGLGSDGTVGANKAIKIIGDKTDMYAQAYFAYDSKKSGGITMSHLRFGKSPITSPYLINKADFISCSQQSYVYKYLLAGLKKGGTFLLNTVWSDEELTQHLPNEIQFYTVNAVSIAKGLGLGGRFNMVMQSAFFKLANIIPIETLKEAVVTSYGRK-GQNIVDMNNGAIDQGIEALHKVE 655
169 1.000e-76gi|125974875|ref|YP_001038785.1| pyruvate ferredoxin oxidoreductase subunit gamma [Clostridium thermocellum ATCC 27405]  clstr ali  48  1...MGKVVEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDEKLTIHSNIYEPDYVVVVDDTLLTVDVTAGLKEDGAIIVNTPKTPDEIRPLLKYKGKVCTIDARKISIETLGKYFPNTPMLGAVVKVSKIMDEEEFLKDMVESFKHKFKPEVVEGNIKALERSMQEVK... 190
170 1.000e-76gi|429184360|gb|EKY25379.1| pyruvate synthase [Clostridium celatum DSM 1785]  clstr ali  21  411ISTP-GTVRCKFWGLGSDGTVGANKAIKIIGENTAKYVQAYFAYDSKKSGGATMSHLRFGDTPIRSTYLIDEADYIGCHVQAYVNYDLLKGLKKGGNFVLNTIWNEEELDRKLPNEVNFYTVNATKLASEIGLGRRINMIMQSAFFKLAEIIPEEEAKESIKKAYGKK-GDKVVNMNYEAVEAGMNSLVKV. 614
171 1.000e-76gi|167751835|ref|ZP_02423962.1| hypothetical protein ALIPUT_00077 [Alistipes putredinis DSM 17216]  clstr ali  25  421.....GTFEALFFGLGADGTVGANKNIKIIGGTTDKYCQAYFAYDSKKSGGYTASHLRFGDKPITSPYLVTTPDFVACHVPSYVDKYVLKGLKPGGSFLLNSVHDAETTCRTLPNKINFYIINATKIAAELGLGSRTNTIMQAAFFKIANVIPFEEMKKAIYKSYGKK-GEDIVNMNYAAVDAGGNAVVKVE 621
172 1.000e-76gi|212550805|ref|YP_002309122.1| pyruvate-flavodoxin oxidoreductase [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2]  clstr ali  28  416..LENGTFEAKFYGLGADGTVGANKNVKIIGDNTNKYCQAYFAYDSKKSGGFTSSHLRFGDKPIRSAYLVNTPDFVACHIQAYLNYDVTKGLKKHGTFLLNTIWNEKQVKENLPDNVKFYIINATDIAHEIGLGNRTNTILQSAFFKITGIIPYEQMKRFIVKSYGKK-GEDVVNMNYAAVERGGDVLK... 616
173 2.000e-76gi|373494487|ref|ZP_09585090.1| pyruvate:ferredoxin oxidoreductase [Eubacterium infirmum F0142]  clstr ali  22  411.TVPEGTVACKFWGLGADGTVGANKNVKIIGDHTDKKVQAYFQYDSKKSGGVTISHLRFGDKPIKSTYYVKQANFVACHNEAYVNLYMVEDVKPGGSFLLNCTWSDAELDSHLPNNINFYTCDAVSIAKEIGLGRRTNSVLQAAFFKIANIIPIEEMKDAIRKTYGKK-GENIVNMNIAAVDAGIERVHKV. 615
174 2.000e-76METAHIT MH0011 GL0136813 [Complete] locus=scaffold56170_2:845:1423:+  ali  46  1...MENLIEIRWHGRGGQGTKTASLLLADAAFNTGKYIQGFPEYGQERRGAPITAYNRISDDPITVHSNIYEPDYVVVVDDTLLEVDVTAGLKTNGAIVINTTKSEDYLKSVLKYKGKVYTIDARKVSTQALGRYFPNTPMLAAIVKVTGIMNDEDFLKDMEGSFKHKFKPEVIDGNMKALEMALKEVKEI. 192
175 2.000e-76METAHIT unmapped GL0554766 unmapped_[Lack_both_end]_[mRNA]_locus=scaffold164314_2:3:1364:+  ali  16  66.SAPEGNISCKFWGLGSDGTVGANKMIKIIGDNTDQYAQGYFEYDSKKSGGITISHLRFGKNEIKSTYFISNADFVACHNPAYVHYDMLADLKQNGTFVLNCIWSPEELEENLPKNANFYIINAVKIGEDIGLGNRINMIMQSAFFALSKVIPLDEAIAHLKDQVVANYGDDIVAMNYKAIEMGSTAFTKVE 270
176 2.000e-76gi|357632824|ref|ZP_09130702.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Desulfovibrio sp. FW1012B]  clstr ali  19  412.TVPEGTVQCKFWGFGSDGTVGANKAIKIIGDNTDLYAQGYFAYDSKKSGGITVSHLRFGKKPIQSTYLVDAADYIACHKPSYVHYDILEGVKDGGTFVLNSSWTAEELEKNLPKKLKVYNIDAVAIGAKVGLGARINMIMQTAFFKLAGVLPIEELKDSIKKTYGNK-GEKIVKMNMDAVDMAMEGLVEI. 616
177 2.000e-76gi|317153096|ref|YP_004121144.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Desulfovibrio aespoeensis Aspo-2]  clstr ali  17  409.TTPAGTVQCKFWGLGADGTVGANKAIKIIGDNTKLYAQGYFAYDSKKSGGITISHLRFGKKPIQSTYLITDADYIACHNPSYVNYDILEGIKDGGTFVLNCPWTAKEMDDHLPKGLKFYTVDAVKIAQKVGLGGRINMIMQTAFFKLADVIPFAKLKDGIKKEYGKK-GDKIVNMNYAAVDSAVDAIVEI. 612
178 2.000e-76gi|397168634|ref|ZP_10492072.1| ferredoxin (flavodoxin) oxidoreductase [Enterobacter radicincitans DSM 16656]  clstr ali  21  415....EGITACKFWGLGSDGTVSANKAIKIIGDKTPMYAQAYFAYDSKKSGGITVSHLRFGERPITSPYLIHRADFIACSQQSYVDKYLLEGLNPGGTFLLNCTWFGEELEARLPNGIRFYTLNAVDIARKLGLGGRFNMLMQSAFFKLAGIIDPDYLKQAVEKSYGSK-GQKVVDMNNAAIDLGMEAIQEV. 615
179 2.000e-76gi|168334990|ref|ZP_02693106.1| pyruvate-flavodoxin oxidoreductase [Epulopiscium sp. `N.t. morphotype B`]  clstr ali  19  414.....GTVRCKFWGLGSDGTVGANKAIKIIGETTDKYVQAYFAYDSKKSGGITVSHLRFGDTPIRSTYLIDEADYIACHNQSYVEYDVLKGLKKGGTFVLNCVWEPEDVENHIENDINFYIVNATKIGEETGLGKRINMVMQTIFFKLANIIPFEEAREELRHSVEKKKGEKIVAMNFEAIDMSVSALVK.. 612
180 3.000e-76gi|256957802|ref|ZP_05561973.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Enterococcus faecalis DS5]  clstr ali  23  411..TPDTTFQAKFWGFGSDGTVGANKAIKIIGDHTDLYAQAYFSYDSKKSGGLTVSHLRFGKEPITSTYLIEQADFIACHNASYLHKYLLKGLKDGGTFLLNTIWDQEKVHRLLPAKIKFYIINAVELARKVGLGRRINTVMSTAFFEVTNILTKEQLKEEVKKTYGKKS-MEIVEKNYQAIDATFESLQEI. 613
181 3.000e-76METAHIT MH0054 GL0039953 [Lack both end] locus=scaffold27344_1:1:1908:+  ali  19  223.TTPEGTINCKFWGLGADGTVGANKNIKIIGDNTDMYAQAYFDYDSKKSGGVTKSHLRFGKKPIKSTYLIHKANFVACHNPSYVNKYMVEELVDGGTFLLNCPWDEAGLEEHLPHNIKFYVIDGVKIGIETGMGPRINTILQSAFFKLAKIIPEEKMKAAAKATYGRK-GDDVVAKNWAAIDEGAKQIKEV. 427
182 3.000e-76gi|291518661|emb|CBK73882.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Butyrivibrio fibrisolvens 16/4]  clstr ali  21  412ITSAPGTKECKFWGLGGDGTVGANKNTKIIGDHTDKYIQAYFQYDSKKTGGVTISHLRFGDNPIKSPYYINQADFVACHNPAYVTMKMVQDVKPGGVFMINCQWSDEELEEKLDNNIQLYTINAIDKAIEIGMGKRTNTILQSAFFKLADVMPIDEMKQAAKKSYGKK-GDDVVNMNYNAIDAGVDAVHKV. 617
183 3.000e-76METAHIT MH0020 GL0034805 [Complete] locus=scaffold9797_2:9255:12818:-  ali  23  411.TVPEGTISCKFWGLGSDGTVGANKNIKIIGDHTDLNVQAYFEYDGKKSGGVTRSHLRFGKKPINSTYLVNHADFIACHNKSYLDYDILADAKEGANVLITCDWKGEELEKHLLKKIHLYTIDSTAIAAELGLGSRTNTILQAAFFKITGIIPIEEMKKAILKSYGRK-GEKIVNMNYAAVDKGVEMVEEAE 615
184 3.000e-76Oral.Meta HOMD ccurt_c_1_6260 Cryptobacterium curtum DSM 15641, ATCC 700683, 12-3T [1121044 - 1117481] pyruvate:ferredoxin (flavodoxin) oxidoreductas  ali  24  418.TAAPGTIECKFWGLGGDGTVGANKNIKIIGDHTDKYVQAYFQYDSKKTGGTTISHLRFGASPIRSPYYINKADFVACHNPSYVIKDFVYDVKPGGIFLVNCQWTPEELAEHLRNNVQLYTINAIDLAREIGMGKRTNTILQSAFFSLAGVLPQEDAIRYMKDAATRKKGQDVVDMNHRAIDAGA....... 616
185 3.000e-76gi|229495879|ref|ZP_04389605.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Porphyromonas endodontalis ATCC 35406]  clstr ali  25  415....DGTFEAKFFGLGADGTVGANKNVKIIGDNTNKYCQAYFAYDSKKSGGFTASHLRFGDKPIRSTYLVVTPDFVACHVPAYLHYDVLKGLKKNGTFLLNSIWAPEDIEQHLPNNIRFYTINATAIAQEIGLGNRTNTILQSAFFKIANVIPYEQMKKFIVKSYAKK-GDDVVNKNYAAVDRGSEIIE... 613
186 3.000e-76METAHIT O2 GL0080521 [Lack both end] locus=scaffold65087_1:1:1995:+  ali  19  115.TTPEGTINCKFWGLGADGTVGANKNIKIIGDNTDMYAQAYFDYDSKKSGGVTMSHLRFGKKPIKSTYLIHKANFVACHNPSYVNKYMVEELVDGGTFLLNCPWDEAGLEEHLPHNIKFYVIDGVKIGIETGMGPRINTILQSAFFKLAKIIPEEKMKAAAKATYGRK-GDDVVAKNWAAIDEGAKQIKEV. 319
187 4.000e-76gi|167746138|ref|ZP_02418265.1| hypothetical protein ANACAC_00834 [Anaerostipes caccae DSM 14662]  clstr ali  20  408.STPESTVSCKFWGLGADGTVGANKNIKIIGDHTDKYAQAYFDYDSKKSGGVTISHLRFGDDPIKATYLINKADFVACHCAPYMTKYMVQDLKDGGTFLLNCSWPVEEIGDHLPHNIKFYVIDGIKIGKEIGLGGRINTVLQSAFFKLSGIIPEADAIQYMKDSYSKK-GDHIVKMNHDAIEAGAKSVVEV. 611
188 4.000e-76METAHIT V1 GL0070117 [Lack both end] locus=scaffold7270_1:1:1680:+  ali  25  299.....GTYEALFFGLGAGGTVGANKNIKIIGGSTNKYCQAYFSYDSKKSGGYTSSHLRFGDLPITSPYLVTTPDFVACHVPSYVDKYVLKGLKPGGSFLLNSVHDPETTCATLPDHINFYVINATKIAAELGLGSRTNTIMQSAFFKIANVIPFEEMKHAILKSYGKK-GEDIVNMNYAAVDAGGSAVVKVE 499
189 4.000e-76METAHIT MH0006 GL0007626 [Lack both end] locus=scaffold23906_5:3:1634:-  ali  24  242......MYEAKFYGLGSDGTVGANKNIKIIGGATNKYCQAYFAYDSKKSGGFTASHLRFGDDPIRSTYLVTTPDFVACHVPAYIHYDVLKGLKKGGSFLLNSLWDEKEIGEHLPNEINFYIINGTKIGQQLGLGNRTNTIMQSAFFKITNVIPYDEMKKAIDKSYGKK-GEAVVKMNYAAVDAGAENVVKV. 442
190 4.000e-76METAHIT O2 GL0059040 [Lack both end] locus=scaffold24425_2:1:1464:+  ali  18  175ITESADTVSCKFWGLGSDGTVGANKNAKIIGDHASMYTQAYFEYDSKNSYGITKSHLRFSKSPIRSTYLIKAADFLACHSQSYITYDMIHEIKDGGTFLLNTSWNQEELEEHLPGDVKFYTVDANRLARELGLGNHANMILQAAFFKLSNVMPVEDMKEAVQKTYAKK-GEKVVNMNMAAVDAGINSPVKVE 380
191 5.000e-76METAHIT MH0020 GL0068196 [Lack 5`-end] locus=scaffold5388_1:26322:29033:-  ali  28  137....EGMFEAKFYGLGADGTVGANKNVKIIGDNTNKHCQAYFSYDSKKSGGFTCSHLRFGDAPIRSTYLVNTPNFVACHVQAYLHYDVTRGLKKNGTFLLNTIWEGEELAKNLPNNIKVYYINATKIAQEIGLGNRTNTILQSAFFRITGVIPVEQMKKFIVKSYGKK-GEDVVNKNYAAVDRGGEY..... 333
192 6.000e-76gi|182416719|ref|ZP_02948119.1| pyruvate:ferredoxin oxidoreductase [Clostridium butyricum 5521]  clstr ali  20  412....EGCTACKFWGLGSDGTVGANKAIKIIGDHTDMYAQGYFDYDSRKSGGITISYLRFGKNPIKSRYLVDKADFIACHNQAYVDKYVTKGLKKDGVFLLNTLWNLDELEERLPNNINFYTINAVKIAQDIGLGGRINMIMQAAFFKLTNIIPVEDAVKYLKETAYGKKGENVVKMNHDAIDEGVNGIVKI. 612
193 6.000e-76gi|376295423|ref|YP_005166653.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Desulfovibrio desulfuricans ND132]  clstr ali  21  410.TAPAGTVQCKFWGLGSDGTVGANKAIKIIGDNTNLYAQGYFAYDSKKSGGITISHLRFGKKPIQSTYLVQNADYVACHNPSYVHYDVLEGIKDGGTFVLNCPWTAEEMDKQLPKNLKFYAVDAVKIAAGVGLGGRINMVMQTAFFKLADVIPFTKLKDGIDKAYGKK-GQKIVDMNCAAVDKAPDALVEI. 613
194 6.000e-76gi|227872319|ref|ZP_03990674.1| pyruvate synthase [Oribacterium sinus F0268]  clstr ali  21  409.TTPKGTVNCKFWGLGADGTVGANKNIKIIGDNTDKYAQAYFDYDSKKSGGVTMSHLRFGDQPIKSTYLIKRANFVACHNPSYMTKNMVQELVDGGTFLLNCTWSKDEVEKHIPHNIKFYIINGVKIGIETGMGPRINTILQSAFFTLTGIIPKEQMKDAAQKTYGRK-GEDVVKKNWAAIDAGANAFEEVE 614
195 7.000e-76gi|307132770|ref|YP_003884786.1| Pyruvate-flavodoxin oxidoreductase [Dickeya dadantii 3937]  clstr ali  21  408.TAPEGTTACKFWGLGSDGTVGANKAIKIIGDQTPMYAQAYFSYDSKKSGGITVSHLRFGTQPITSPYLIRNADFIACSQQSYVEKYLLAGLKPGGTFLLNCTWSQAALEDALPNQIRFYVVNAVDIAQQLGLGGRFNMIMQAAFFKLTGIIPADTAADYLKSAVAGKKGQHVVAMNQAAIDQGM....... 605
196 7.000e-76gi|373106080|ref|ZP_09520384.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Stomatobaculum longum]  clstr ali  18  408.TTPEGTTNCKFWGLGADGTVGANKNIKIIGDNTDMYAQAYFDYDSKKSGGVTMSHLRFGHKPIKSTYLIHQADFVACHNPAYIRKYMVQELVDGGTFLLNCAWSDAELEEHLPHKINLYTIDGVKIGIETGMGPRINTILQSAFFKLTGIIPEEKMKDAAQKTYGRK-GEDVVKKNWNAIDAGASGAHKVE 613
197 7.000e-76METAHIT MH0060 GL0118559 [Lack 3`-end] locus=scaffold18323_3:929:3430:+  ali  21  277.......ISCKFYGLGSDGTVGANKNIKIIGDHTDKYAQAYFAYDSKKSGGITISHLRFSDKPIRSTYLIDQADFVACHNESYLRYDMLSDLKDGGTFLLNSQWEPEEMDAKLPKHVKFYTLDGLKVIQEIGTKKGVNTVMQAAFFKLANVIPYEDMKEMIKKSYGKK-GDAVVAMNNACVDNAIAHLKEVK 475
198 7.000e-76gi|374300534|ref|YP_005052173.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Desulfovibrio africanus str. Walvis Bay]  clstr ali  20  412.TTPKGTIQCQFWGLGADGTVGANKAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKPIQSTYLVNRADYVACHNPAYVGYDILEGIKDGGTFVLNSPWSSEDMDKHLPKKLKFYNIDAVKIATDVGLGGRINMIMQTAFFKLAGVLPFEKLKKSIHKAYGKK-GEKIVKMNTDAVDQAVTSLQEFK 617
199 7.000e-76gi|154496280|ref|ZP_02034976.1| hypothetical protein BACCAP_00567 [Bacteroides capillosus ATCC 29799]  clstr ali  22  411.TAAEGTIECKFWGLGGDGTVGANKNIKIIGDHTDKYVQAYFQYDSKKTGGVTISHLRFGDKAIKSPYYINKADFVACHVPAYIIKPMVRDVKDGGIFLINCQWSDEELDKHMPHNIQVYTINAIDLAIEIGMGKRTNTILQSAFFKLAKVMPEAEAIQYMKDAATHKKGQDVVDMNHKAIDAGATAFHKFE 616
200 7.000e-76gi|421075832|ref|ZP_15536838.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Pelosinus fermentans JBW45]  clstr ali  18  411.TTVPGTTACKFWGLGSDGTVGANKAIKIIGDHTDMYAQAYFAYDSKKSGGVTISHLRFGKQPIKSPYLINKADFIACHNQSYYNYPVLDGLKKGGSFLLNCRWSQAEIESKLPNDIEFYTIDGVGIAEEIGLGGRINMIMQSAFFKIADIIPLHDLKEAVWKSYGNK-GEKVVAMNHAAIDKGIYSIVKI. 614
201 8.000e-76gi|15895497|ref|NP_348846.1| pyruvate:ferredoxin oxidoreductase [Clostridium acetobutylicum ATCC 824]  clstr ali  18  411.TTPEGTKTCKFWGLGSDGTVGANKAIKIIGDHTSMYAQGYFAYDSKKSGGITVSHLRFGKKEIKSPYLIDKADFIACHNQSYVYKYVLAGLKKGGNFLLNTIWSPEEIEEKLPNDINFYTLNAVKIAQGIGLGGRVNMICQAAFFKIANIIPVEDAVKYLKDAVYGKKGQKVVDMNNAAIDQGVGAIVKI. 614
202 8.000e-76gi|242278205|ref|YP_002990334.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Desulfovibrio salexigens DSM 2638]  clstr ali  18  411.TTPEGTVQCKFWGLGSDGTVGANKAIKIIGDKTDMYAQGYFAYDSKKSGGITVSHLRFGNSPIKSTYLVEIADFIACHNPSYVKYDLLDGIREGGTFLLNTSMGLEELEAELPNKLKFYVIDGVKIAGEVGLGGRINMVMQTAFFKLANVIPFEDAVKYLKESIQGKKGEKIVNMNNAAVDQAEANLIEIK 615
203 9.000e-76gi|154505922|ref|ZP_02042660.1| hypothetical protein RUMGNA_03464 [Ruminococcus gnavus ATCC 29149]  clstr ali  18  427.TTPEGTINCKFWGLGADGTVGANKNIKIIGDNTDMYAQAYFDYDSKKSGGVTMSHLRFGKSPIKSTYLIRQANFVACHNPSYVDKYMVQELVDGGTFLLNCSWDMEGLEEHLPHNIKFYTIDGIKIGKEIGLGGRINTVLQSAFFKLAAIIPEEEMKAAAKATYGRK-GDKIVQMNYDAIDAGAKQVVEI. 630
204 9.000e-76gi|418016358|ref|ZP_12655923.1| pyruvate:ferredoxin oxidoreductase [Candidatus Arthromitus sp. SFB-mouse-NYU]  clstr ali  25  428......MISCKFWGLGSDGTVGANKMIKIIGDNTDKHVQAYFEYDSKKSGGITISHLRFGDSRIRSTYGIVKADFVACHNQAYMSKYIVTGVKNNGAFLLNTLWTPEELEEKLPNNIHFYTINAVKIARELGLGGRINMIMQSAFFKLAKIIPIEDAVKYLKKAYGKK-GEKIVKMNFDAIDAGVSAIVKI. 627
205 9.000e-76gi|206896485|ref|YP_002247507.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Coprothermobacter proteolyticus DSM 5265]  clstr ali  57  5.......LEIRWHGRAGQGVKTAAYLLAEAAMDTGKYIQAFPEYGAERSGAPIAAFTRIGDEPIRIHYGIRTPDVVVVVDESLIAMDVTSGLKENGILLVNSNQSPEIYRQKLPSHGKIATVDATQIALDCIGRPIPNIPIMGALIRASGIVSLEDLEPRLRHKFSAKFSEQVVEGNVKALKRGYEEVK... 188
206 9.000e-76Oral.Meta HOMD falo_c_1_6562 Filifactor alocis ATCC 35896 [562883 - 559344] pyruvate-flavodoxin oxidoreductase  ali  19  412.TSSKGTMRCKFWGLGSDGTVGANKAIKIIGDNTDLYAQGYFDYDSKKSGGITVSHLRFGKQPIRSTYLIDQADFIACHNQSYVTYDLLKGLRNGGTFVLNTQWSDEELDTKLPKNIQFYTVDAVKIGQELGLGNHINMIMQAVFFELTKVIPVEQLKEAIQQTYAKK-GEDIVQINCMAIDKGQEALHQV. 615
207 9.000e-76gi|156938043|ref|YP_001435839.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Ignicoccus hospitalis KIN4/I]  clstr ali  49  9.......VEIRWHGRGGQGAVTASEIVAKAAIAQGKYAQAFPSFGVERRGAPVEAFTRIDEKPIYIRSKIYEPDIIVVLDPSLLGPKLAEGLKEGGMAIVNTEKTPDEVRKLLREDVKVAVVNATKIALETLKRPIVNTAILGAFAKATGLVDLDALLEAVKE----KVPPRTVEANLEAVRRAYEEVV... 187
208 9.000e-76gi|212704112|ref|ZP_03312240.1| hypothetical protein DESPIG_02167 [Desulfovibrio piger ATCC 29098]  clstr ali  18  410.TVPAGTVQCKFFGLGADGTVGANKAVKIIGDNTDMYAQAYFAYDSKKSGGFTVSHLRFGKSPIQSSYLITQADYIACHKAAYVTYDILDGIKDGGTFVLNSNWSLEDMEKHLPKHLKFFNVDAVAVAQEVGLGGRINMIMQTAFFKLANVIDFDKLKESIKKTYGMK-GDKIVNMNIAAVDKGMDALVEIK 614
209 1.000e-75gi|350271930|ref|YP_004883238.1| pyruvate-ferredoxin (flavodoxin) oxidoreductase [Oscillibacter valericigenes Sjm18-20]  clstr ali  21  411.TSPDGQTNVEIWGMGSDGTVGANKNIKIIGHATDLYCQAYFVYDSKKSGGLTQSHLRFGKDPIRSPYLVHNADFVACHTPSYVNKYMVKDLKDGGTFLLNCSWDLDGLERNLPKHASFYTINAIDIARKLGLGNRTNTILQAAFFKLTGVIPVDEMKEAIYKTYYKKKGQAVVNMNNASIEHGIDELQKIQ 616
210 1.000e-75gi|320535295|ref|ZP_08035417.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Treponema phagedenis F0421]  clstr ali  19  413.TEPTGNIRCKFWGFGSDGTVGANKAIKIIGDSTGMYAQAYFAYDSKKSGGVTVSHLRFGKKPIKSAYLISDADFISCSKQSYVHYDLLKGLKKGGTFLLNCLWSDAELENTIPNDIKFYTINATEIAQKIGLGHRINMIMQSAFFKLAEIIPIESLKSSILSTYGKK-GDDIVKMNYTAVDMGIESPHQV. 616
211 1.000e-75gi|315924269|ref|ZP_07920493.1| pyruvate-ferredoxin oxidoreductase [Pseudoramibacter alactolyticus ATCC 23263]  clstr ali  18  416.TIPEGTTSCKFWGLGSDGTVGANKAIKIIGDNTDLYAQGYFDYDSKKSGGITCSHLRFGKKPIKSPYLINQADFISCSTESYVHYDLLDGLKKGGTFLLNTVWTPEQINEELPNDIQFYTINATKAAEDIGLGRRTNMILQAAFFKLAKILPIEDAKASIKKTYGNK-GEAIVEMNYKAVDAGVD...... 614
212 1.000e-75Oral.Meta HOMD ppis_c_1_503 Pyramidobacter piscolens W5455, DSM 21147, CCUG 55836, F0317 [83371 - 79736] (REVERSE SENSE) ORF  ali  24  438.TESEGTVACKFWGLGSDGTVGANKNIKIIGDNTDQYVQAYFEYDTKKSGSVTRSHLRFGRLPIRSTYLVTQADFVACHVQAYIGKYNVSGLKDGGTFLLNCAWKPEDLERHLPKHINFYIIDATRIAMEIGMGNRTNSVLQSAFFKLSGILPFEDMKEAIKSTYGAK-GDKVLRMNYEAVDRGGASVIRIE 642
213 1.000e-75gi|291278971|ref|YP_003495806.1| pyruvate:ferredoxin oxidoreductase [Deferribacter desulfuricans SSM1]  clstr ali  24  419LTPQDDVFNGMFYGLGSDGTVGANKNAKIIGELTDNFVQAYFVYDSKKSGSMTVSHVRFGKKPIRSSYLIQEADFVACHNFSFLEQYILKPLKKGGIFLLNSIYTKDEVWDKLPKEVKFYVINANKIAEEIGLGGRVNVILQTAFFKISNVIPFDAIKDAIKKTYG-KYGDEVVNMNIKAVEAGMNEVYEV. 623
214 1.000e-75gi|315925657|ref|ZP_07921867.1| pyruvate-ferredoxin oxidoreductase [Pseudoramibacter alactolyticus ATCC 23263]  clstr ali  21  411.TTPEGETSAEFWGMGSDGTVGANKNIKIIGNATDLYCQAYFVYDSKKSGGLTQSHLRFGKNPIHSPYLIQAADFVACHNPSYVHYDMVKNLKAGGTFLLNCQWDMDGLEAHLPKNAQFYTIDAIDIARELGLGGRTNTILQSAFFKLSGVIPIEQAVREMKDSYFKKKGQKVVDMNNAAVEKGVDAFVKI. 615
215 1.000e-75METAHIT V1 GL0001561 [Lack both end] locus=scaffold27437_2:1:1923:+  ali  27  53.......FQAKFYGLGADGTVGANKNVKIIGDNTNKYCQAYFAYDSKKSGGFTCSHLRFGDVPIRSTYLVNTPNFVACHVQAYLHYDVMRGLQPGGTFLLNTIWNADELAKNLPNSVKLYYINASKIAQEIGLGNRTNTILQSAFFRITEVIPVEQMKKFIVKSYAKK-GQNIVDMNYQAVDRGNEY-HKLE 250
216 1.000e-75gi|342215626|ref|ZP_08708273.1| pyruvate synthase [Peptoniphilus sp. oral taxon 375 str. F0436]  clstr ali  17  411.TEPEGTIACKFWGFGSDGTVGANKAIKIIGDGTDMYAQGYFDYDSKKSGGVTMSHLRFGHKKITSTYLITEANFISCSKQSYVYYDLLRGIKKGGKFLLNTIWTEEELESHLPNEIEFYTINATKIAAEVGLGGRTNMVMQAAFFKLSEVLPIEELKEAIVKDYGHK-GDDIVAMNNKAVDRGMDAIVRI. 614
217 1.000e-75METAHIT MH0076 GL0105975 [Complete] locus=scaffold8640_2:30:611:-  ali  46  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTSPIRVHSNIYEPDYVVVVDDTLLKVDVASGLKEDGAIVINTTKGIDEIAPLLKYKGSVYTIDARKVSEEALGKYFPNTPMLAAIVKVAGIMPEDDFIKDMQDSFKHKFKPEVIDGNMKALKLALEQVKKIQ 193
218 1.000e-75gi|389887023|ref|ZP_10210556.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Coriobacteriaceae bacterium JC110]  clstr ali  23  412.TAAAGTIECKFWGLGGDGTVGANKNVKIIGDHTDKYVQAYFQYDSKKTGGVTISHLRFGDSPIRSSYYINKADFVACHNPSYITKNFVKDVKPGGTFMINCQWTPEELEEHLSNDVQLYTINAIDLARQIGMGKRTNTILQSAFFTLANILPAEDAVRYMKDAATRKKGQEVVDMNHRAIDAGATAFVKI. 616
219 1.000e-75gi|260587961|ref|ZP_05853874.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Blautia hansenii DSM 20583]  clstr ali  19  418.TTPEGTINCKFWGLGADGTVGANKNIKIIGDNTDMYAQAYFDYDSKKSGGVTMSHLRFGKSPIKSTYLIKQANFVACHNPSYVNKYMVQELVDGGTFLLNCPWDMEGLEKHLPHNIKFYVIDGIKIGKEIGLGGRINTVLQSAFFKLANIIPEEQMKAAAKATYGRK-GDAIVQMNYDAIDAGAKQVVEIQ 622
220 2.000e-75gi|345889237|ref|ZP_08840259.1| pyruvate:ferredoxin oxidoreductase [Bilophila sp. 4_1_30]  clstr ali  22  411..VAEGQTACKFWGFGSDGTVGANKLVKIIGDHTDMYSQAYFAYDSRKSGGVTISHLRFGSQPIRSSYLIDYADFIACHNQSYVDKYLLRGIKEGGVFLLNCMWKDGDLEKHLPKKIRFYTLNAVDIAMNLGLGGRINMLMQAAFFKLAGIIPLDDAVEAIVKTYGRK-GHSVVDMNQEAVRQGIAMLHEV. 613
221 2.000e-75gi|167770396|ref|ZP_02442449.1| hypothetical protein ANACOL_01739 [Anaerotruncus colihominis DSM 17241]  clstr ali  18  411.TAPDGTTACKFWGLGSDGTVGANKNIKIIGDHTDMYAQAYFAYDSKKSGGVTVSHLRFGHTPIHSTYLISKANFVACHNPSYITKYMVEDLVDGGTFLLNCPWSAEELEERLPGKVKFYTIDGIDIGRKLGLGTRINTVLQSAFFKLAKIIDEADAIKYMKKSYGAK-GDKVVKMNHDAIDEGAKAVVKV. 614
222 2.000e-75gi|404485021|ref|ZP_11020225.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Barnesiella intestinihominis YIT 11860]  clstr ali  28  416....EGIFEAKFYGLGADGTVGANKNVKIIGDNTDKYCQAYFSYDSKKSGGFTCSHLRFGDTPIRSTYLVNTPNFVACHVQAYLHYDVLRGIRQNGTFLLNTIWTAEELVKHLPNNVKFYTINATKIAQEIGLGNRTNTILQSAFFRITEVIPIEQMKKFIVKSYGKK-GEDVVNKNYAAVDRGGEY..... 612
223 2.000e-75gi|365129619|ref|ZP_09341082.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Subdoligranulum sp. 4_3_54A2FAA]  clstr ali  22  411.TAAEGTVECKFWGLGGDGTVGANKNTKIIGDHTDKYIQAYFQYDSKKTGGVTISHLRFGDKPIRAPYYINKADFVACHNPSYVIKGMVNDVKPGGVFMINCQWTPEELDHHMPNNIQLYTINAIDKAIEIGLGKRTNTILQSAFFALAGVLPKEDALKFMKKSFAKK-GDAIVEMNYKAIDAGFDAFVKI. 615
224 2.000e-75gi|27262514|gb|AAN87538.1| Pyruvate-flavodoxin oxidoreductase [Heliobacillus mobilis]  clstr ali  20  413...PEGTIQCKFWGLGSDGTVGANKAVEIIGNNTDMYAQAYFAYDSKKSGGVTVSHLRFGKKLIRSPYLIHSADFISCSNQAYVYYNLLAGLKEGGTFLLNTVWSPEELNEKLPKKINFYTIDAVHIAKKLGLGNRTNMIMQSAFFKLANVIPIDTLKDSIKKAYGRK-GEQIVAMNEAAVDDGINALVKVE 615
225 2.000e-75gi|255523967|ref|ZP_05390930.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain protein [Clostridium carboxidivorans P7]  clstr ali  22  413.PTPEGTIACKFWGYGSDGTVSANKAIKIIGNNTDYYAQAYFAYDSKKSGGLTVSHLRFGESPIKEPYEITNADFIACHNQSYVNKYLLAGIKKNGKFLLNCIWSEEELGNQLPNNVEFYIIDAVDIAREIGLGGRINMIMQAAFFKLAQIIPVEEVKKEVEKSYGSK-GQNIVDMNNLAIDKGFGSMRKI. 616
226 2.000e-75gi|302335287|ref|YP_003800494.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Olsenella uli DSM 7084]  clstr ali  23  413.TSAAGTIECKFWGLGGDGTVGANKNIKIIGDHTDKYVQAYFQYDSKKTGGVTISHLRFGDAPIRSPYYVTAADFVACHNPSYIIKGFVRDVKPGGSFLLNCQWSDEEFAEHMPNDINVYLIDAIDLAAKVGMGKRTNTVLQSAFFALAKVLPAEDALRYMKKSYSKK-GEAVVAANHKAIDAGATAFRKFE 618
227 2.000e-75gi|291545110|emb|CBL18219.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Ruminococcus champanellensis 18P13]  clstr ali  23  411.TAAEGTIECKFWGLGGDGTVGANKSIKIIGDHTDKYVQAYFQYDSKKTGGITVSHLRFGDQPIKSPYYINKADFVACHNPSYIMKGMVNDVKPGGKFLINCQWTPEELEKHLKNNIQLYTVNAIDIAAKIGLGKRTSTVLQSAFFALANVLPSEDAINYMKEKFSKK-GQDIVDMNHKAIDAGKDALVKI. 615
228 2.000e-75gi|159026286|emb|CAO88863.1| unnamed protein product [Microcystis aeruginosa PCC 7806]  clstr ali  20  414.TEPDKVVRAVFYGLGSDGTVGANKNIKIIGEDTDNYAQGYFVYDSKKSGSVTVSHLRFGPEPIRSTYLITDANFIACHQWEFIEQDLLETAKPNSIFLLNSPYPPEELFSHLPKNLQVYTINATQVAKEAGMGSRINTVMQVCFFALAGVLSREEIKKAIRKTYGKK-GEEIVQMNIKAVDSALEHLYQV. 617
229 2.000e-75gi|169335115|ref|ZP_02862308.1| hypothetical protein ANASTE_01522 [Anaerofustis stercorihominis DSM 17244]  clstr ali  24  414...PKGTVACKFWGLGADGTVGANKNVKIIGDYTDKKVQAYFQYDSKKSGGVTISHLRFGDKPIKSTYYVKQADFVACHNSAYLNYDMVEDVKPGGYFLLNCVWSDEELETFLPNDIQFYTCDAVSIAKKIGLGRRTNSVLQAAFFKLANIIPIEDMKDAINKTYGKK-GQKIVDMNVAAVDEGIKNVHKVE 617
230 3.000e-75METAHIT MH0020 GL0091753 [Lack 5`-end] locus=scaffold5110_7:6942:9470:-  ali  23  72ITAAEGTIECKFWGLGGDGTVGANKSIKIIGDHTDKYVQAYFQYDSKKTGGVTISHLRFGDKPIKSSYYINKADFVACHNPSYIEKRMVEDVKPGGVFLINCQWDENELSEKLKNNIQLYTVNAIDIAAKIGLGKRTNTVLQSAFFSLAKVLPAEEAIGYMKEKAQKKKGIEIVKMNEAAIDAGASAYVKI. 276
231 3.000e-75METAHIT MH0059 GL0016302 [Complete] locus=scaffold35358_1:4263:7790:-  ali  27  417.....GTTECKFYGLGSDGTVGANKNIKIIGSHTQKYCQAYFDYDSKKSGGYTCSHLRFGDKPIKAPYLVSTPDFVACHVPSYLSKYVLKGIKEKGTLLLNSLWDEEETVKRIPKKIKLYIINATKIAAEIGLGNRTNTILQSAFFKITGIIPYEDMKDAIVKSYGNK-GENVVNMNFAAVDRGGEYTEVA. 616
232 3.000e-75gi|258649199|ref|ZP_05736668.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Prevotella tannerae ATCC 51259]  clstr ali  29  416....KSIFEAKFFGLGADGTVGANKNIKIIGDNTDKYCQAYFSYDSKKSGGFTCSHLRFGDTPIRSTYQIKTPNFVACHVQAYLRMYVTEGLRDNGTFLLNTIWDSEELAKNLPNNIKVYYINATKIAQEIGLGNRTNTILQSAFFRITNVIPIDQMKKFIVKSYSRK-GQDVVDKNYQAVDRGNEY..... 612
233 3.000e-75gi|304440515|ref|ZP_07400402.1| pyruvate:ferredoxin oxidoreductase [Peptoniphilus duerdenii ATCC BAA-1640]  clstr ali  20  411.TEPAGTIRCKFWGFGSDGTVGANKAIKIIGDNTDMYAQGYFDYDSKKSGGVTMSHLRFGTNRITSTYLLSEMDFISCSKQSYVYYNLLRGLKRGGTFLMNTTWSDEELETHLPNDIKFYTINATKIAAEIGLGGRTNMVMQSAFFKLSEVLPMEQLKEAIVKDYGAK-GDEIVNMNYKAVDQGVEALHAV. 614
234 3.000e-75gi|333381166|ref|ZP_08472848.1| pyruvate:ferredoxin oxidoreductase [Dysgonomonas gadei ATCC BAA-286]  clstr ali  28  418.......YEAKFYGLGSDGTVGANKNVKIIGDNTDKYCQAYFAYDSKKSGGFTASHLRFGDNPIRSTYLVNTPNFVACHVPAYLHYDVTKGLKKNGTFLLNSVWDKEDVGNYLPNNINFYIINATKIATEIGLGGRTNTILQSAFFKISNVIPYEQMKKFIVKSYGRK-GEDVIKKNYAAVDRGVE-VEKVE 615
235 3.000e-75gi|421076223|ref|ZP_15537216.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Pelosinus fermentans JBW45]  clstr ali  22  414....EGTISCKFWGLGSDGTVGANKNIKIIGDHTDLYVQAYFEYDTKKSGGITKSHLRFGKTPIRSSYYVKTADFVACHNPSYIDKYIVSDIKDNGIFLLNCSWKGNELEESLKKNIQFYIIDATHIAKEIGLGSRTNTILQAAFFKLAKVIPVEYMKAAILKSYGQK-GEKVIHMNNAAVDQGVIGAEKVK 615
236 3.000e-75gi|365842661|ref|ZP_09383658.1| pyruvate synthase [Flavonifractor plautii ATCC 29863]  clstr ali  22  459.TAAPGTIECKFWGLGGDGTVGANKNIKIIGDHTDKYVQAYFQYDSKKTGGVTISHLRFGDEPIRAPYYINKADFVACHVPAYIVKPMVRDVKDGGVFLINCQWSDEELDHHMPHNIQVYTINAIDLAIEIGMGKRTNTILQSAFFKLAKVMPEAEAIGYMKDAATHKKGQDVVDMNHKAIDMGATAFHKFE 664
237 3.000e-75gi|310827119|ref|YP_003959476.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Eubacterium limosum KIST612]  clstr ali  19  411.TVPEGTKGCKFWGLGSDGTVGANKNIKIIGDHTDLYAQGYFDYDSKKSGGITVSHLRFGKQPIKSPYLIVNSDFISCSTQAYVHYDLLNGLKKGGTFLLNTVWSVDELGERLPNDTQFYIINATKVAEEIGLGRRTNTIMQAAFFKLADIIPIDDMKEGIMKSYGKK-GDKIVNMNYEAVDAGIDILTKVE 617
238 4.000e-75METAHIT V1 GL0131470 [Lack both end] locus=scaffold2915_3:2:997:+  ali  21  22....EGTIACKFWGLGGDGTVGANKNIKIIGDNTDMQVQAYFQYDSKKSGGVTISHLRFGKNQIKASYYVTKADFVACHLASYIEKDIVQDIKPGGTFLLNCPWNLQELEEHLPNHIRVYTCDATHKAIELGMGNRSNTILQAAFFKLAKVIPVEEMKDAIVKSYGHK-GMDVIMRNYNAVDAGVEGVQEI. 222
239 4.000e-75gi|94986722|ref|YP_594655.1| pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit [Lawsonia intracellul  clstr ali  21  413.TVPPGTIQCKFFGFGSDGTVGANKAVKIIGDNTDKYVQAYFAYDSKKSGGFTASHLRFGDHPIRSTYLVTQADYIACHHPAYIQYDVLEGIKEGGIFVLNSSWNTEDLERELPKKLRFYNIDAVKIASEVGLGGRINMIMQTAFFKLANIIPFEKLKQSIQETYKSK-GEDVVKINYTAVDNTVSALNEIQ 618
240 4.000e-75METAHIT V1 GL0070431 [Lack both end] locus=scaffold8744_2:1:2541:-  ali  18  281...PEGTIACKFYGLGSDGTVGANKNIKIIGDHTDMYAQGYFAYDSKKSGGFTVSHLRFGKKPIQSPYLIDAADFVACHNASYVTYDVTEGIKEGGTFLLNSEWTLEEMEHELPNHLKFYNIDAVKLAKEVGMGNRINTIMQSAFFKLANVIPADQAIEYMAKKSYAKKGEDVVARNYAAIDAGANAIVEI. 482
241 4.000e-75gi|375337192|ref|ZP_09778536.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Succinivibrionaceae bacterium WG-1]  clstr ali  22  407...PKGTSACKFWGLGADGTVGANKNVKIIGDHTDKYVQAYFQYDSKKSGGVTISHLRFGDSPIKSSYYVKQADFVACHNSSYLYKYMVQDVKPNGFFLLNCTWNDEELSEHLPNNIKFYTCDAVSLAKKIGLGRRTNTVLQAAFFKIANIIPINEMKEAILHSYAKK-GQNIVDMNNAAVDAGVENIHLV. 609
242 4.000e-75gi|158521464|ref|YP_001529334.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Desulfococcus oleovorans Hxd3]  clstr ali  19  410.TAPRGTIQCKFWGLGADGTVGANKAIKIIGDHTDMYAQAYFAYDSKKSGGVTMSHLRFGKKPIQSTYLIDSADYIACHKASYVHYDLLEGIKTGGTFLLNSDWTAEQMAAELPKKLKFYNIDAVKIAGEVGLGGRINMIMQTAFFKLANVIPVKDLKEQIKEMFGKK-GDNIVKMNCDAVDKTLENIVEIK 614
243 4.000e-75gi|374385387|ref|ZP_09642893.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Odoribacter laneus YIT 12061]  clstr ali  24  414..THDTTYEAKFYGLGSDGTVGANKNIKIIGGATDKYCQAYFAYDSKKSGGFTASHLRFGDEPIRSTYLITTPDFVACHVPAYINYDVLKGLKKGGSFLLNSLWDAEETKKHLPNDINFYIINGTKIGQELGLGNRTNTIMQSAFFKITNVIPYEEMKSAIVKTYGKK-GEAIVNMNYAAVDAGGENLIKVE 619
244 4.000e-75METAHIT MH0070 GL0000315 [Lack 3`-end] locus=scaffold22295_2:3:2903:-  ali  18  410.TTPEGTTCCKFWGLGSDGTVGANKNIKIIGDHTDMYAQAYFAHDSKKSGGVTISHLRFGKTPIKSTYFINKANFVACHNPSYIDKYMVEDVVPGGSFLLNCHWTVDELDEKLPNNINFYIINANKVAREIGLGNKTNTVLQSAFFSIANIIPPEDAITYMKKMAYKKKGDDIVNMNYAAIEKGAGEVIKV. 613
245 5.000e-75METAHIT O2 GL0015671 [Lack both end] locus=scaffold240_4:1:1449:-  ali  27  225....EGIFEAKFYGLGADGTVGANKNIKIIGDNTDKYCQAYFSYDSKKSGGFTCSHLRFGDHPIRSTYQIKTPNFVDCPVQAYLHYDVLRGLRDNGTFLLNTIWEGDELANNLPNNVKVYYINATKIAQEIGLGNRTNTILQSAFFRITGVIPVEQMKKFIVKSYSKK-GQDIVDKNYQAVDRGGEY..... 421
246 5.000e-75gi|350566839|ref|ZP_08935470.1| pyruvate:ferredoxin oxidoreductase [Peptoniphilus indolicus ATCC 29427]  clstr ali  21  411.TEPKGTIRCKFWGFGSDGTVGANKAIKIIGDNTDMYAQGYFDYDSKKSGGVTMSHLRFGKEKITSTYLLAESDFISCSKQSYVHYDLLRGLRKGGTFLLNTVWDEETLANELPNEIEFYTINATKIAAEIGLGGRTNMVMQSAFFKLSKVLPIEQLKKAIVKDYGSK-GDEIVAMNYKAVDQGIDALQKIE 615
247 5.000e-75gi|325261442|ref|ZP_08128180.1| pyruvic-ferredoxin oxidoreductase, gamma subunit [Clostridium sp. D5]  clstr ali  44  1...MDNMIEIRWHGRGGQGAKTAAMLLAEAAFDTGKFIQGFPEYGPERMGAPVTAYNRISNERILVHSNIYEPDYVVVVDETLMDLDVTAGLKKEGALLINSPKSPAEIREKCGYEGRIYTIDADRIAMETLGKNFPNTSMLSAVVKITKVEEEERFLESLQESFRHKFEHKMIEPNMQAAARAFREVKE.. 191
248 5.000e-75gi|257063579|ref|YP_003143251.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Slackia heliotrinireducens DSM 20476]  clstr ali  23  413.TASEGTIECKFWGLGGDGTVGANKNIKIIGDHTDKYVQAYFQYDSKKTGGITVSHLRFGDTFIRSPYYVNKADFVACHMPAYITKGFVRDVKPGGTLLINCQWDLEELEHHLSNDINLYTINAIDLAIEIGMGKRTNTILQSAFFALANVLPAEEAIQYMKDAATKKKGQDVVDKNHRAIEVGATAFVKV. 617
249 5.000e-75gi|328956229|ref|YP_004373562.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Coriobacterium glomerans PW2]  clstr ali  22  413.TSAPGTVECKFWGLGGDGTVGANKNIKIIGDHTDKYVQAYFQYDSKKTGGVTISHLRFGCSPIRSPYYVSKADFVACHNPSYVTKRFVRDVKPGGTFLINCQWDVDELGRQLENDIQVYTINAIDLAAEIGMGKRTNTILQSAFFALAKILPQEDAIRYMKHSYLSK-GQAIVDMNHKAIEIGATAFKRVE 618
250 6.000e-75METAHIT MH0083 GL0091920 [Lack 5`-end] locus=scaffold11790_2:5061:7847:-  ali  28  155....ESTYEAKFYGLGADGTVGANKNVKIIGENTKKYCQAYFAYDSKKSGGFTCSHLRFGDEPIRSTYLVTTPNFVACHVQAYLHYDVTRGLRDGGTFLLNTIWEGDELAKNLPNKVKVYYINATKIAQEIGLGNRTNTILQSAFFRITEVIPVEQMKKFIVKSYGKK-GQDIVDKNYAAVDRGGEY..... 351
251 7.000e-75gi|167751377|ref|ZP_02423504.1| hypothetical protein EUBSIR_02368 [Eubacterium siraeum DSM 15702]  clstr ali  19  418.TTPEGTTCCKFWGLGSDGTVGANKNIKIIGDHTDMYAQAYFAYDSKKSGGVTISHLRFGKSPIKSTYFVNKANFVACHNPSYIDKYMVEDVVPGGSFLLNCQWTVDELDEKLPNNINFYIINAIKVAKEIGLGNKTNTVLQSAFFSIANIIPAEDAIEYMKKSFAKK-GDDIVKMNYAAIEKGAGEVIKV. 621
252 7.000e-75gi|169824082|ref|YP_001691693.1| pyruvate/ferredoxin oxidoreductase [Finegoldia magna ATCC 29328]  clstr ali  16  411.TSPEGTIRCKFWGFGSDGTVGANKAIKIIGDGTDMYAQGYFDYDSKKSGGVTMSHLRFGNNPIHSTYLLDESDFISCSKQAYVYYDLLRGLRKGGTFLLNCIWDEKELDTHLPNDIKFYTINASKIAAEVGLGGRTNMIMQAAFFKLSKVLPIDELKESIVHNYGRK-GEDIVNMNYAAVDQGIDQLVEIK 615
253 7.000e-75Oral.Meta HOMD apar_c_1_4064 Atopobium parvulum ATCC 33793 DSM 20469 IPP 1246 [1495256 - 1491651] pyruvate ferredoxin/flavodoxin oxidoreductase  ali  23  431.TAAEGTIECKFWGIGGDGTVGANKNIKIIGDHTDKYVQAYFQYDSKKTGGITISHLRFGDHKIRSPYYVTKADFVACHVPAYIIKGMVRDVKPGGTFLVNCQWDAEEFAHHLPNNINVYLINAIDLAKEIGMGKRTNTILQSAFFALAKVLPEADALQYMKDAATHKKGQNVVDMNHKAIDAGATAFTKIE 636
254 7.000e-75gi|332652559|ref|ZP_08418304.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Ruminococcaceae bacterium D16]  clstr ali  21  412.TAAEGTIECKFWGLGGDGTVGANKNIKIIGDHTDKYVQAYFQYDSKKTGGVTISHLRFGDKAIRSPYYINKADFVACHNPSYVTKDFVRDVKPGGVFMINCQWNMEELEHHLSNNIQLYTINAIDLAAKIGMGKRTNTILQSAFFTLAKVMPQEEAIQYMKDAATKKKGQDIVDMNHKAIDAGATAFVKI. 616
255 9.000e-75gi|312879496|ref|ZP_07739296.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Aminomonas paucivorans DSM 12260]  clstr ali  19  409.TEDPKTVRCLFFGLGSDGTVGANKNIKIIGEDTDNYAQGYFVYDSKKSGGLTTSHLRFGPKPLRSSYLIDKAGFVACHQFSFLERNVLKNAVPGGVFLLNSPFGPEEVWNHLPKKLRFYVIDAVTIAKETGMGNRINTIMQTCFFAISGVLPKDEIKKSIKKTYGKK-GEAVVKQNIDAVDATLANLYEVK 613
256 9.000e-75gi|348025506|ref|YP_004765310.1| pyruvate-flavodoxin oxidoreductase [Megasphaera elsdenii DSM 20460]  clstr ali  21  415....KGLKACKFWGFGSDGTVGANKAIKIIGDNTDMYAQAYFAYDSKKSGGVTVSHLRFGDTPIQMPYLINNADFIACHRQSYVHFDLLRGIKKGGTFLLNTVWKPEELDEKLPNDVQFYIIDAVGIAQKIGLGGRINMIMQSAFFKLADVIPLDKLKESVVASYGKK-GQNIVDMNNEAIDQGLSAIVKV. 615
257 1.000e-74gi|427413317|ref|ZP_18903509.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Veillonella ratti ACS-216-V-Col6b]  clstr ali  21  411..TAEGLTGCKFWGFGSDGTVGANKAIKIIGDYTDMYAQAYFDYDSKKSGGVTMSHLRFGKTPINKPYLVTEPEFIACHRQSYVEYDLLRGIKKGGTFLLNCTWTPEELEEKLPKELNFYIINAAEIAREIGLGGRINMICQAAFFKLTNIIPIEYLKDSVEKTYGKK-GQNVVDMNNAAIDKGVGALVKI. 613
258 1.000e-74METAHIT MH0009 GL0080385 [Complete] locus=scaffold20629_6:1169:4696:-  ali  17  408.TAPEGITSCKFWGLGADGTVGANKNIKIIGDHTDMYAQAYFDYDSKKSGGVTISHLRFGHSKIHSTYLINKADFVACHNPAYVRKYMVQDLKDGGTFLLNCDWDMAGLEEHLPHNIKFYTIDGIKLGIETGMGARINTILQAAFFKLANIIPIDDAVKYMKDAATAKKGEDVVKKNHNAIDAGLANVVEVK 612
259 1.000e-74gi|301064184|ref|ZP_07204627.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [delta proteobacterium NaphS2]  clstr ali  17  411.SAPEGTVRCKFWGLGADGTVGANKNIKIIGENTDMYAQAYFAYDAKKSGGITISHLRFAPHKIQAPYLLTKSDFIACHNPSFVEYDILDGIRKGGAFLLNSPWTLKEMETRIPDHMKFYNIDAVKIGAELGLGTRINMIMQAAFFKIANVIPPEEVKTAIKKTYGKK-GDKIVQMNIDAVDQAVDALKKIK 615
260 1.000e-74gi|303231857|ref|ZP_07318568.1| pyruvate synthase [Veillonella atypica ACS-049-V-Sch6]  clstr ali  18  415.....GLTECKFWGFGSDGTVGANKAIKIIGDHTDLYAQAYFDYDSKKSGGVTMSHLRFGTNPINLPYLITEPQFVACHRQSYVEYDLLRGIKKGGTFLLNCTWSPEELNEHLPKELNFYIINAAKIAAEIGLGGRINMVTQAAFFKLTEIIPVDDAIKYLKESVYGKKGQNIVDMNNAAIDQGVGALVKV. 614
261 1.000e-74gi|269122203|ref|YP_003310380.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Sebaldella termitidis ATCC 33386]  clstr ali  23  411.TGNADVTECLFFGLGSDGTVGANKNIKIIGDKTPLYSQGYFAYDSKKSGGVTRSHLRFSKDPIRSTYLVTKANFVACSVPAYLGKYMLTGLKEGGSFLLNSIWDADKVVEHLPNEIKFYIINATAMAEEVGLGTRTNTIMQSAFFKLTNVIPYEEMKEYIEKTYGAK-GQDIVKMNWAAVDKGTEGLVEV. 614
262 1.000e-74gi|50121881|ref|YP_051048.1| pyruvate-flavodoxin oxidoreductase [Pectobacterium atrosepticum SCRI1043]  clstr ali  19  416.....GTTACKFWGLGSDGTVGANKAIKIIGDHTPLYAQAYFSYDSKKSGGITVSHLRFGQSPITSPYLIHHADFIACSQQSYVEKYLLVGLKPGGTFLLNCSWTAEELAAKLPNAIRFYTLNAVHIAQRLGLGGRFNMIMQAAFFKLAAIIAPETLKAAVVKSYGSK-GQNVVDMNSAAIDEGMQALVEV. 615
263 1.000e-74gi|352516817|ref|YP_004886134.1| pyruvate--flavodoxin oxidoreductase [Tetragenococcus halophilus NBRC 12172]  clstr ali  28  413..TPDSTFQARFWGFGSDGTVGANKAIKIIGDHTDKYAQAYFDYDSKKSGGLTVSHLRFGEEKIDSTYLVEKPDFVGCHNAAYIYKDLVKGLRDGGTFLLNTVWNEEQVHKHLPTNLKFYIINAMDIAKATGLGRRINTVMSAAFFEVTDIMDRKELKDEIDKTYGKKS-QEIVEKNWQAIDQTFENLHEI. 615
264 1.000e-74Oral.Meta HOMD sspu_c_8_269 Selenomonas sputigena ATCC 35185 [75914 - 79522] pyruvate:ferredoxin (flavodoxin) oxidoreductase  ali  21  442..TPEGTTACKFWGLGSDGTVGANKAIKIIGDKTDMYAQAYFAYDSKKSGGITMSHLRFGKSPINSPYLIHNANFISCSQQSYVTKYLLAGLKRGGKFLLNTVWNEEDLSKHLPNNIEFYTVNAVEIAKELGLGGRFNMVMQSAFFKLANIIPIETLKDAVVASYGNK-GQKIVDMNNGAIDKGIEALHRV. 644
265 1.000e-74METAHIT MH0020 GL0085772 [Complete] locus=scaffold2636_1:24206:27778:-  ali  28  416....EGIFEAKFYGLGADGTVGANKNVKIIGDNTNKYCQAYFAYDSKKSGGFTCSHLRFGDTPIRSTYLVNTPNFVACHVQAYLHYDVTRGLRPNGTFLLNTVWSGEELAKHLPNKVKVYYINATQIAQEIGLGNRTNTILQSAFFRITEVIPVEQMKKFIVKSYGKK-GEDVVNKNYAAVDRGGEY..... 612
266 1.000e-74METAHIT MH0043 GL0061177 [Lack 3`-end] locus=scaffold25067_6:1613:4681:+  ali  20  405.TAKSGTISCKFWGLGSDGTVGANKNIKIIGDKTDLYVQGYFAYDSKKSGGITVSHLRFGKDPIKSTYYISKADFVACHNVSYIKKYIVQDLKLGGNFLLNCPWGLNELEIELPNKINFYTINATKIGKEIGLGGKINTILQAAFFKIANIIPVEKALEYMKKSYGKK-GEKIVAMNHEAIERGMTELQKIE 609
267 1.000e-74gi|317485394|ref|ZP_07944273.1| ferredoxin oxidoreductase [Bilophila wadsworthia 3_1_6]  clstr ali  20  411.TVAPGTVQCKFFGLGADGTVGANKAIKIIGDNTDLYAQAYFAYDSKKSGGFTVSHLRFGKSPIHSTYLVNQADYIACHKSAYVHYDVLEGIKEGGVFVLNSEWTVEDLSRELPKNIKFYNVDAVKVAMEIGLGGRINMIMQTAFFKLAEVIPFEQLKDSIKKTYGRK-GDKVVNMNLAAVDNAIAALTEIK 616
268 2.000e-74gi|315651463|ref|ZP_07904486.1| pyruvate-ferredoxin oxidoreductase [Eubacterium saburreum DSM 3986]  clstr ali  18  409.TTPEGTTNCKFWGLGADGTVGANKNIKIIGDNTDMYAQAYFDYDSKKSGGITMSHLRFGKKPIKSTYLIHKANFVACHNPAYIRKYMVQELVDGGTFLLNCAWSDAELEEHIPHKINFYTIDGVKIGIATGMGPRINTILQSAFFKLSAIIPEEQMKKAAEKTYGRK-GEDVVKKNWAAIEEGAKNVHKVE 614
269 2.000e-74gi|121534265|ref|ZP_01666089.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain protein [Thermosinus carboxydivorans Nor1]  clstr ali  23  413.TTPPGTVCCKFWGMGSDGTVSANKAIKIIGDHTDLYVQAYFAYDARKSGGLTISHLRFGQQPIQSSYLITNADFIACHNQAYVNYDILAGLKPGGKFLLNCQWQMHDLEKNLPNNIQFYTINAIDIAKELGLGGRINMIMQAAFFKLVDIIPVEDAIHYLKESVYGKQGQAIIDMNFAAIERGVRELCRIE 617
270 2.000e-74METAHIT MH0080 GL0051554 [Lack both end] locus=scaffold8072_1:3:3044:-  ali  28  324....ESTYEAKFYGLGADGTVGANKNVKIIGDNTRKYCQAYFAYDSKKSGGFTCSHLRFGDEPIRSTYLVNTPNFVACHVQAYLNYDVTRGLRKGGTFLLNTIWEGEELAKNLPNDITVYYINATKIAQEIGLGNRTNTILQSAFFRITEVIPIEQMKKFIVKSYGKK-GQDVVDKNYAAVDRGGEY..... 520
271 2.000e-74gi|150020241|ref|YP_001305595.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Thermosipho melanesiensis BI429]  clstr ali  66  1..MPAKYFEIRWHARAGQGAKSASQMLAEAALEMGKYVQSFPEYGAERTGAPMKAFNRVSDEPILIHSSVDYPDVVVIIDDTMLGQPLTDGTDENTVFIVNTVKDVEYVREKLGVKGKICTIAATDIALEELKRGIPNTVMLGAIAKVTGVITLESAEQRIRKAFSKKFPEELVEANVRALRRGFEEVK... 188
272 2.000e-74Gut.JP.Meta  ali  21  3...........FRGLGGDGTVGANKNIKIIGDHTDKYVQAYFQYDSKKTGGVTVSHLRFGDKAIKSPYYINKADFVACHNPSYITKGFVQDVKPGGVFLINCQWNLEELEHHLDNNIQLYTIDAIDLAIKVGMGKRTNTILQSAFFSLAKVMPAEDAIKYMKDAAEHKKGRDVVEKNWNAIDVGATAYHKV. 197
273 2.000e-74gi|294102067|ref|YP_003553925.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Aminobacterium colombiense DSM 12261]  clstr ali  18  414...PEGTIRCKFWGLGSDGTVGANKNIKIIGDNTDMYAQGYFAYDSKKSGGVTISHLRFGKKPIRSTYLIDEADFIACHKQEYVYYDVLAGLKKGGTFLLNTQWTTEELEKNLPGNVKLYVLNGIDLGMEIGLGNRINMIMQSAFFKLAKVIPLDDMKDAILETYGLK-GEKIVEMNYKAVDAGIGALIKI. 616
274 2.000e-74gi|373455553|ref|ZP_09547382.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Dialister succinatiphilus YIT 11850]  clstr ali  22  410..MPGKLVSCKFWGFGSDGTVGANKAIKIIGDHTNLYAQGYFAYDSKKSGGVTISHLRFGEDPIRKPYLIRKADYIACHRPSYIYKYLLRGFKPGGIFLLNSPWRKEDLERVLPAHARFYIIDAFEIAKKIGLGGRINMIMQAAFFHLTHIIPDEDAVKYLKKSYGRK-GQNVVDMNNAAVDAGMTGMEEVE 613
275 3.000e-74METAHIT V1 GL0128425 [Complete] locus=scaffold99318_1:7533:8108:+  ali  49  1......MIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDTPIRIHSNIYEPDYVVVVDDSLIAVDVTSGLKDNGAIVINTNEDIDSLRKKLGFSGKIYTIDASKISLECLKANFPNTAMLAAVVNITKIMSKEELVDNMKDAFSHKFKPEVIEPNMEALLRGYDEIK... 187
276 3.000e-74gi|354559338|ref|ZP_08978588.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Desulfitobacterium metallireducens DSM 15288]  clstr ali  20  410.TAPEGTISCKFWGLGSDGTVGANKAIKIIGDHTDMSAQAYFQYDSKKSGGTTISHVRFGKKAIKSPYYVIGADYIACHNQAYVQYDLVKGLKKNGTFVLNTQWKPEDLEEKIPNDINFYIIDAVSIGREIGLGSRINMIMQAAFFKLANVIPVDYLKESVIKAYGKK-GQNIIDMNNAAIDRGVGSLVKVE 614
277 3.000e-74gi|429150504|gb|EKX93412.1| pyruvate synthase [Prevotella sp. oral taxon 473 str. F0040]  clstr ali  25  415....EGMFQAKFYGLGADGTVGANKNVKIIGETTDKYCQAYFSYDSKKSGGFTCSHLRFGDHPIRSTYLVNTPNFVACHVQSYMHYDVLRGIQPNGTFLLNTLWEGEDLVRNMPNKIKVYTINATKIAREIGLGNRTNTILQSAFFRITNVIPVDKAVKEMKKTYGKK-GQDIVEKNYAAVDRGGEY..... 611
278 3.000e-74METAHIT MH0003 GL0137715 [Complete] locus=scaffold18459_1:4266:7778:+  ali  18  412..EPEGTISCKFWGLGSDGTVGANKNIKIIGETTDMYCQAYFEYDTKKSFGITKSHLRFGKKPISSTYYVSHADFIACHNQTYLTKYIISELKPHGSFLLNCEWSEDELEQKMPNDIKFYIIDANKESQSLGLGNRSNMVLQAAFFKLANVIPVEDMKDAVKKTYGLK-GEKIVNMNIAAVDAGINAVKQVQ 615
279 4.000e-74gi|339443164|ref|YP_004709169.1| hypothetical protein CXIVA_21000 [Clostridium sp. SY8519]  clstr ali  18  408.TAPEGTVACKFWGLGADGTVGANKNIKIIGDNTDMYAQAYFDYDSKKSGGVTISHLRFGKSPIHSTYLINKANFVACHCTAYIHKYMVQDLVPGGTFLLNCSWDMEGLEKNLPNDIQFYTIDGIKIGKEIGLGGRINTVLQSAFFKLSNIIPEDQMKAAAKATYGKK-GDKIVQMNYDAIDAGAKNVVKIE 612
280 4.000e-74gi|406883696|gb|EKD31227.1| hypothetical protein ACD_77C00360G0004 [uncultured bacterium]  clstr ali  26  417....KGVKECKFYGLGSDGTVGANKNIKIIGETTPKYVQAYFDYDSKKSGGYTCSHLRFGDTPINAPYLVSTPDFVACHVTSYLTKYVLKGIKKGGTLLLNTLWSTQETIDKLPDHIKFYIINATKIAEDIGLGNRTNTILQSAFFKIADIIPSEEMKKAAEKSYGRK-GEAILEMNNAAIDRGSEY-EKVE 617
281 4.000e-74gi|296110002|ref|YP_003616951.1| pyruvate/ketoisovalerate oxidoreductase, gamma subunit [methanocaldococcus infernus ME]  clstr ali  47  1......MIEIRFHGRGGQGAVTAAQILAKAAFYDGKYCQAFPFFGVERRGAPVRAFTRIDDKEILIRSQIYEPDYVVVLDPTLLDVNVLEGLKKDGAVIVNTVKD-------LDLGYKVYTLDATKIALDVLGVPIVNTSMVGAFAGATKLVSLESVKKAILETFKGKLG----EKNALAAEKAYNEIIE.. 174
282 4.000e-74Oral.Meta HOMD lbuc_c_1_529 Leptotrichia buccalis C-1013-b, DSM 1135, ATCC 14201, JCM 1296 [390066 - 393644] ORF  ali  23  415.TGNEDVKGCLFFGLGSDGTVGANKNIKIIGDKTDLYAQGYFAYDSKKSGGVTRSHLRFSKKPIRSTYLVKKPNFVACSVPAYLGKYMISGLREGGIFLLNTIWDKEKLRELARKKAKFYLINATEIAKEIGLGNRTNTIMQSAFFYLSEVIPHDEAKEYMKKSYGRK-GQDIVQKNWDAIDRGIDGLEEVE 619
283 4.000e-74gi|154484477|ref|ZP_02026925.1| hypothetical protein EUBVEN_02191 [Eubacterium ventriosum ATCC 27560]  clstr ali  47  20...MKDTLEIRWHGRGGQGAKTAALLLAEVAFKTGKNAQGFPEYGPERMGAPITAYDRISDQPIRVHSNIYDPQYVVVVDETLIEVDVTKGLREDGAILINTARPKEEIIPHLKYKGKVYTVDARKIAMETLGKNFPNTPMLAAIVKVTGVIDDETFLNEMEGSFKHKFKPEVIKGNMDALRIALREVK... 209
284 4.000e-74METAHIT V1 GL0003926 [Complete] locus=scaffold66995_3:253:834:-  ali  48  1...MKDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPMTAYNRISVNPIRVHSNVYEPDYVVVVDDTLLSVPVTDGLKEEGAIIINTTKGIDEIKPLLGYNGNVYTIDAKKISEEALGKYFPNTPMLAAIVKVTEIMEDEAFIKDMEGSFKHKFKPEVIDGNMQAIKEALKQVKKVQ 193
285 4.000e-74gi|269793044|ref|YP_003317948.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Thermanaerovibrio acidaminovorans DSM 6589]  clstr ali  21  409.TEDPKTVRCLFYGLGSDGTVGANKNIKIIGEETDYNAQGYFVYDSKKSGGLTISHLRFGPKPIRGSYLISNANFVACHQFSFIERNVLKRAAKGGVFLLNSPYGPDQVWDKLPKELKFYVIDAVSIAKETGMGGRINTIMQTCFFAISGVLPREEIKKSIKKTYGKK-GEDVVMRNIEAVEATLSNLHQVK 613
286 5.000e-74gi|224371989|ref|YP_002606155.1| protein PorA4 [Desulfobacterium autotrophicum HRM2]  clstr ali  23  411.PAPEGTVSAKFWGLGSDGTVGANQAIKIIGDNTDKYAQGYFAYDSKKSGGITISHLRFGDVPIQSTYLINRADFVACHKSNYVQYDVLEGLKEGGTFLLNSAWSLEDMEKTIPNKIKFFNVDAVKIAGEVGLGNRINMIMQTCFFKLANVIPFEELLKAIKKTYGKK-GDKIVQMNIDAVDRTLANLVEIE 615
287 6.000e-74gi|389577458|ref|ZP_10167486.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Eubacterium cellulosolvens 6] :_  clstr ali  47  1...MDNTLEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAFNRISKDPIRVHSNIYYPDYVVVVDETLLHVHVTDGLKDEGAIIVNTSKTEEEIRPLLKYTGRVVVIDARDISEKALGKNFPNTPMLAAAVAVSGVMPKDDFIANMRESFGHKFKPEVIDGNMKALEDAFKAV.... 189
288 6.000e-74Oral.Meta HOMD sexi_c_4_1244 Slackia exigua ATCC 700122 [145502 - 141657] pyruvate:ferredoxin (flavodoxin) oxidoreductase  ali  21  512.TAAPDTIESKFWGLGGDGTVGANKNVKIIGDHTDKYVQAYFQYDSKKTGGVTISHLRFGDSPIRSSYYINKADFVACHNPSYVTKGFVQDVKPGGVFMINCQWTPEELEHHLRNGIQLYTINAIDLAIEIGMGKRTNTILQSAFFSLAKVLPAEDAIRYMKDAATKKKGQDIVDMNHRAIDAGATAYRKI. 716
289 6.000e-74gi|222823423|ref|YP_002574997.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Campylobacter lari RM2100]  clstr ali  20  414....ESTIECLFYGLGADGTVGANKNIKIIGDKTDFYAQAYFAYDSKKSGGYTRSHLRFSKKPITSTYLVSTPHFVACSVAAYLEYDVLAGIRKGGTFLLNSIWNAQETIKRIPKEINFYIINATKLAREIGLGSRTNTIMQSAFFKLANIIPFEDAQKYMKKSYSKK-GDAIVEMNYKAIDVGADGLVKV. 614
290 6.000e-74Gut.JP.Meta  ali  22  419ITAAEGTIECKFWGLGGDGTVGANKSIKIIGDHTDKYVQAYFQYDSKKTGGVTISHLRFGDKPIKSSYYINKADFVACHNPSYIEKRMVEDVKPGGVFLINCQWNEKELSEKLKNNIQLYTVNAIDIAAKIGLGKRTNTVLQSAFFSLAKVLPAEEAIGYMKEKAQKKKGIEIVKMNEAAIDAGASAYVKI. 623
291 7.000e-74gi|57242553|ref|ZP_00370491.1| pyruvate ferredoxin/flavodoxin oxidoreductase family protein [Campylobacter upsaliensis RM3195]  clstr ali  21  417.......IECLFYGLGADGTVGANKNIKIIGDKTDFYAQAYFAYDSKKSGGYTRSHLRFSKKPIRSTYLVSTPHFVACSVAAYLEYDVLAGIRKGGTFLLNSIWNAKETIRQLPKEVNFYIINATKLARDIGLGNRTNTIMQSAFFKLAKIIPYEDAQKYMKKSYSKK-GDAIVEMNYKAIDMGADGLVKVE 615
292 8.000e-74gi|348026231|ref|YP_004766036.1| pyruvate-flavodoxin oxidoreductase [Megasphaera elsdenii DSM 20460]  clstr ali  22  414....EGTISCKFWGFGSDGTVGANKNIKIIGDNTDMYVQAYFEYDTKKSGGVTKSHLRFGKKPIRATYYIKSADFLACHKQAYMTYDIVSEIKDGGIFLLNCSWDKDDVANHLSNKVKFYIINATKIAEEIGLGNRTNTVLQAAFFKLANILPIDDMKDAIAKTYLAK-GEQVIAMNQAAVDRGISDIVEV. 615
293 9.000e-74gi|257457105|ref|ZP_05622282.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Treponema vincentii ATCC 35580]  clstr ali  22  422....SGMHQAMFYGLGSDGTVGANKNIKIIGEATDNNAQAYFVYDSKKSGSITTSHLRFGKKKIRKPYLVGQADFIACHKFTFLEYDMLKSLKKGGTFLLNSHWNKDEVWEHLPKEAKFYVIDGVKIAEKAGMGNRINVVMQTAFFKISGILPEDEIKKFIEKSYGKK-GPEIVQKNIKTIDMALEGVEQV. 622
294 9.000e-74Oral.Meta HOMD synsp_sgp_c_1_3910 Synergistetes sp SGP1 [1392407 - 1396168] ORF  ali  18  465.TAAEGTVCCKFWGLGSDGTVGANKNIKIIGDHTDMYAQGYFDYDSKKSGGITVSHLRFGKSPIKSTYLIDSADFIACHKQEYVNYDLTAGLKKGGTFLLNTQWTPEALEEHLPSDAKFYVINAVDEAQKIGLGNRTNSIMQAAFFKLANVIPIDDMKQAIVDTYGRK-GEKVVKMNHDAVDAGLKSLIEIK 670
295 1.000e-73Oral.Meta HOMD ssat_c_2_3119 Shuttleworthia satelles DSM 14600 BAA-774 CCUG 45864 [97859 - 94269] pyruvate:ferredoxin oxidoreductase  ali  18  429.TTPKGTTNCKFWGLGADGTVGANKNIKIIGDNTDMYAQAYFDYDSKKSGGVTVSHLRFGHTPIRSTYLISQANFVACHCQAYIYKYMVQDLVPGGTFLFNTQWTEDELDEKLPNDINFYIIDGVKIGKEIGLGRRINTVLQSAFFSLTKLIPEEQVLKLMKDSYAKK-GDNVVKMNWDAIDAGATAYHKV. 632
296 1.000e-73gi|345862377|ref|ZP_08814601.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Desulfosporosinus sp. OT]  clstr ali  20  410.TAPEGTISCKFWGLGSDGTVGANKAIKIIGDHTELYSQAYFQYDSKKSGGNTISHLRFGKKPIKSPYYVTGTNYIACSNQTYVYKYLLKGLKKNGIFVLNCNWSAEELDEKLPNNVNFYIIDAIAIANKLGLGSHINMIMQAAFFKLANVIPVEEAINYLKASVVKKSGQSVVDMNIAAIDQGVSAFVKVE 614
297 1.000e-73gi|427729062|ref|YP_007075299.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Nostoc sp. PCC 7524]  clstr ali  22  427..EPDNIVRAIFYGLGSDGTVGANKNIKIIGEETSNYAQGYFVYDSKKSGSVTVSHLRFGSQPIRSTYLITKANFVACHQWEFLEKPILRDIVPGGTLLLNAPYDKEEVWQQLPDAIKVYGINAYKVAHDAGMGNRINTVMQVCFFALSGVLPIEEIKKSIRKTYGKK-GEQIVQMNIQAVDSTLENLYELE 630
298 1.000e-73gi|218886951|ref|YP_002436272.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Desulfovibrio vulgaris str. `Miyazaki F`] :  clstr ali  20  411.TVPAGTVQCKFFGLGADGTVGANKAIKIIGDNTGMYAQGYFAYDSKKSGGFTVSHLRFGNSPIQSTYLVNSADYIACHKSAYVHYDVLDGIKTGGTFVLNSHWSVEEMEKELPKKLKFYNVDAVKVATEVGLGGRINMIMQTAFFKLSSVIPFEQLKDSIHKAYGKK-GEKIVAMNVAAVDKAIEAVTEIK 616
299 1.000e-73gi|294673934|ref|YP_003574550.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Prevotella ruminicola 23]  clstr ali  28  416....AGMFQAKFYGLGADGTVGANKNVKIIGDNTDKYCQAYFSYDSKKSGGFTCSHLRFGDTPIRSTYLVTTPNFVACHVQAYLHYDVTRGLQKNGQFLLNTIFDADELEKFMPNKVKVYTINATKIAQEIGLGNRTNTILQSAFFRITGVIPVEKMKAAALKSYGAK-GQDVVDKNYAAIDRGGEYVQ... 614
300 1.000e-73gi|288575050|ref|ZP_06393407.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Dethiosulfovibrio peptidovorans DSM 11002]  clstr ali  19  413...PEGTIRCKFWGLGSDGTVGANKNIKIIGDNTDMYAQGYFSYDSKKSGGVTISHLRFGKKPIKSTYLIKDADFIACHKQEYVHYDVLDGLRKNGTFLLNTQWTDEALEANLPANVKFYVINGIDLGQEIGLGNRINMIMMSAFFKLAKVIPYEDAIKYMKKTYGKK-GDKIVAMNDTAVDKGADGLMKIE 616
301 1.000e-73gi|428775221|ref|YP_007167008.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Halothece sp. PCC 7418]  clstr ali  20  414.TEPETVSRAVFYGLGSDGTVGANKNIKIIGSQTENYAQGYFVYDSKKSGAVTVSHLRFGPDPIRSTYLIDQANFVGCHQWSFLEKDVLEVAADGATFLLNSPYPADQVWEHLPKGLEVYAIDANKVARESGMGGRINTVMQTCFFALSGVLPREEIKHAIEKTYGKK-GTEIVQMNLSAVDNALDNLHRI. 617
302 1.000e-73METAHIT MH0086 GL0077340 [Lack 5`-end] locus=scaffold13585_1:1459:4023:-  ali  17  73.TTPEGTTCCKFWGLGSDGTVGANKNIKIIGDPTDMYAQAYFAYDSKKSGGVTISHLRFGKTPIKSTYFINKANFVACHNQSYIDKYMVEDVVPGGSFPLNCHWTVDELDEKLPNHINFYIINANKVAREIGLGNKTNTVLQSAFFSIANIIPPEDAITYMKKMAYKKKGDDIVNMNYAAIDKGAGEVIKV. 276
303 1.000e-73gi|218781978|ref|YP_002433296.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Desulfatibacillum alkenivorans AK-01]  clstr ali  20  411.TAPIDTIACKFWGLGSDGTVGANKAIKIIGDRTDMYAQGYFSYDSKKSGGITISHLRFGKQPIQSTYQVHRSNFIACHNSTYVNYDVLEGIAEGGTFLLNSTWTQDQMDEKLPADVKFYNIDATAIAKEVGLGGRINMIMQTAFFNLANVIPVDDLKDEIKKAYGKK-GDEIVQMNYDAVDKTIANIQEI. 614
304 1.000e-73METAHIT unmapped GL0033089 unmapped_[Lack_both_end]_[mRNA]_locus=scaffold12671_2:2:1489:+  ali  19  232....EGTVSCKFWGLGADGTVGANKNIKIIGDHTDMYAQAYFHYDSKKSGGVTQSHLRFGKNPIRSTYLVKTADFIACHNQAYIKYDILGDIKEGGTFLLNCEWDTEQLEAELPKKVNFYVIDATKIAQELGLGNRTNSVLQSAFFKLADIIPIDDAVKYMKDAIYNKKGENIVNMNYAAVDAGLTGYKKI. 433
305 1.000e-73gi|160888747|ref|ZP_02069750.1| hypothetical protein BACUNI_01165 [Bacteroides uniformis ATCC 8492]  clstr ali  28  416....EGMFEAKFYGLGADGTVGANKNVKIIGDNTDKHCQAYFSYDSKKSGGFTCSHLRFGDTPIRSTYLVNTPNFVACHVQAYLHYDVTRGLRKNGSFLLNTIWEGEELAKNLPNKVKVYYINATQIAQEIGLGNRTNTILQSAFFRITGVIPVEQMKKFIVKSYGKK-GEDVVNKNYAAVDRGGEY..... 612
306 1.000e-73gi|392530987|ref|ZP_10278124.1| pyruvate:ferredoxin oxidoreductase [Carnobacterium maltaromaticum ATCC 35586]  clstr ali  25  412..TSAGTYQAKFWGFGSDGTVGANKAIKLIGDHTDKYVQGYFSYDSKKSGGLTVSHLRFGDNPIKSTFLIEQADFIACHTAAYLSKYLVKGLKKGGTFLLNTVWDDEKLAQMLPYKIKFYTINAVQLANQIGLGRRINTIMQTAFFKVTSIMPIAEVVELLKKTYGRKS-QKIAEKNCQAIEMAAEMVHQVE 615
307 2.000e-73METAHIT unmapped GL0069822 unmapped_[Complete]_[mRNA]_locus=scaffold134630_1:619:1197:-  ali  41  1..MMKDMTEIRWHGRGGQGAKTACLLLADAAFTAGKYVQGFPEYGPERMGAPITAYNRISEERCSIHSNIYEPDYVVVVDETLLEVDVTKGLNPEGAIVINSERSAAELRPMLRYEGRVYTIDARKVSEECLGKYFPNTPMLAAIVEVSRVLEPEQFIADMEASFRHKFKPQVVEGNMQCLKRAMKEVR... 191
308 2.000e-73gi|282897271|ref|ZP_06305273.1| ferredoxin (flavodoxin) oxidoreductase [Raphidiopsis brookii D9]  clstr ali  22  427..ESDSIVRAIFYGLGADGTVGANKNIKIIGEETDNYAQGYFVYDSKKSGSVTVSHLRFGSQPIRATYLITKANFLGCHQWEFVEKPLLKDLVPGGTFLLNSPYNPEEVWDKLPKQIKFYVINAYKVARDSGMGGYINTVMQVCFFAVSGILPREEIKKSIRKTYGKK-GEEIVAMNIQAVDKTLDNLHQI. 629
309 2.000e-73gi|268608043|ref|ZP_06141773.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Ruminococcus flavefaciens FD-1]  clstr ali  21  414.TAAEGTIECKFWGLGGDGTVGANKSIKIIGDHTDKYVQAYFQYDSKKTGGITISHLRFGDKPIKSPYYINKADFVACHNPSYILKGMVNDVKPGGVFLINCQWKPEELDQHLKNNIQLYLVNAIDLAQEIGLGKRTNTILQSAFFSLSKVLPEAEAIGYMKEKAQKKKGIEIVQMNEKAIDAGANAYVKV. 617
310 2.000e-73gi|154149287|ref|YP_001407124.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Campylobacter hominis ATCC BAA-381]  clstr ali  24  417.......IECLFYGLGADGTVGANKNIKIIGDKTDLYAQAYFAYDSKKSGGYTRSHLRFGKKPIRSTYLVSNPHFVACSVAAYLDYDVVDGIREGGTFLLNSIWDAKETIEKIPNKVKFYILNATKLASEIGLGNRTNTIMQSAFFKLANIIPFDDAKAYMKKTYGKK-GDKIVQMNYDAIDRGADGLIEIK 615
311 2.000e-73gi|313888440|ref|ZP_07822107.1| pyruvate synthase [Peptoniphilus harei ACS-146-V-Sch2b]  clstr ali  19  411.TEPEGTIRCKFWGFGSDGTVGANKAIKIIGDNTDMYAQGYFDYDSKKSGGVTMSHLRFGHNRITSTYLLTETDFISCSKQSYYSYDLLRGLKKGGKFLLNTIWNDEELDEHLPNEIEFYTINATKIAAEVGLGGRTNMVMQAAFFNLSQVLPLDELKQAIVKDYGAK-GDDIVNMNYAAVDQGIGALHKVE 615
312 2.000e-73gi|389576536|ref|ZP_10166564.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Eubacterium cellulosolvens 6]  clstr ali  17  408.TTPEGTVSCKFWGLGADGTVGANKNIKIIGDNTDMYAQAYFDYDSKKSGGVTMSHLRFGKKPIKSTYLIHRANFVACHNPSYVTKNMVQELVDGGTFLLNCPWTGDELAAHLPHNINFYIIDGVKTGIEVGMGPRINTILQSAFFKLTGIIPEEKMKAAAKATYGRK-GDDVVAKNWAAIDAGADKAVKV. 612
313 2.000e-73gi|69245966|ref|ZP_00603738.1| Pyruvate decarboxylase:4Fe-4S ferredoxin, iron-sulfur binding:Pyruvate ferredoxin/flavodoxin oxidoreductase:Pyruvate f  clstr ali  23  412LTEPQ-TFQAKFWGFGSDGTVGANKAIKIIGDHTDKYAQGYFYYDSKKSGGLTVSHLRFGDTPIRSAYLVEHADLVACHTPAYLHYDLVKGLKPGGIFLLNTLWSDEQLETHLPNNIRFYTINAMRLAQEVGLGRRINTAMETAFFKLADIIPFDEVKEEALKSYGHKS-MAIVEKNIQAIDRTTELLHQV. 615
314 2.000e-73gi|118578740|ref|YP_899990.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Pelobacter propionicus DSM 2379]  clstr ali  20  422...MEGVYEAMFFGLGSDGTVGANKNIKIIGEATDNYTQAYFVYDSKKAGSITTSHLRFGKQPINTPYLIDNAEFIACHNFSFLEKYMLSKAKVGGTFLLCSPFDHDEVWDKMPKKLKFYVINAIKLGEEIGLGARINMIMQTAFFKISNIIPIEHIKKAIKKSYG-KAGDKVVNMNYAAVDAGLTNIHEVK 624
315 2.000e-73Oral.Meta HOMD plac_c_8_126 Peptoniphilus lacrimalis 315-B [10579 - 7034] pyruvate:ferredoxin (flavodoxin) oxidoreductase  ali  18  415.TEPEGTIRCKFWGFGSDGTVGANKAIKIIGDNTDMYAQGYFDYDSKKSGGVTMSHLRFGNHKITSTYLLSESDFISCSKQSYVYYDLLRGLKQGGKFLLNTTWDDEQLEEHLPKKVDFYTINATKIAAEVGLGGRTNMVMQAAFFKLSQVLPLDLLKEGIVKDYGVK-GDDIVQMNYKAVDEGVKSIHQVK 619
316 3.000e-73METAHIT MH0006 GL0129383 [Lack 5`-end] locus=scaffold223479_1:38:667:-  ali  42  17..LMNDLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISTKPITIHSNIYEPDYVVVVDDTLIEVDVTAGLKKTGAVVINTTKDGEYLKKHLKYEGEIYKIDARKISMETLGKYFPNTPMLAAIVKVSKVMTDEEFLNDMQGSFKHKFKPEVIEGNMKALEMALKEVERV. 209
317 3.000e-73METAHIT V1 GL0066660 [Complete] locus=scaffold14074_1:79:696:+  ali  46  13...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISDCPITIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTTKDENYLKNALGYNGNIYTIDARKVSMETLGKYFPNTPMLAAIVKVSHIMSDEELLNDMEGSFKHKFKPEVIDGNMKALKMALNEVKKI. 204
318 3.000e-73gi|298675716|ref|YP_003727466.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanohalobium evestigatum Z-7303]  clstr ali  41  1......MKEIRVHGRGGQGSVTAAELLAIAAFSDGKFSQAFPSFGVERRGAPVQAFTRIGDKPIRLRSQIYEPDYVIVQDPTLIDVDVAHGMDENGIVIINSDFNPEDFN--IDTDAKIMTVDATKIALDIIGRPIVNTILLGAFAGATDEINPESIKEAVKERFPGKIG----DKNAEAVQKAYDMIRE.. 179
319 3.000e-73METAHIT MH0064 GL0095983 [Complete] locus=scaffold5611_1:8785:9366:+  ali  47  1...MSNLIEIRWHGRGGQGAKTASLLLADAAFNTGKFIQGFPEYGPERMGAPITAYNRISDEPITVHSNIYNPDYVVVVDDTLLEVDVTAGLKETGAIVINTTKDINYLSSVLGYKGKIYTIDARKVSMETLGRYFPNTPMLAAIVKVSNVMPEDAFIQDMEGSFKHKFKPEVIEGNMNALKLALKEIK... 190
320 3.000e-73gi|242237942|ref|YP_002986123.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Dickeya dadantii Ech703]  clstr ali  20  412.TAPAGTTACKFWGLGSDGTVGANKAVKIIGDQTPMYAQAYFSYDSKKSGGITVSHLRFGQRPITSPYLIHSADFISCSQQSYVDKYLLAGLKTGGTFLLNCTWSAAELEAKLPQQIRFFTLNAVQIAQQLGLGGRFNMIMQAAFFKLTGIIAEDYLKSAVVKSYGSK-GQNVVDMNCAAIDQGMQALVNV. 615
321 3.000e-73gi|428202312|ref|YP_007080901.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Pleurocapsa sp. PCC 7327]  clstr ali  18  415..EPDSVVRALFYGLGADGTVGANKNIKIIGEETDNYAQGYFVYDSKKSGAVTVSHLRFGPQPIRSTYLIDKANFIGCHQWNFIEKDMLTSAAPGATFLLNSPYSAEEVWGHLPKKLKVYAINANKVARESGMSGRINTIMQVCFFALANVLPRDEIKKAIQKTYGKK-GDEIVRMNLQAVDNTLANLHEV. 617
322 3.000e-73gi|197120393|ref|YP_002140820.1| pyruvate:ferredoxin oxidoreductase [Geobacter bemidjiensis Bem]  clstr ali  22  412.TTPEGTIQCRFWGMGADGTVGANKAIKIIGDNTELYVQAYFSYDSKKSGGITVSHLRFGESPIQSTYLVDAADFISCQKAPYVQYDLLEGIKEGGIFLLNSPWTVEEMEQHLPKKVRLYNVDAIRIASAAGLGGRINMIMQTAFFKLSGVLPFERLKDSIRKEYGRK-GDQVVEMNLGAVDLAVQSLVQIE 617
323 4.000e-73gi|220909729|ref|YP_002485040.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Cyanothece sp. PCC 7425]  clstr ali  18  412..EPESVVRAIFYGLGSDGTVGANKNIKIIGEETDNYAQGYFVYDSKKSGSVTISHLRFGPQPIRSTYLINQANFVACHQFGFLEYDLLAAAVPKATFLLNAPYPAAEIWDHLPKNLKFYVIDASKVARDSGMGGRINTVMQVCFFALSGVLPREEAIAAIKHSIEKKKGKEIVQMNLKAVDQTLAHLYEV. 614
324 4.000e-73gi|407474584|ref|YP_006788984.1| pyruvate:ferredoxin oxidoreductase Por [Clostridium acidurici 9a]  clstr ali  19  411.TSPQENISCRLWGLGSDGTVGASKVIKIIGDKTDLHAQGYFSYDSKKSGGSTVSHLRFGKDPIKSSYLVYSTDYISCNNKSFINHYILDGLKENGTFVLNCPWNIEELEEHLPNNIKFYIINANEIANKIGLGNRINMIMQTVFFKLTNVIPFEDAIKYLKEYIKGRKGDEVVNMNYSAVDKATEELIEVE 616
325 4.000e-73gi|427720608|ref|YP_007068602.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Calothrix sp. PCC 7507]  clstr ali  21  417.TEPDSVVRAMFYGLGSDGTVGANKNIKIIGEETDNYAQGYFVYDSKKSGSMTVSHLRFGKEPIRSTYLIDKANFIGCHHWGFLEIDVLKAATKGATILVNSPYDADAVWKYLPKQLKLYVINANQVARESGMGRRINTIMQVCFFALAGVLPEKDIKQAIEKTYGKK-GAEVVRMNLQAVDNTLENLHQVK 621
326 4.000e-73gi|342215218|ref|ZP_08707875.1| pyruvate synthase [Veillonella sp. oral taxon 780 str. F0422]  clstr ali  21  413....EGLTGCKFWGFGSDGTVGANKAIKIIGDHTDMYAQAYFDYDSKKSGGVTMSHLRFGKNPINKPYLVTEPEFIACHRQSYVEYDLLRGIKKGGTFLLNCTWSPEELAEKLPKELNFYIINAAKIAAEIGLGGRINMVTQAAFFKLTEIIPIEYLKDSIEKTYGKK-GADVVAMNNKAVDEGVGALVKVE 616
327 4.000e-73gi|402570655|ref|YP_006619998.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Desulfosporosinus meridiei DSM 13257]  clstr ali  19  410.TAPEGTISCKFWGLGADGTVGANKAIKIIGDHTKLYAQAYFQYDSKKSGGITVSHLRFGKKQIKSPYYVTGTNYIACHNQTYVYYDLLKGLKQGGSFVLNCQWTPEELDQKLPNKVNLYIIDAVSIARKIGLGNRINMIMQAAFFKLANVIPVEEAVDYLKKTYGKK-GQNIVDMNTAAIDMGVTSLVKV. 613
328 5.000e-73gi|402837011|ref|ZP_10885542.1| pyruvate synthase [Mogibacterium sp. CM50]  clstr ali  21  405IVSAEGTVACKFWGLGADGTVGANKNVKIIGNHTDRYVQAYFQYDSKKSGGVTISHLRFGDNPIRSTYYVNSADFIACHSASYMHKYIVQDVNPGGIFLLNCSWSDEELDKNLPNNIQFYTCDAVKLANEVGLGRRTNTVLQAAFFKLVNIMPIEEMKAAIKKSYISK-GDDIVSMNCKAVDAGVSHVHKV. 610
329 5.000e-73METAHIT MH0067 GL0030712 [Complete] locus=scaffold40327_1:6741:7379:+  ali  46  20...MDNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGAERMGAPITAYNRISTAPIRIHCNIYNPDYVVVVDDTLLNVDVTSGLKESGAIIINTTKDGETLKRLLKYKGHIYTIDARTVSVEALGKYFPNTPMLAAVVKVTGIIPEEDFLKDMEGSFKHKFKPEVIEGNMKALEIALQKVIKVQ 212
330 5.000e-73gi|334147459|ref|YP_004510388.1| pyruvate ferredoxin/flavodoxin oxidoreductase family protein [Porphyromonas gingivalis TDC60]  clstr ali  26  419.......VEAKFYGLGADGTVGANKNVKIIGDNTNKYCQAYFAYDSKKSGGFTCSHLRFGDTPIRSTYLVVTPDFVACHVPAYLRYDVLKGLKKKGTFLLNSIWAPEDIEQHLPNNIRFYTINATAIAQQIGLGNRTNTILQSAFFKIANVIPYEQMKKFIVKSYGKK-GEDVVNKNFAAVDRGGDVVE... 614
331 5.000e-73gi|227498364|ref|ZP_03928514.1| pyruvate:ferredoxin oxidoreductase [Acidaminococcus sp. D21]  clstr ali  22  421.TAPEGQMSAEFWGMGSDGTVGANKNIKIIGHTTDLYCQAYFVYDSKKSGGLTQSHLRFGRNPIRSPYLIQAADFVACHTPSYVTKYMVKNLKEGGTFLLNCAWSDEDLDRHLPKKAKFYTINATAIARSIGLGNRTNTILQAAFFKLLGIIPVEEAVKAMKKTYFIKKGQAVVDKNYASIDHGINELHSV. 625
332 5.000e-73gi|257869231|ref|ZP_05648884.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Enterococcus gallinarum EG2]  clstr ali  21  413..TNPNTFQAKFWGFGSDGTVGANKAIKIIGDHTDKYVQGYFYYDSKKSGGLTVSHLRFGDTPIRSTYLIEHADFVACHTPAYLHYDLLKGLKKGGTFLLNTTWNEQQIATSLPKDIRFYTINAMQLAMETGLGRRINTAMETAFFYLSDIMPFDEVKAEVLKNYGHKS-MEIVEKNYLAIDRTLELLYEIQ 616
333 5.000e-73gi|218248649|ref|YP_002374020.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Cyanothece sp. PCC 8801]  clstr ali  19  415.TEPDNVVRAIFYGLGSDGTVGANKNIKIIGEETNNYAQGYFVYDSKKSGSVTVSHLRFGPNPIQSTYLVTKANFIACHQWEFVEKDLLESAIDGSTLLLNSPYKPEEIWHHFPKHLKVHTINAYEVAKNAGMGGRINTVMQVCFFALSGVLPIEQIKKAIRKTYGKK-GEEIVQMNMKAVDASLDHLHEI. 618
334 6.000e-73METAHIT V1 GL0027739 [Lack both end] locus=scaffold44440_1:1:678:-  ali  25  3..........................VKIIGNLTDKYAQAYFAYDAKKSGGVTQSHLRFSDQPIHATYLVQSADFVAVHNPAYLSKDVAKDLKPGGTFLLNCQWSAEELDEKLPKQAKLYLIDASHIAMKLGLGNRTNTVLQSAFFKLANIIPMDAMKEAIKKTYLVKAGQKVVDMNCAAVDQGVQALHQVE 182
335 6.000e-73Oral.Meta HOMD dmic_c_9_165 Dialister micraerophilus DSM 19965 [45250 - 41552] pyruvate-ferredoxin oxidoreductase  ali  23  448.......ISCKFWGFGSDGTVGANKNIKIIGDHTDMYAQGYFSYDSKKSGGVTISHLRFGPNPIRKPYLISHANYIACHRPSYVYKYLLRGLNKGGIFLLNCRWRKEDLNRALPADAQFYIIDAFEIAKKIGLGGRINMIMQSAFFNLTNIIPTEDLKKAIEKSYGRK-GQHVVDMNYKAVELGA....... 639
336 6.000e-73METAHIT MH0075 GL0054011 [Complete] locus=scaffold56418_1:3183:3764:+  ali  46  1...MNNLIEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSNIYEPDYVVVVDDTLLEVEVTDGLKEDGAIIINTTKNYDYLKNVLGYNGKVYTIDAREISMEALGKYFPNTPMLAAVVKVTGIMTDEEFLNDMQGSFKHKFKPEVIDGNMKALQLALNQV.... 189
337 7.000e-73METAHIT MH0063 GL0069867 [Complete] locus=scaffold5007_1:4490:7615:+  ali  27  265....DGMFEAKFYGLGADGTVGANKNVKIIGDNTDKHCQAYFSYDSKKSGGFTCSHLRFGDAPIHSTYLVNTPNFVACHVQAYLHYDVTRGLRKNGTFLLNTIFDGQELVNFIPNKVKVYYINATKIAQEIGLGNRTNTILQSAFFRITEVIPIEQMKKFIVKSYGKK-GQDIVDKNYAAVDRGNEY..... 461
338 7.000e-73METAHIT MH0086 GL0001288 [Complete] locus=scaffold11368_8:9017:9598:+  ali  45  1...MSELTEFRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYDRISDTEIRVHSNIYDPDYVVVVDETLLHVHVTEGLKEDGAILVNTAKTSDEIRPLLGYKGRVYTIDAREVCMKTLGKYFPNTPMLAAIVKISKIMEEENFIKEMEASLSHKFKPEVLEGNMQALRLAMQEVR... 190
339 7.000e-73METAHIT MH0035 GL0091539 [Complete] locus=scaffold21813_2:343:915:-  ali  44  1...MNKTVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEPITVHSNIYEPDYVVVVDESLLETDVTKGLKREGAVIINSERSKEELRKHLGYEGSVYTVNAKQISMRTLGKNYPNSPMLAAAVAVSNVMERKAFLQEMRASFQHKFKPEVIDGNMQALELAFEEA.... 189
340 8.000e-73gi|312897374|ref|ZP_07756798.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Megasphaera micronuciformis F0359]  clstr ali  21  416....KGLKACKFWGFGSDGTVGANKAIKIIGDNTDMYAQAYFAYDSKKSGGVTVSHLRFGSSPINMPYLVNSADFIACHRQSYYNYDLLRGIKKGGTFLLNTVWKPEELEEKLPNEVQFYILDGVGIAQSIGLGGRINMIMQSAFFKLSEVIPIEKLKEAVVKSYGKK-GQEVVNKNYAAIDEGLKNIVKI. 616
341 8.000e-73gi|218133625|ref|ZP_03462429.1| hypothetical protein BACPEC_01494 [[Bacteroides] pectinophilus ATCC 43243]  clstr ali  19  408.TAPAGTTSCKFWGLGADGTVGANKNIKIIGDHTDMYAQAYFDYDSKKSGGVTTSHLRFGKSPIKSTYLIDKADFVACHCPAYMSKYMVQDVKDGGTFLLNCEWSPEEVADHIPHNVKFYIIDGIKLGKEIGLGGRINTILQSAFFKLANIIPEDEAIGYMKHSYAKK-GEDVVRMNFEAIERGA....... 605
342 8.000e-73gi|428216162|ref|YP_007089306.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Oscillatoria acuminata PCC 6304]  clstr ali  22  415.TEPDSVVRAMFYGLGADGTVGANKNIKIIGEETDNYAQGYFVYDSKKSGAITISHLRFGPQPIRSTYLIEQANFVGCHQWIFLEKDVLSAAAPGAIFLLNSPYAHEEVWNQLPKGLKVYTIDANKVARESGMSGRINTVMQVCFFALAGVLPRDEIKKAIEKTYGKK-GKEIVRMNLQAVDNTLANLFEV. 618
343 9.000e-73METAHIT MH0060 GL0092110 [Lack 5`-end] locus=scaffold2643_2:2:3424:+  ali  20  378.TTPKGTTSCKFWGLGSDGTVGANKSIKIIGDNTDMYAQGYFFYDSKKSGGITVSHLRFGSSPITSTYLINKANFVACHNPSYVTKYMVQDIVPGGTFLLNCIWSPEELDKQLPNNINFYTINGIKIAEEVGLPGRASTILQSAFFTIANIIPVDKMKKAVVKKFSKK-GEAVVNANCNGIDRGSKEVVKI. 581
344 9.000e-73METAHIT MH0012 GL0243892 [Lack 3`-end] locus=scaffold9624_16:1:2418:-  ali  18  412.TTPAGTTSCKFWGLGSDGTVGANKSIKIIGDNTDMFAQGYFFYDSKKSGGITVSHLRFGSSPITSTYLINKANFVACHCPSYVTKYMVQDLVPGGTFLLNCIWTPDQLDSQLPNNIHFYIINGIKIAEEVGLPGRASTILQSAFFAISGILPVEKMKAAVVKKFSKK-GEAVVNANFAGIDRGAQEIVKV. 615
345 1.000e-72gi|354565338|ref|ZP_08984513.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Fischerella sp. JSC-11]  clstr ali  21  431..EPDNVVRAIFYGLGSDGTVGANKNIKIIGEETENYAQGYFVYDSKKSGSVTTSHLRFGSQLIRSSYLINKANFVACHQWGFLERDMLKHIEPGGIFLLNSPYSKAEVWQNLPKHLKFYVINAYKVARESGMGGHINTVMQVCFFALSGVLSREEIKRSIEKTYGKK-GDEIVAMNLRAVDKTLEHLYEV. 633
346 1.000e-72gi|34763801|ref|ZP_00144714.1| Pyruvate-flavodoxin oxidoreductase [Fusobacterium nucleatum subsp. vincentii ATCC 49256]  clstr ali  23  418......TKACLFFGLGADGTVGANKNIKIIGDKTDLYAQGYFAYDSKKSGGVTRSHLRFGKKPIRATYLVSSPSFVACSVPAYLKYDMTSGLKKGGKFLLNCVWDKDEVLEHIPDNIKFYIINATKLAHEIGLGQRTNTIMQSAFFKLSEIIPYEEAQKYMKKSYGRK-GDDVVQLNYKAIDVGASGLVEI. 616
347 1.000e-72gi|302386096|ref|YP_003821918.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Clostridium saccharolyticum WM1]  clstr ali  20  407ITTPEGTTNCKFWGLGADGTVGANKNIKIIGDNTDMYAQAYFDYDSKKSGGVTMSHLRFGHKPIKSTYLIRQANFVACHNPAYIRKYMVQELVDGGIFLLNCPWDAAGLEKHLPHNIKFYTIDGVKIGIETGMGQRINTILQSAFFELTGIIPSEKMKAAAKATYGRK-GEEIVMKNWAAIDAGAKGVVKVE 613
348 1.000e-72gi|358067719|ref|ZP_09154195.1| pyruvate:ferredoxin oxidoreductase [Johnsonella ignava ATCC 51276]  clstr ali  18  408ITTPEGTKNCKFWGLGADGTVGANKNIKIIGDNTDMYAQAYFDYDSKKSGGVTVSHLRFGHKPIKSTYLISKANFVACHNPAYIRKNMVQELVDGGSFLLNCPWDEKELENKLPHNINFYTIDGVKIGVETGMGARINTILQSAFFQIAKIIPEEKMKQAAQKTYGRK-GEDVVKKNWAAIDAGAKKVVKV. 613
349 1.000e-72gi|333911220|ref|YP_004484953.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanotorris igneus Kol 5]  clstr ali  45  1......MIEIRFHGRGGQGAVTAAQILAKAAFYDGKYCQAFPFFGVERRGAPVMAFTRIDDKKIRLRCQIYEPDYVVVQDATLLDVDVTSGLKNDGKVIINT------VKDIKLGDYDTYCIDATGIALDVLGVPIVNTTMLGAFAGVTGEVSIESLKKAIMETFPAKLG----EKNAKAAEVAYEAMIE.. 175
350 1.000e-72METAHIT unmapped GL0048677 unmapped_[Complete]_[mRNA]_locus=scaffold18464_1:2342:2920:+  ali  41  1...MKDLIEIRWHGRGGQGAKTAALLLADVAFNNGLYVQGFPEYGPERMGAPITAYNRLSRNPIRVHSNIYEPDYVVVVDESLIEVDVTAGIKEGGAIIINSHKSSNELKPLLEEKGHIYTIDARKISIETLGKYFPNSPMLAAVVKITGVMEEKAFLEDMRKSYAHKFKPSVIDGNMKALEIALKEVH... 192
351 1.000e-72gi|16331975|ref|NP_442703.1| pyruvate oxidoreductase [Synechocystis sp. PCC 6803]  clstr ali  20  412.TEADSVVRAIFYGLGSDGTVGANKNIKIIGEDTDNYAQGYFVYDSKKSGSVTVSHLRFGPNPILSTYLISQANFVACHQWEFLEQFVLEPAVDGGVFLVNSPYGPEEIWREFPKNLKVYTINANDVARDAGMGRRTNTVMQTCFFALAGVLPREEIKQSVQKTYGKK-GQEIVEMNIKAVDSTLAHLYEV. 615
352 1.000e-72gi|288931275|ref|YP_003435335.1| pyruvate/ketoisovalerate oxidoreductase, subunit gamma [Ferroglobus placidus DSM 10642]  clstr ali  38  6.......IEVRFHGRGGQGAVTAADILAIAGFKQGYYTLSFPMFGAEKRGTPVVSFLRISDKPIVVRDEVRNPDYVVVMDPSLLDVDVLAGIKKGGMLIANYPKGSEELKEKLKEDVEIYTINATKMATEILGRPITNTAMVGAFVGATNVVKLEYVEEAIREFFEDK---DIAEKNVQLVRKAYEYMREV. 188
353 2.000e-72METAHIT MH0081 GL0017394 [Lack both end] locus=scaffold81097_1:3:2324:-  ali  19  187...PAGTSRCKFYGLGSDGTVGANKNIKIIGDHTDMYAQGYFVYDSKKSGGITISHLRFGQTPIKSTYTIDEADFVACHNPSYIRYNMTSEIKKGGVFLLNCKWNLAQLEKNLPNKIQFYTIDALKIAGKVGLGGRINGVMQAAFFKLADIIPYEDMKKAIEKTYGKK-GPEIVQKNFDGIDNAIAGLKKV. 388
354 2.000e-72METAHIT V1 GL0013317 [Complete] locus=scaffold52247_2:11251:11835:+  ali  44  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGKNVQGFPEYGPERMGAPITAYNRISSDEIRVHSNIYHPDYVVVVDETLLHVDVTAGLKEQGAIVVNTPKSPQEIAPQLGYKGKVYTVDARKISVETLGKNFPNSPMLAAIVAVSKVMDKDTFIREMKNSYQHKFKPEVIDGNMKALEVAYDAVIAHE 193
355 2.000e-72gi|406880980|gb|EKD29162.1| hypothetical protein ACD_79C00030G0001, partial [uncultured bacterium]  clstr ali  22  420.TESKDVTRALFYGLGSDGTVGANKNIKIIGENTNNYAQGYFVYDSKKAGTITISHLRFGKKQIKSAYLVSKANFIACHQTVFIEKYMLKNLTEGGTFLLNTPYGKDEVWKNLPKKAKFYVIDAYAVAEKTGMGMMINTIMQTCFFAISGVLPREEIKKAIKKTYGKK-GEEVVNKNIAAVDQTLANLQEV. 623
356 2.000e-72METAHIT O2 GL0015715 [Complete] locus=scaffold738_1:7097:10771:+  ali  18  413.TAPAGTKSCKFWGLGSDGTVGANKSIKIIGDHTDMYAQGYFDYDSKKSGGLTMSHLRFGHTPIKSTYYISQADFVACHNPAYLEYDMVQDLKKGGSFLLNCPWDAAELEERLPNEINLYTIDGFKIGKEIGLGTRINTVLQSAFFSIAKIIPEEDAIKYMKKSYSKK-GEAIVKMNHDAIDRGATGYVKVE 617
357 2.000e-72gi|350271282|ref|YP_004882590.1| pyruvate-ferredoxin (flavodoxin) oxidoreductase [Oscillibacter valericigenes Sjm18-20]  clstr ali  25  415.....GRISCKIWGLGGDGTVGANKNITTIGLTADKYAQAYFSYDSMKSGGLTQSHLRFGDEPIRSTYLVSSADFVAVHAPTYVNKYTTDDLKEGGIFLLNCPWGAEELENRLPKHARFYIIDAAKLATEVGLGQRTNNILQAAFFALTKVIPLNVAVEDMKKSYFKKAGQKIVDLNNRAVDVGASAAVQVE 616
358 2.000e-72gi|365174119|ref|ZP_09361572.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Synergistes sp. 3_1_syn1]  clstr ali  20  410.TENPKTVRCLFYGLGSDGTVGANKNIKIIGQETDLYAQGYYSYDSKKSGGITVSHLRFGPDPIYASYLINKANFLACHVYSFLEKDILKNAADGGTFLLNAPFGPEQIWDKLPKHLKLYVIDAVKIAKQTGMGSRTNTIMQTCFFAISGILPQDKAIKAIKDSIIKKKGQAIVDKNIKAVDETLANLYQVK 614
359 2.000e-72gi|228471122|ref|ZP_04055946.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Porphyromonas uenonis 60-3]  clstr ali  24  414..LESDAYEAKFFGLGADGTVGANKNVKIIGENTNKYCQAYFAYDSKKSGGFTASHLRFGDQPIRSTYLVVRPNFVACHVPAYLRYDVLAGLRKGGTFLLNSVWDLDSIEEHLPNHIKFYMINATEIAQRIGLGNRTNTILQSAFFKISGVIPYEQMKKFIVKSYSRK-GEEIVNKNFAAVDEGANVIQ... 614
360 2.000e-72gi|154173937|ref|YP_001407586.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Campylobacter curvus 525.92]  clstr ali  22  414....ESVKECLFYGLGADGTVGANKNIKIIGDKTPLYAQAYFAYDSKKSGGYTRSHLRFGKNPIRSTYLVSNPHFVACSVAAYLDYDVIGGIRQGGTFLLNSIWDAAETVAKLPNKVKFYIINATKLAREIGLKNRTNTIMQSAFFKLADIIPFEDAQKYMKEYAHKKKGEAIVEMNYKAIDVGADGLVKV. 614
361 2.000e-72gi|260425164|ref|ZP_05734388.2| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Dialister invisus DSM 15470]  clstr ali  21  399IPVPEKLVSCKFWGFGSDGTVGANKAIKIIGDYTDMYAQGYFAYDSKKSGGVTISHLRFGPEPIRKPYLIRKADYIACHRPSYVYKYLLRGFKPGGIFLLNCQWRPEDLEHALPAHAKFYIIDAFEIAKNIGLGGRINMIMQSAFFHLTNIIPEADAVKYLKDSYGRK-GQNIVDMNNAAVDAGIAGAVEV. 606
362 2.000e-72gi|239627594|ref|ZP_04670625.1| Pyruvate:ferredoxin oxidoreductase [Clostridiales bacterium 1_7_47_FAA]  clstr ali  21  413...PEGTVSCKFWGLGSDGTVGANKNIKIIGDHTDMHVQAYFEYDGKKSGGVTKSHLRFGNSPIRSAYLVNKADFVACHNQAYIDKYIVSDLKEGGSLLLACDWKEEELDSHLPKKINLYIIDSVGIAAGLGLGSRTNTVLQSAFFKIANIIPAEDMKEAILKSYGNK-GEAVVNMNYAAVDAGVGHLVKV. 614
363 2.000e-72gi|340750372|ref|ZP_08687217.1| pyruvate ferredoxin oxidoreductase [Fusobacterium mortiferum ATCC 9817]  clstr ali  45  1...MREIFEIRWHGRGGQGAKTASLLLADAAFSGGMYVQGFPEYGPERMGAPITAYNRISKNPVRVHSNIYEPDFVVVVDETLIEVDVTKGLKEDGAIIINSSKPASEFVPFLKYKGKVFTCDARTISEETLGKNFPNTPMLGAVVKVSGVMEEKAFLEAMEESFKHKFKPEVLKGNMDALIRSMNEVKE.. 191
364 2.000e-72gi|254302984|ref|ZP_04970342.1| pyruvate synthase [Fusobacterium nucleatum subsp. polymorphum ATCC 10953]  clstr ali  23  416......TKACLFYGLGADGTVGANKNIKIIGDKTDLYAQGYFAYDSKKSGGVTRSHLRFGKKPIRSTYLVSKPTFVACSVPAYLHYDMTSGLKEGGKFLLNCVWSKEEAIENIPNNVKLFIINATALAQEIGLGQRTNTIMQAAFFKLAEIIPFEEAQQYMKDYAKKKKGDEIVQLNYNAIDRGANDIVEIE 615
365 2.000e-72METAHIT unmapped GL0042665 unmapped_[Lack_3`-end]_[mRNA]_locus=scaffold440534_1:1:3318:-  ali  24  415.....GQISCKLWGLGGDGTVGANKNISTIGLVGNKYAQAYFSYDTMKSGGLTQSHLRFGDEPIRSTYLVNSADFVAVHAPTYIGKYVTEDLKEGGTFLLNCPWTEDELETRLKKHINFYIIDAAKIAAEIGLGKRTNNVLQGAFFALTKVIPMDVAEEDMKRSYFKKAGQKIVDLNNKAVDLGISAAVKI. 615
366 2.000e-72gi|257865944|ref|ZP_05645597.1| pyruvate decarboxylase [Enterococcus casseliflavus EC30]  clstr ali  23  417......TFQAKFWGFGSDGTVGANKAIKIIGDHTEKYVQGYFHYDSKKSGGLTISHLRFGDTPIRSTYLIEHADFVACHTPAYLHYDLLKGLKKGGTFLLNTTWSQEQILKNLPKKIRFYTINAMQLAMEVGLGGRINTAMETAFFYLANIIPTEEIEEALKSY--RRKSMAIVEKNQAAIDRTIELLQEI. 615
367 3.000e-72gi|157364628|ref|YP_001471395.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Thermotoga lettingae TMO]  clstr ali  67  1..MPAKYYEIRWHSRAGQGAKSASQLLAEAVLDMGKYAQAFPEYGAERSGAPMRAFNRISDGKITIHSSVEKPNVVVVIDDTLLSPAVVEGITEDGVLIVNTTHPVDYIRKKTHFNGKICTLKATDIALEEIKRGIPNTVILGAVAKITNVVTLESLEQKIKNMFGKKLSEEMLEANLRALRRGYEEV.... 186
368 3.000e-72gi|212696067|ref|ZP_03304195.1| hypothetical protein ANHYDRO_00603 [Anaerococcus hydrogenalis DSM 7454]  clstr ali  18  413....EGTSRCKFWGFGSDGTVGANKAIKIIGDNTDMYAQGYFDYDSKKSGGLTVSHLRFGKNPIRSTYLLDEADFISCSKPAYVNYDLLDGLKDGGRFLLNCPWSEEDLEEHLPAKMKRYIIDASHIAENIGLGSRTNMIMQSAFFNLANVIPIDELKDSIVKSYGHK-GDDIVNMNYKAVDQGIDAVVKV. 613
369 3.000e-72gi|292671026|ref|ZP_06604452.1| pyruvate-ferredoxin oxidoreductase [Selenomonas noxia ATCC 43541]  clstr ali  19  425..TKEGTTACKFWGLGSDGTVGANKAIKIIGDKTDMYAQAYFAYDSKKSGGITMSHLRFGKSPIMSPYLINKADFISCSQQSYVRYDLLAGLKKGGKFLLNTLWSDEELSTHLPNEIEFYTVNAVQIARDLGLGGRFNMVMQSGFFKLANIIPIEDAVKYLKDSYGSK-GEKVVNMNNGAIDQGIASLHRV. 627
370 3.000e-72JCVI_PEP_1096678585019 /source_dna_id=JCVI_ORF_1096678585018 /offset=0 /translation_table=11 /length=437 /full_length=437  ali  19  44..EPDDVFRAVFHGLGSDGTVGANKNIKIIADHEDTWVQGYFVYDSRKAGSRTVSHLRFGPRPVRSTYLIGSADFVACHQPQFLEQDVLAVAKPGAVFLLNSPHAPDGVWDALPRDLDFYAIDAYGVATEAGMGSRINTIMQTCFFHIAGVMPEDKIKEAIEKTYAKK-GAAVVEKNYAAVDQAIANLHRIE 247
371 3.000e-72gi|336424736|ref|ZP_08604770.1| pyruvate:ferredoxin oxidoreductase [Lachnospiraceae bacterium 3_1_57FAA_CT1]  clstr ali  19  409.TTPEGTTNCKFWGLGADGTVGANKNIKIIGDNTDMYAQAYFDYDSKKSGGVTMSHLRFGHSKIKSTYLIRQANFVACHNPAYVRKYMVQELVDGGTFLLNCAWNAEELDKHLPHNINFYTIDGVKIGIETGMGPRINTILQSAFFELTGIIPAEKMKAAAKATYGRK-GEDVVMKNWAAIDAGAKGVVKVE 614
372 4.000e-72gi|428311260|ref|YP_007122237.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Microcoleus sp. PCC 7113]  clstr ali  19  414..EPDNVVRAIFYGLGSDGTVGANKNIKIIGEETDNYAQGYFVYDSKKSGSVTVSHLRFGPQLIRSIYLVDSANFVACHQWEFVEKDLLGTAKPEAVFLLNSPYNSEETWRRLPKQLKFYVINASQVAREVGMGRHINTVMQVCFFAIAGVLPREEIKQSIRKTYGKK-GETIVEMNLKAVDRTLDNLYEVE 617
373 4.000e-72METAHIT MH0006 GL0269900 [Lack 3`-end] locus=scaffold240487_2:7675:9810:+  ali  19  415...PAGTSRCKFYGLGSDGTVGANKNIKIIGDHTDMYAQGYFVYDSKKSGGITISHLRFGQTPIKSTYTIDEADFVACHNPSYIRYNMTSEIKKGGVFLLNCKWNLAQLEKNLPNKIQFYTIDALKIAGKVGLGGRINGVMQAAFFKLADIIPYEDMKKAIEKTYGKK-GPEIVQKNFDGIDNAIAGLKKV. 616
374 4.000e-72gi|428225360|ref|YP_007109457.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Geitlerinema sp. PCC 7407]  clstr ali  21  415.TEPASVVRSIFYGLGSDGTVGANKNIKIIGEETDNYAQGYFVYDSKKSGSVTVSHLRFGPNPIRSTYLVSRANFVACHQWEFVEKDLLGAAEPHGVFLLNSPYSPEETWARLPAKLRVYTIDASRVAREAGMGGHINTVMQVCFFAVAGVLPREEIQQSIRKTYGKK-GEAVVEMNLRAVDQTLEHLYPV. 618
375 4.000e-72gi|225874248|ref|YP_002755707.1| pyruvate ferrodoxin oxidoreductase [Acidobacterium capsulatum ATCC 51196]  clstr ali  18  422.TENPRTVRALFYGLGSDGTVGANKNIKIIGSETDHYVQGYFVYDSKKSGSLTTSHLRFGPDPIRSTYLISRANFIACHQFEFLEKNVLEAAEDGATFLLNSPWGPEEVWQHLPRHLRLFVIDGYTVARNVGMGNRINTVMQTCFFAISGVLPREEIKKAIRKTYSKR-GEAVVEQNFAAVDAALAHLHEV. 625
376 4.000e-72gi|336323032|ref|YP_004602999.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Flexistipes sinusarabici DSM 4947]  clstr ali  21  419LTPQDDVFNGMFFGLGSDGTVGANKNAKIIGDLTDNKVQAYFVYDSKKAGSMTTSHVRFGQREIKSSYLVQKADFIGCHNFAFLEYDIVKKLKKGGTFLLNSFYSKDEVWDKLPKEAKFYVINANDIAEEIGLGPRINVILQTAFFKISEILPFDEAVKAIKETIKKKYGDEIVEMNNKAVDAGANQLHQVK 624
377 5.000e-72gi|338731570|ref|YP_004660962.1| pyruvate ferredoxin oxidoreductase subunit gamma [Thermotoga thermarum DSM 5069]  clstr ali  70  1..MPAKYFEVRWHSRAGQGAKSAAQLLAEAVLDMGKYAQAFPEYGAERSGAPMRAFNRISDEKITVHSAVENPDVVVVIDDTLLSPAVVVGLKKEGVLIVNTAHPIEFVRKKTGFEGKICIVRATDIALEELKRGIPNTVMLGTIARVTGLITLETAAQRIREMFERKLPEEMIQANLRALKRGYEEV.... 186
378 6.000e-72gi|310777908|ref|YP_003966241.1| pyruvate ferredoxin oxidoreductase subunit gamma [Ilyobacter polytropus DSM 2926]  clstr ali  46  1...MSNLVEIRWHGRGGQGAKTASLLLADAAFTIGKFVQGFPEYGPERMGAPITAYNRISGEKIRVHSNIYEPDYVVVVDDTLLSVDVTKGLKKEGAIIINTSIPQKEILSKLKKDGNVFLCDARKISEESLGKNFPNTPMLGAVVKVSGIMSEEEFLGSMEESFKHKFKPEVIKGNMKALKVSMGEVKICE 193
379 6.000e-72METAHIT O2 GL0039018 [Lack both end] locus=scaffold4755_1:2:1600:+  ali  25  214.....GEVSCKIWGLGGDGTVGANKNISTIGLVANKYAQAYFSYDSMKSGGLTQSHLRFGDEPIRSTYLVSSADFVAVHAPTYVNKYTTEDLKDGGILFLNCPWSAEELETRLPKHANFYIIDAAKLAVQVGLGKRTNNILQAAFFALTKVIPLDMAVEDMKKSYFKKAGQKIVDLNDKAVDLGISAAVKVE 416
380 6.000e-72gi|333979329|ref|YP_004517274.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Desulfotomaculum kuznetsovii DSM 6115]  clstr ali  28  1......MYEILIAGFGGQGVLSTGQLLAYAGMLEGKHVSWIPSYGPEMRGGTANCGVTISDSPI-SSPVVTEPTSLIVMNRPSLEK-FEGSVVPGGLILINSSLVD---IKATRKDVRVYYIPANELAEELGNARVAGNVILGALLELTGVVSLDAVEKSLREVLPA-HRHKLIPLNRQALETGAALVR... 178
381 6.000e-72gi|322420762|ref|YP_004199985.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Geobacter sp. M18]  clstr ali  19  422....DGTYQAMFFGLGSDGTVGANKNIKIIGEATENYAQAYFVYDSKKAGSITTSHLRFGKKPINAPYLIDNADFVACHNFTFLEKYMLSKAKPGATFLLCSPFDEGEVWDNMPKKLKVYTINAIKLAEELGLGARINVIMQTAFFKISGIIPLESAIAEIKGAIGKKAGEKVVAMNNAAVDQALLNIHEV. 622
382 7.000e-72gi|227485074|ref|ZP_03915390.1| pyruvate synthase [Anaerococcus lactolyticus ATCC 51172]  clstr ali  21  414....EGTSRCKFWGFGSDGTVGANKAIKIIGDNTDMYAQGYFDYDSKKSGGLTVSHLRFGKEPILSTYLLDEADFISCSKQAYVNYDLLAGIKEGGTFLLNTVWSVEELEQHLPKNIDFYILDASHIAQSIGLGGRTNMIMQSAFFNLTKVIPVEDLKESIVKSYGHK-GEDIVNMNYNAVDKGLEAPIKV. 614
383 7.000e-72METAHIT MH0006 GL0216919 [Complete] locus=scaffold1464_3:4230:7802:+  ali  27  416....KGVFEAKFFGLGADGTVGANKNVKIIGDNTDKYCQAYFSYDSKKSGGFTCSHLRFGDTPIRSTYQIKTPNFVACHVQAYLHYDVTRGLQQNGLFLLNTIFEGDELVNFIPNNVKVYYINATKIAQEIGLGNRTNTILQSAFFRITEVIPVEQMKKAIVKSYGKK-GEDVVNMNYAAVDRGGEY..... 612
384 7.000e-72gi|118474239|ref|YP_891594.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Campylobacter fetus subsp. fetus 82-40]  clstr ali  21  414....DDCIECLFYGLGADGTVGANKNIKIIGDKTDLYAQAYFAYDSKKSGGYTRSHLRFGKKPIRSTYLVSNPHFVACSVAAYLDYDVVDGLRDGGTFLLNSIWDADETVKRIPNKVKFYILNATKLAYDIGLGNRTNTIMQSAFFKLANIIDFKDAQNYMKEYAKKKKGDKIVEMNYAAIDQGADKLVEIK 615
385 8.000e-72gi|339443108|ref|YP_004709113.1| pyruvate:ferredoxin oxidoreductase [Clostridium sp. SY8519]  clstr ali  44  1...MSKGIEIRWHGRGGQGAKTAALLLADVAFKTGKQVQGFPEYGPERMGAPITAYNRISEEEIRVHSNIYDPDYVAVVDETLLHVDVTAGLSEQGAIIVNSPRSAREVAAELPDHGKVVTIDARKISEETLGKNFPNSPMLAAVVAVTQVMNREEFLREMRASYGHKFKPEVIEGNMRALERTLAILQ... 190
386 8.000e-72gi|170078052|ref|YP_001734690.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Synechococcus sp. PCC 7002]  clstr ali  21  414.SEPDSVVRAMFYGLGSDGTVGANKNIKIIGEETDNYAQGYFVYDSKKSGAVTVSHLRFGPNLIRSTYLINQANFVGCHQWLFLEKDVLSGAKDGSIFLLNSPYAVDQVWDQLPKNLKFYVINANKVARESGMGGRINTVMQTCFFALSGVLPKEEIKEYIQKTYGKK-GADVVTMNIQAVDNTLANLFEV. 617
387 9.000e-72gi|312898273|ref|ZP_07757664.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Megasphaera micronuciformis F0359]  clstr ali  21  414....DGIVNCKFWGFGSDGTVGANKNVKIIGDNTDMFVQAYFEYDTKKSGGVTKSHLRFGKNPIRSTYYIKSADFLACHKPVYMTYDIVGEVKDGGVFLLNCGWSQEELETHLRKKLRFYIIDAAKIAGELGLGNRTNTVLQAAFFKLANILPIEDMKKAIQKTYMAK-GDKVVAMNQAAVDRGISDVVEVQ 616
388 9.000e-72gi|427736854|ref|YP_007056398.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Rivularia sp. PCC 7116]  clstr ali  19  413.TEAENVVRAMFYGLGSDGTVGANKNIKIIGEETDNYAQGYFVYDSKKSGSMTVSHLRFGSQLIRSTYLIDKANFIGCHQWTFLEVDVLQNAVSGATFLLNSPYDPETVWQHLPAKAKFYVINANEVARNSGMGGRINTIMQTCFFALAGVLPQDEAIESIKKTYGKK-GDKVVAMNLQAVDNTLDNLHKVQ 617
389 1.000e-71gi|397691652|ref|YP_006528906.1| pyruvate:ferredoxin oxidoreductase subunit alpha [Melioribacter roseus P3M]  clstr ali  21  423....EDVTRCLFYGLGADGTVGANKNIKIIGEETDNYAQGYFVYDSKKSGSTTVSHLRFGKKPIHSTYLIQTASFVGCHQFNLLEKDVLGNIKEGGTFLLNSPYSKEETWDKLPKKVNFYVIDGYSVAAQTGMGSRINTIMQTCFFAISGILPIEQIKNAIKKTYGAK-GEEIVKKNFAAVDQTLEHLYKV. 623
390 1.000e-71gi|291563571|emb|CBL42387.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [butyrate-producing bacterium SS3/4]  clstr ali  18  408.TTPEGTTNCKFWGLGADGTVGANKNIKIIGDNTDMYAQAYFDYDSKKSGGVTMSHLRFGHTPIKSTYLIHKANFVACHNPAYIRKYMVQELVDGGTFLLNCPWDAEGLEKHLPHNIKFYTIDGVKLGIETGMGPRINTILQSAFFELTKIIPADKMKAAAKATYGRK-GEDVVMKNWAAIDAGAKGLVEVQ 613
391 1.000e-71gi|290967889|ref|ZP_06559439.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Megasphaera genomosp. type_1 str. 28L]  clstr ali  19  414.....GLTSCKFWGFGSDGTVGANKAIKIIGDHTDMYAQAYFAYDSKKSGGVTMSHLRFGTKPIDMPYLIDAADYIACHRQSYANRDLLRGIKEGGTFMLNCTWTDEELDHELPNHVKFYTLNGDAIGQKLGLGTRINMVMQAAFFALAKVIPLEDLKDSIVKSYGKK-GQKVVDMNWAAVDAGIGEFHEV. 613
392 1.000e-71gi|408421527|ref|YP_006762941.1| pyruvate-flavodoxin oxidoreductase NifJ [Desulfobacula toluolica Tol2]  clstr ali  22  411.PAPKGTIAAKFWGLGADGTVGANQAIAIIGDNTDKYAQGYFAYDSKKSGGLTVSHLRFGDVPIQSTYLIDDSDFVACHKSNYVEYDVLKGLKEGGTFLLNSPWSIEDMETYIPKKIKFFNIDAVKIAGEVGLGGRINMIMQTCFFKLANVLPVDELKEDINVMFGKK-GDKIVNMNIEAVDKTLDNLVEI. 614
393 1.000e-71gi|85857951|ref|YP_460153.1| pyruvate dehydrogenase (ferredoxin/flavodoxin-dependent) [Syntrophus aciditrophicus SB]  clstr ali  20  413...PPGTSSCKFWGIGADGTVGANKAIKIIGENTDLYTQAYFAYDAKKSGGVTVSHVRFSPNRILSHYLIKHADLIACHVPAYVHQDLLEGIVDGGIFLLNSPWTVEQMETELPKHLKFYNIDAVTIADRVGLGGRINMIMQAAFFKIANVIPPDELKDAIRKTYGKK-GDKIVNMNIAAVDKALDAIKVIE 615
394 1.000e-71METAHIT MH0009 GL0069642 [Complete] locus=scaffold20653_2:10815:14363:-  ali  17  413.TSPEGTKSCKFWGLGSDGTVSANKAIKIIGDHTDLYVQGYFSYDSKKSGGLTVSHLRFGKEIIHSSYLCSNADYIACHNQSYVRYDLLDGIKKKGIFLLNCIWTDDELADKIPNNLRFYTINAFDVAEKIGLGRRINMIMQSAFFALIDLIPISYLKAEVEKNYGNR-GAQIVEMNNAAIDQAKSALHQV. 616
395 1.000e-71gi|119489276|ref|ZP_01622083.1| ferredoxin (flavodoxin) oxidoreductase [Lyngbya sp. PCC 8106]  clstr ali  21  415..EPDHVVRAMFYGLGSDGTVGANKNIKIIGNDTDNYAQGYFVYDSKKSGAVTVSHLRFGPNPIRSTYLISQANFIGCHQWTFVEKDVLKCAAQGSTFLLNSPYSVESVWGKLPKQLKFYVIDADTVARDSGMGRRINTIMQTCFFALSGVLPREEIKKSIEKTYGKK-GAEIVRMNIQAVENTLANLHEV. 617
396 1.000e-71gi|94967761|ref|YP_589809.1| pyruvate--ferredoxin (flavodoxin) oxidoreductase [Candidatus Koribacter versatilis Ellin345]  clstr ali  18  418.TEDAKTVRALFYGLGADGTVGANKNIKIIGEDTDNFAQGYFVYDSKKSGSLTTSHLRFGPKPIRSSYLISRASFVACHQFTFLEVNVLQNAEPGATFLLNSPFSAEEVWDHLPKKLKFYVVDGYKVARDTGMGTRINTIMQTCFFAISGVLPREEAIEAIKKAVKKKRGEAIVQKNFDAIDSTLANLFEVK 622
397 1.000e-71METAHIT V1 GL0093698 [Complete] locus=scaffold8233_8:8447:9076:-  ali  45  9...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGQNVQGFPEYGPERMGAPITAYNRISSDTIRVHSNIYHPDYVVVVDETLLSVDVTAGLKKTGAIIINTPKSKEEVMDELGDEGRVYTVDARKISVETLGKNFPNSPMLAAAVAVSDIMPRDKFIHEMRASYEHKFKPEVIDGNMKALERAYDVVEEA. 200
398 1.000e-71gi|424844648|ref|ZP_18269259.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Jonquetella anthropi DSM 22815]  clstr ali  18  415....EGTICCKFWGIGSDGTVGANKNIKIIGDNTDMYAQGYFSYDSKKSGGVTVSHLRFGHHPIRSTYLISAADFVACHKQEYLHQYVLRGLKKGGTFLLNTQWTMEALEANIPNNISFYTINGVDLAEEVGLGNRTNMITMAAFFKLAKVIPEDEMKEAIVHSYGRK-GEKIVAMNNAAVDKGIGALRKIE 617
399 1.000e-71gi|304383331|ref|ZP_07365797.1| pyruvate:ferredoxin oxidoreductase [Prevotella marshii DSM 16973]  clstr ali  28  415....AGTFEAKFYGLGADGTVGANKNVKIIGDNTDKHCQAYFSYDSKKSGGFTCSHLRFGDSPIRSTYLVKTPNFVACHVQAYLHYDVTRGLQQNGTFLLNTIFDGEELINFIPKKVKVYYINATKIAQEIGLGNRTNTILQSAFFRITKVIPVEQMKAFIVKSYGNK-GQDVIDKNYQAVDRG........ 608
400 1.000e-71gi|392408058|ref|YP_006444666.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Anaerobaculum mobile DSM 13181]  clstr ali  19  426.......TRAVFYGLGSDGTVGANKNIKIIGEETDLYAQGYFVYDSKKAGGYTISHLRFGPNPIRSTYQIDKANFVACHQFAFTEKNILDIAEEGAIFLLNSPYSAEEVWDYLPKKLRFYVIDAYTVAKEKGLGPRINTIMQTCFFYLSKVIPFEKIKEAIVETYGKR-GEAIVNKNIAAVDAALEHLHEVK 624
401 2.000e-71gi|148266340|ref|YP_001233046.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Geobacter uraniireducens Rf4]  clstr ali  21  420..TAAGTYSAMFYGLGSDGTVGANKNIKIIGEKTDNNVQAYFVYDSKKAGSVTTSHLRFGKNIIRSPYLIDRADFIACHNFTFLEKYMLSKAKEGATFLLCSPFDKDEVWDRMPKKLKFYVINAIKLGEELGLGARINVIMQTAFFRISSIIPLEAIKDAIKKSYG-KAGEKVVEMNNKAVDAALENIFEV. 622
402 2.000e-71METAHIT MH0066 GL0012882 [Complete] locus=scaffold19269_8:2905:6441:+  ali  18  417.TTPKGTTSCKFWGLGSDGTVGANKSIKIIGDHTDMYAQGYFFYDSKKSGGITVSHLRFGSSPITSTYLINKANFVACHNPSYVNKYMVQDLLPGGTFLLNCIWSPEELDANLPNNINFYTINGIKIAEEVGLPGRASTILQSAFFTISGILPVDEAIGYMKEKVVAKFGEAVVNSNCNGIDRGSKEVVKI. 620
403 2.000e-71gi|167771831|ref|ZP_02443884.1| hypothetical protein ANACOL_03203 [Anaerotruncus colihominis DSM 17241]  clstr ali  47  1...MKDIVEIRWHGRGGQGAKTASLLLADAAFNTGKYVQGFPEYGPERMGAPITAYNRISSERSTVHSNIYEPDYVVVVDETLISVDVTAGLKKEGAIVINSGKSPAQLRPLLKYAGRVFTIDAGRISEEELGKNFPNTPMLAAIVKVSGVVEPDAFVKDMEASFHHKFKPQVIEGNMRALKRSMEEVQ... 190
404 2.000e-71gi|148655365|ref|YP_001275570.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Roseiflexus sp. RS-1]  clstr ali  20  416......TVRCLFYGLGADGTVGANKNIKIIGEETNNYAQGYFVYDSKKSGSMTVSHLRFGPDPIRAPYLIERANFVACHQFSFLERDVLKAAEPGAVFLLNSMYGPDEVWYHLPKKLKFYVIDGDRVAKESGMGRRVNTVMQTAFFAISGVLPREEIKRSIKKTYGKR-GEAVVQQNYRAVDAALAHLYQV. 614
405 2.000e-71gi|404491945|ref|YP_006716051.1| pyruvate:ferredoxin/flavodoxin oxidoreductase [Pelobacter carbinolicus DSM 2380]  clstr ali  20  422....DGLYSAVFYGLGSDGTVGANKNIKIIGESTDNNVQAYFVYDSKKAGSITTSHLRFGKQAIRAPYLIDRADFVACHNFSFLEKYMLGKAKQGGTFLLNSPYSAEEVWGQLPKQLKFYVIDGVRLGNEIGLGPRINVIMQTAFFAISNIIPLETIKQAIVKSYGKR-GEKVVNMNYQAVEVALANLKEV. 622
406 2.000e-71METAHIT MH0073 GL0097987 [Complete] locus=scaffold23130_2:2278:2883:+  ali  42  1...MNNGIEIRWHGRGGQGAKTAALLLADVAFKTGQYVQGFPEYGPERMGAPITAYNRISEDKIRIHSNIYTPDYVVVVDETLLDVDVTAGLKKDGAIIINTPKSRDEIKDKLGYEGKVYTVDARHISVKTLGKNFPNSPMLAAVVAVSNVMPRDTFIREMRASYQHKFKPEVIDGNMEALEMTFDRLAE.. 191
407 2.000e-71gi|95928306|ref|ZP_01311054.1| Pyruvate:ferredoxin (flavodoxin) oxidoreductase [Desulfuromonas acetoxidans DSM 684]  clstr ali  21  418.KVPSDCYAAMFYGLGSDGTVGANKNIKIIGETTDNKVQAYFVYDSKKAGSMTTSHLRFGKKAIKSPYLIDSADFIACHNFSFLEKYILSNINEGGTFLLNSPYGKDEIWNNIPKKLKFYVIDGVHLGEAIGLGPRINVIMQTAFFKISGIIPLEEIKNAIVKSYG-KAGEKVVAMNQEAVDRALEEIHEV. 621
408 2.000e-71gi|21674446|ref|NP_662511.1| pyruvate flavodoxin/ferrodoxin oxidoreductase [Chlorobium tepidum TLS]  clstr ali  22  418..EPDSVFRALFYGLGSDGTVGANKNIKIIGENTDNYAQGFFVYDSKKAGSITTSHLRFGPEQIRSTYLITEAQFVGCHHWVFLEMDVAKNLKQGGTLLINSAYAPDVVWSKLPKQAKLYTIDAYKVAHESGMGQRINTIMQACFFAISGVLPREEIKDAIRHTYGKK-GDEVVQQNIKAVDNTLANLHEVK 621
409 2.000e-71Oral.Meta HOMD pbiv_c_17_19 Prevotella bivia JCVIHMP010 [14272 - 17919] pyruvate:ferredoxin (flavodoxin) oxidoreductase  ali  27  441....EHTFEAKFYGLGADGTVGANKNVKIIGDNTDKYCQAYFSYDSKKSGGFTCSHLRFGDDKIRSTYQVKTPNFVACHVQAYLNYDVTRGLRKNGTFLLNTIFDGKELIDFIPNKVKVYYINATKIAQEIGLGNRTNTILQSAFFRITEVIPLELAIEQMKKSYSKK-GQDVVDLNYAAVDRGGEY..... 637
410 2.000e-71METAHIT MH0061 GL0006843 [Complete] locus=scaffold284_2:654:4184:+  ali  23  416.....GEISCKIWGLGGDGTVGANKNISTIGLVANKYAQAYFSYDSMKSGGLTQSHLRFGDAPIRSTYLVSSADFVACHAPTYVKKYLTEDLKDGGTFLLNCPWPVEELESQLPKHARFYIIDAAKLAGEIGLGKHTNNILQGAFFALTKVIPMDVAVEDMKKTYFKKAGQKIVDMNDKAVDVGVHAAVKV. 616
411 2.000e-71gi|148265505|ref|YP_001232211.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Geobacter uraniireducens Rf4]  clstr ali  19  417...MDGTYEAMFYGLGSDGTVGANKNIKIIGETTNNFAQAYFVYDSKKAGSITTSHLRFGTQPINAPYLIDNADFIACHNFTFLEKYMLSKAKPGGTFLLCSPFAHGEVWDRIPKQLKFFVINAIKLGEELGLGARINVIMQTAFFKISNIIPLEEIKGAIKKSYG-KAGEKVVAMNNAAVDEALKNIHEV. 618
412 2.000e-71gi|119511752|ref|ZP_01630855.1| ferredoxin (flavodoxin) oxidoreductase [Nodularia spumigena CCY9414]  clstr ali  21  417.TEPDNVIRAMFYGLGSDGTVGANKNIKIIGEETDNYAQGYFVYDSKKSGSMTVSHLRFGPQPIRSTYLINKANFIGCHHWGFLERDILKDAISGGTLLLNSPHNADTVWEYLPPKVKFFVINANQVARESGMGGRINTIMQVCFFALAGVLPEAEIKKAIEKTYGKK-GAEVVQKNLQAVDNTLTNLHKV. 620
413 3.000e-71METAHIT unmapped GL0001772 unmapped_[Lack_3`-end]_[mRNA]_locus=scaffold376593_2:14:2320:+  ali  23  377.STPSKNFSCKFWGLGSDGTVGANKAVKIIGDHTDSYVQAYFAYDAKKSGGVTISHLRFGPEKIQGSYQIKAANFIACHNQAYVHYNLIADLKKGGSFLLNTIWSDEELEKNLPASLKFYTLDAFSIAKDLGLGGRINMVMQAGFFALCPIFPLEEAIAYLKKTYGAK-GQDVVDMNCAAIDQGARRIHRV. 580
414 3.000e-71gi|254412467|ref|ZP_05026241.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Coleofasciculus chthonoplastes PCC 7420]  clstr ali  20  416.TEPETVVRCVFYGLGSDGTVGANKNIKIIGEETENYAQGYFVYDSKKSGAVTVSHLRFGPEKIRSTYLISQANFVACHQWLFLEKNVLSSAAPGATFLLNCPFSKDEVWSKLPKQLKFYVIDANQVAVSSGMGRRINTVMQVCFFELANVLPKAEIKQYIEKTYGKK-GAEVVRMNIEAVDNALAHLSEVQ 620
415 3.000e-71gi|327400693|ref|YP_004341532.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Archaeoglobus veneficus SNP6]  clstr ali  44  1......MLEVRFHGRGGQGSVTAAEVLAIAAFKDGKYSQAFPIFGVERRGAPVQAFCRIDEKPIKQRCQVYEPDLVVVQDATLMDVDVTAGLKEGGILLINSAKSPEEFGINSNTTVK--TIDATRLALETLGRPIVNTVMLGALAKL-GIVSLNSIVEAV----GEKFGCKLAEKNILAVKKAFEEL.... 176
416 3.000e-71METAHIT V1 GL0069366 [Complete] locus=scaffold76268_1:269:862:+  ali  45  8...MKKNIEIRWHGRGGQGAKTAALLLADVAFNTGMHVQGFPEYGPERMGAPITAYNRIGESEIRVHSNIYHPDYVVVVDETLLHVDVTNGLKEDGAIVINTPRPKEEILPLLGYKGSVYTIDAHKVSIETLGKYFPNSPMLAAIVKVADIMDKDVFLSQMQASYEHKFKPEVIDGNMRALKMAFEEVK... 197
417 3.000e-71gi|254421458|ref|ZP_05035176.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Synechococcus sp. PCC 7335]  clstr ali  19  414..EPDSVVRAIFYGLGSDGTVGANKNIKIIGGNTDNYAQGYFVYDSKKSGSVTVSHLRFGPDPIRSTYLVEQANFVACHQWEFVDKYVLSAAKQGATVLFNSPFSPVETWRRLPKQLRVYGIDGAKVAREAGMKGRINTVMQVCFFALANVLPIEQIKKSIHKTYGKK-GKAVVEMNLQAVDRTLENLFEV. 616
418 3.000e-71gi|166030573|ref|ZP_02233402.1| hypothetical protein DORFOR_00236 [Dorea formicigenerans ATCC 27755]  clstr ali  45  1...MSNHTEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDEVIRVHSNIYDPEFVVVVDESLLEVDVTAGLKKEGAILVNTARPKEEIIPHLKYEGKLYTIDAHKVSMEAMGRYFPNTPLLAAIVKVANIMDEETFLREMQASFKHKFKPEVIDGNMKALEMALKEVK... 190
419 3.000e-71gi|51894302|ref|YP_076993.1| pyruvate flavodoxin dehydrogenase [Symbiobacterium thermophilum IAM 14863]  clstr ali  18  416.TEADDVHRAVFWGLGSDGTVGANKNIKIIGEETDFYAQGYFVYDSKKSGGITISHLRFGPRPIKSTYQIQKANFVAIHQFVFLYKYVLDAATPGATVLLNSPYPADEVWNHLPKGLKLWAIDADNVARQTGMGRRINTIMQTCFFAISGVLPKDEIKKAIEKTYSSK-GETVVQKNFAAVDAALAHLHEVK 620
420 3.000e-71METAHIT MH0012 GL0027729 [Complete] locus=scaffold132115_2:3227:3787:+  ali  45  3......TLEVRWHGRGGQGIVTANEILAGAALYEGKFMKAFPEFGPERMGAPIRAFARVSDEPIKVHSQVYFPDYVAVLDPTLININVLEGLKETGSLIVNNTASVSELKKTLDTDMDVHVVDASKIALETIGKPLANTAMLGALVKISGIVGLDSIIAEMQIKLGGKLPAPVVEKNVLSVKRAYEEVQ... 186
421 3.000e-71gi|333988108|ref|YP_004520715.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanobacterium sp. SWAN-1]  clstr ali  42  1......MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYCQAFPFFGVERRGAPVMAFSRIDDQPIRRRYQVYKPNYVIVLDDGLLEVDVFSGIKDGGKIIINTTSDVKTV-----DGAEVQKIDATGIALEILGVPIVNTVMLGAFAGLTGEISLESLIKIIKETFSGKIG----EKNAKAATIAYNKVRE.. 176
422 3.000e-71gi|82523792|emb|CAI78535.1| pyruvate oxidoreductase [uncultured Chloroflexi bacterium]  clstr ali  19  416.....ETVRCVFWGLGADGTVGANKNIKIIGEETDNYAQGYFVYDSKKSGGSTISHLRFGPKPIRSPYLINQAQFVACHQFTFLERDVLKYAMPGGVFLLNSLAGPDEVWDTIPKKLRFFVINAYEVANATGMGTRINTIMQTCFFAISGVLPRDEIKKSIEKTYGKR-GEAVVKKNFEAVDQTLVHMHEVK 616
423 3.000e-71METAHIT MH0017 GL0000159 [Lack both end] locus=scaffold16933_1:1:2526:-  ali  18  211.TTPEGTTNCKFWGLGADGTVGANKNIKIIGDDTDMYAQAYFDYDSKKSGGVTISHLRFGHSPIRSTYLISQANFVACHCTAYIYKYMVQDLVPGGTFLFNTQWTVDELDEKLPNNINFYIIDGVKIGKEIGLGNRINTVLQSAFFSLTKLIPEEEVIKLMKDSYAKK-GDDVVKMNHDAIDAGATAYVKV. 414
424 3.000e-71Gut.JP.Meta  ali  23  430.......TACKFWGFGSDGTVGANKAIKIIGDNTDMYAQAYFDYDSKKSGGVTMSHLRFGKKPINKPYLVTRPTFVACHRQAYVEYDILQGIEEGGTFLLNCTWTPEELSEKLPKHLKFYIINAAHIAQDIGLGGRINMICQSAFFKLANIIPIEELKDSIVATYGKK-GQSVIDMNMMAVDKGVNAIVPV. 627
425 4.000e-71METAHIT MH0006 GL0139421 [Complete] locus=scaffold65160_1:7099:10617:+  ali  20  412...PKDAIRCKFYGLGSDGTVGSNKNIKIIGNYTEKYAQAYFAYDSKKSGGLTVSHLRFGDTPIKSSYLIDTADFVACHNPSYVTKYMVSDLKDGGTFLLNSIWKPEEMDAMLPKHIKFYTIDAIDIVTKIGLGNRISTTMQSAFFYLAGVMPYEEMKEFVVKSFSKK-GEAVVNMNFAAIDDAVSGLVEVK 614
426 4.000e-71gi|291523667|emb|CBK81960.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric [Coprococcus catus GD/7]  clstr ali  21  413...PAGTTSCKFWGLGSDGTVGANKNIKIIGDHTDMYAQAYFHYDSKKSGGVTQSHLRFGKTPIRSTYLVKTADFIACHNQAYIHYDILGDIKEGGTFLFNTVWSPEELDEKLPKHVKFYIINAEDVDKELKLNGKTNAVLQAAFFKLANIIPIDTAVKYMKKSYGKK-GEDVVNKNFAAVDAGLDKIVEV. 614
427 4.000e-71Oral.Meta HOMD cgra_c_7_416 Campylobacter gracilis ATCC 33236, RM3268 [12889 - 9287] (REVERSE SENSE) ORF  ali  25  422....EDETECLFYGLGADGTVGANKNVKIIGDKTELYAQAYFAYDSKKSGGYTRSHLRFGKRPIRSTYLVSNPHFVACSVAAYLDYDVIGGIREGGTFLLNSIWDAEQTAAKLPNKVKFYILNATKLAREIGLGGRTNTIMQSAFFKLSGIIPFEQMKEYAKKTYAKK-GEAVVAMNCDAIDRGADALVQV. 622
428 4.000e-71gi|350272945|ref|YP_004884253.1| pyruvate-ferredoxin (flavodoxin) oxidoreductase [Oscillibacter valericigenes Sjm18-20]  clstr ali  22  411.TAAAGTIECKFWGLGGDGTVGANKNIKIIGDHTDKYIQAYFQYDSKKTGGVTISHLRFGDKAIRSPYYINKADFVACHVPAYITKGFVRDVKPGGTFLINCQWNDKELSEKLENGIQVYTIDAIDLAAKIGMGKRTNTILQSAFFSLAKIMPESEAVGYMKDAATHKKGQDVVDMNHKAIDMGATAYKK.. 614
429 4.000e-71gi|167036892|ref|YP_001664470.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Thermoanaerobacter pseudethanolicus ATCC 33223]  clstr ali  29  4........RIIFAGFGGQGVLSMGLIITYAGMFEGKNVSWTPSYGPEMRGGTAYCNVTVSDEEVGS-PVITEATSVIVMNRPSLDKY-ESYVIPGGKLFINTSLVD---RKAERKDIEVYEIPANDIANELGNLKIANMVMLGAFIEATKVVKLETVLKALPEVFG-KGKEHLIPINEKALNKGAELVK... 178
430 4.000e-71gi|261403273|ref|YP_003247497.1| pyruvate ferredoxin oxidoreductase subunit gamma [Methanocaldococcus vulcanius M7]  clstr ali  42  1......MIEVRFHGRGGQGAVTAAQILAKASFYDGKFCQAFPFFGVERRGAPVMAFTRIDDKKITLRCQIYEPDYVIVQDPTLLEVNVVDGLKENGAVIINT------VKEDLDLGYKTYTIDATGIALDVLGVPIVNTAMVGAFAGVTKLVSIESVKKAILDTFKGKLG----EKNAKAAELAYNEMIK.. 175
431 4.000e-71METAHIT MH0006 GL0050435 [Complete] locus=scaffold92609_1:7102:10650:+  ali  21  409IKLLEGTSELVFYGLGSDGTVGANKNIKIIGDNTDLYAQAYFAYDSKKSGGVTRSHLRFGPKPITAPYLVSHADFVSCSLEAYVEKYMLSCLKDGGTFLLNTVRNAKELEEHLPKHAKFYIIDAVHLARQIGLGGRTNTILQSAFFKLNEIMPYETAQELMKKYAAKKKGEAIVQLNYQAIEKGAEGLVEVK 615
432 4.000e-71gi|218438247|ref|YP_002376576.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Cyanothece sp. PCC 7424]  clstr ali  20  424.TEPSEVVRAVFYGLGSDGTVGANKNIKIIGEDTENYAQGYFVYDSKKSGSVTVSHLRFGPHLIRSTYLVTQANFIACHQWEFVDQDLLETAIPGSTFLINSPYSKDEVWEHLPKNLKVYVVNAYQVAREAGMGGRINTVMQVCFFALSGVLPIEQIKKSIRKTYGKK-GEDIVRMNILAVDSTLDHLYQV. 627
433 5.000e-71gi|305666200|ref|YP_003862487.1| ferredoxin (flavodoxin) oxidoreductase [Maribacter sp. HTCC2170]  clstr ali  20  416....KNTFNCMFYGLGSDGTVGANKNIKIIGETTDNYVQGYFVYDSKKAGAQTVSHLRFGPEPIYSTYLIHKANFIACHQFNFIEKYILKNIKKGGTFLLNSPFDKDAVWEILPKKLEFYVIDASKVAQEANLGKRTNTVLQTCFFAISGVLPKDEIKEAIVKSYSKK-GDAVVQMNFNAVDKSLENLQRV. 616
434 5.000e-71gi|307719342|ref|YP_003874874.1| pyruvate-flavodoxin oxidoreductase [Spirochaeta thermophila DSM 6192]  clstr ali  20  421.TEDDETFRAIFYGLGSDGTVGANKNIKIIGESTDNYAQGYFVYDSKKAGTVTVSHLRFGKKPIKGAYLISDAHFLACHKFSFLEKYMLGKLRKGGTFLLASPYGKDEVWAHLPKEAKFYVINAHKIAEEVGMPGRINVIMQTAFFKIAGILPEQQIKESIVKTYGKK-GKDVVDKNLKAVDRALEALEEVQ 625
435 5.000e-71gi|268680517|ref|YP_003304948.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Sulfurospirillum deleyianum DSM 6946]  clstr ali  22  415.....ETKECLFYGLGADGTVGANKSIKIIGDETDMYAQAYFAYDSKKSGGFTRSHLRFGKHPIRSTYLVSNPHFVACSVAAYLEYDVIDGIRENGTFLLNSIWDADETIKRIPKKVKFYIINATKLARDIGLGNRSNTIMQSAFFKLAEIIDFEKAQEFMKKTY-HKKGEHIVELNYKAIDVGANGLVKV. 614
436 5.000e-71gi|375107815|ref|ZP_09754076.1| 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family [Burkholderiales bacterium JOSHI_  clstr ali  39  1......MLQIRIHGRGGQGVVTAADMLAIAAFNQGRHAQSFPSFGSERTGAPVVAFCRIDDREIRLREPILSPDVLIVQDPTLLHVDVFQGLKPDGYVLINSRKSLDELGLSERDRSHLLTVPATDIAIAHVGRPLPNAVLLGGFAALAGLISLDAVEHAIRDRFTGK----VAEGNVAAARQAFEHVRQ.. 185
437 5.000e-71gi|354564668|ref|ZP_08983844.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Fischerella sp. JSC-11]  clstr ali  21  450.TEPDHVVRAMFYGLGSDGTVGANKNIKIIGEETDNYAQGYFVYDSKKSGSMTVSHLRFGPKPIRSTYLIGKANFIGCHQWVLLDVDVLKNAVSGATFLLNSPYDADMVWEYLPEKVKFYVINATQVARESGMGGRINTIMQVCFFALAGVLPIAKIKQVIEKTYGKK-GAEVVHMNLQAVNQTLENLQKV. 653
438 5.000e-71gi|282878344|ref|ZP_06287136.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Prevotella buccalis ATCC 35310]  clstr ali  27  416....EGTFEAKFFGLGADGTVGANKNVKIIGDNTDKYCQAYFSYDSKKSGGFTCSHLRFGDQPIHSTYKVITPNFVACHVQAYLRYDVIRGLRKNGTFLLNTVFEGEELANFIPNNITVYYINATKIAQEIGLGNRTNTILQSAFFRITEVIPVEQMKKFIVKSYGNK-GQDIVDKNYAAVERGVEY..... 612
439 5.000e-71gi|189423439|ref|YP_001950616.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Geobacter lovleyi SZ]  clstr ali  19  421...MEGVYQAMFYGLGSDGTVGANKNIKIIGEETNNNAQAYFVYDSKKAGSMTTSHLRFGKKYIRAPYLVQEADFVACHNFSFLEKYMLAKAKTGSTFLLNAPFSASEVWDTMPKEVKFYVIDGVKLGNEIGLGPRINVIMQTAFFKISNIIPVKSIKDAIKKSYG-KAGEKVLEMNYKAVDAGLNNFYEVK 623
440 5.000e-71gi|337286775|ref|YP_004626248.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Thermodesulfatator indicus DSM 15286]  clstr ali  45  1......MIEVRLHGRGGQGAVTSAELIAISAINQGNYAQAFPSFGPERRGAPVMAFVRISDQRIRTREKVYNPDIVVVLDPSLPTVNVTDGLKKDGWVVLNSAKDEKTLREILGFKGKLAVVDATKIAIEELGLPITNTTMLGAFLKATGLVDQEYLEEALEHRFGR-----LAEKNKAAMARAIKETK... 180
441 6.000e-71gi|414077199|ref|YP_006996517.1| pyruvate-flavodoxin oxidoreductase NifJ [Anabaena sp. 90]  clstr ali  20  414..EADNIVRAIFYGLGADGTVGANKNIKIIGEETDNFAQGYFVYDSKKSGSVTVSHLRFGSQPIHSTYLITKANFVACHQWDFVEKPILKDIIPGGTFLLNSHYHKDEIWNKLPKNIKFYVINAYKVAREAGMGGHINTVMQVCFFAISGVLPREEIKKSIRQAYGKK-GEEIVQMNIQAVDKTLENLYEI. 616
442 6.000e-71gi|320162233|ref|YP_004175458.1| putative pyruvate:ferredoxin oxidoreductase [Anaerolinea thermophila UNI-1]  clstr ali  19  423....SSTVQCVFFGLGSDGTVGANKNIKIIGEETENNAQGYFVYDSKKSGSVTISHLRFGPKPLRAPYLIRQADFVACHQFSFLERDITRYAKPGAVFLLNSIYGPDEVWNHLPKKLKFYVIDAYEVANRTGMGQRINTIMQTCFFAISGVLPREEIKKAIQKTYGKR-GEAVVQKNFEAVDQTLANLYEVK 624
443 6.000e-71METAHIT MH0012 GL0289442 [Complete] locus=scaffold151113_1:654:1235:-  ali  46  1...MNDLIEIRWHGRGGQGAKTACLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPITIHSAIYEPNYVVVVDDTLLDVDVTAGLKEDGAIVINTTNDAETLKKKLGYKGGIYTIDARSISIDALGKYFPNTPMLAAIVKVSGVIPEDQFLADMEGSFKHKFKPEVIDGNMKALKNTLEKVNKIQ 193
444 7.000e-71gi|421766963|ref|ZP_16203729.1| Pyruvate-flavodoxin oxidoreductase [Lactococcus garvieae DCC43]  clstr ali  22  415..TSADIYQAKFWGFGSDGTVGANKAIKIIGDYTNKYVQGAFEYDSKKSGGLTVSHLRFGDTPIQSEYMISCPDFVACHNTTYVRYDLVKGLRRGGTFLLNTSWTDEQLDRNLPNDINFYSIDAAKIAQTTGLGRRINTIMQVAFFKLTEIMPFDEVYEILKQKYAKKSP-KIVEQNLQAMEEALTYLHKVE 617
445 7.000e-71gi|310778346|ref|YP_003966679.1| pyruvate ferredoxin/flavodoxin oxidoreductase [Ilyobacter polytropus DSM 2926]  clstr ali  20  414....DDVKGCLFFGLGSDGTVGANKNIKIIGDKTDLYAQGYFAYDSKKSGGVTRSHLRFGKTPIRSTYLLSAPSFVACSVPAYLTYDMISGLKKGGSFLLNCIWDKDETIANLPNSIKFYTINATKLGEEIGLGNRTNTIMQSAFFKLADVIPFEEMKEYAKKSYEKK-GQDIVEMNYAAIDRGAGELVEI. 614
446 7.000e-71gi|154249550|ref|YP_001410375.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Fervidobacterium nodosum Rt17-B1]  clstr ali  67  26.TVPANIFEIRWHGRAGQGAKSASQMLAEAALDMGKYVQAFPEYGAERTGAPMKAFNRISDEPILLHSSVETPNLVVVIDDTLLNPDILAGTNEETVLIVNTVRSIEWVRQKSGFKGKICVVKATDIALEELGRGTPNTVMLGAIARVTGVIELKYVEDKIRDMFLKKFGEEVVNKNIRALHRGYEEV.... 213
447 8.000e-71gi|239616786|ref|YP_002940108.1| pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Kosmotoga olearia TBF 19.5.1]  clstr ali  64  1..MPEKYFEVRWHGRAGQGAKSASQLLAEAALEAGMYAQSFPEYGAERSGAPMKAFNRISDVPIRVHHTVENPDIIVIVDDTLLGLSITEGVKEDTVMIVNTVRGSNFVREKTGFKGKIFTIPATDIALEEIGRGIPNTVMIGALLKASNDIPLDAVLNRVKKMFSGKLTEEKIEANLRAVRRGYEEVK... 189
448 8.000e-71JCVI_PEP_1096678595075 /source_dna_id=JCVI_ORF_1096678595074 /offset=0 /translation_table=11 /length=416 /full_length=416  ali  21  226..EPQGTIRCKFWGLGSDGTVGANKNIKIIGDKTDLYAQGYFQYDSKKSGGITISHLRFGEKPIQSEYLLTKSDFIALHNPSYVGKYILKGIKEGGMFLINCSWDAGEIKEILEKKVKVYAIDANRIAQETGMGRRINTIMQVAFFKIVDVINHDEIKEAIKKTYGKK-GQEIVDKNI.............. 415
449 9.000e-71gi|312898883|ref|ZP_07758271.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Megasphaera micronuciformis F0359]  clstr ali  18  407.KMPLDTTACKFWGFGSDGTVGANKAIKIIGDHTDLYAQAYFAYDSKKSGGVTVSHLRFGTKPIDMPYLIDAADYIACHRQSYVKRDLLRGIKDGGTFMLNCTWSDEELDHQLPHHVKFYTLNGDAIGQKLGLGTRINMVMQAAFFALAKVIPLDDLKDSIVKSYGKK-GQKVVDMNWAAVDAGVGEFHEV. 613
450 9.000e-71gi|227520214|ref|ZP_03950263.1| pyruvate synthase [Enterococcus faecalis TX0104]  clstr ali  22  427..TNPKTYQAKFWGFGSDGTVGANKAIKIIGDHTDKYAQGFFYYDSKKSGGLTVSHLRFGETPIRSTYLIEHSDFVACHTAAYLHYDLVKGLKKGGTFLLNTIWNDEQLARFLPNEIQFYTINAVKLASEVGLGGRINTAMETAFFKLAEIMPFEQVKEEALKSYGHKS-MKVVEKNIQAIDKTVELLHQV. 629
451 9.000e-71METAHIT MH0011 GL0134813 [Lack both end] locus=scaffold26715_1:3:1772:-  ali  16  195...PEGTIACMFYGLGSDGTVGANKNIKIIGDHTDMYAQGYFAYDSKKSGGLTVSHLRFGKQPIQSPYLIDAADFIACHNSSYVTKYMLEHIKDHGIFLLNSPWTLAEMEHELPKHVKFYNMDGVKIARSVGMGNRINTVMQAAFFVLANVIPADQAIDYMAKKSYAKKGDEVVQKNYAAIDAGATGFEEVK 397
452 1.000e-70gi|288800889|ref|ZP_06406346.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Prevotella sp. oral taxon 299 str. F0039]  clstr ali  27  416....EGVFEAKFYGLGADGTVGANKNVKIIGDNTNKYCQAYFSYDSKKSGGFTCSHLRFGDSPIHSTYQVKTPNFVACHVQAYLNYDVIRGLQKNGLFLLNTIFEGQELIDFIPNNITVYYMNATKIAQEIGLGNRTNTILQSAFFRITKVIPIEQMKKFIEKSYGKK-GQDVVEKNYAAVDRGNEY..... 612
453 1.000e-70gi|160878761|ref|YP_001557729.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Clostridium phytofermentans ISDg]  clstr ali  24  414....EGLVACQVWGLGSDGTVGANKAIKIIGEHSDLNVQAYFDYDSKKSGGLTVSHLRFGQEPIKSVYLVTHADYVACHNQSYVNKYLLESLKPGGIFVLNTQWNEEELRKLAEKNTQFYTINAIKIAEEIGLGNRINMVMQGAFFKLINVLPLEELNNVIAKMYGKK-GEKVVKMNQDAVIQGIQAIHKV. 614
454 1.000e-70Oral.Meta HOMD pmulx_c_4_1426 Prevotella multisaccharivorax DSM 17128 [38384 - 34743] pyruvate ferredoxin/flavodoxin oxidoreductase  ali  28  435....EGLFEAKFYGLGSDGTVGANKNVQIIGNNTNKYCQAYFSYDSKKSGGFTCSHLRFGDEPIHSTYSVNTPNFVACHVQAYLHYDMTRGLRDNGTFLLNTIFDGEELVNFIPNNIKVYYINATKIGQEIGLGNRTNTILQSAFFRITEVIPIEQMKAFIVKSYGKK-GQDVVDKNYAAVDRGGEY..... 631
455 1.000e-70gi|262039451|ref|ZP_06012755.1| pyruvate:ferredoxin (flavodoxin) oxidoreductase [Leptotrichia goodfellowii F0264]  clstr ali  26  414....KDVKACLFYGLGSDGTVGANKNIKIIGDKTDLYAQGYFAYDSKKSGGVTRSHLRFSKDPIRSTYLVTKPSFVACSVPAYLGKYMISGLREGGIFLLNTIWDKDKLVKNIPKKAKFFIINATKLALEVGLGNRTNTIMQSAFFYLTEVIPYEEAKKYMKKTYGKK-GRDVVEKNWAA............ 603
456 1.000e-70gi|227499096|ref|ZP_03929233.1| conserved hypothetical protein [Acidaminococcus sp. D21]  clstr ali  24  410..VPEGTVSCKFWGIGSDGTVGANKNIKIIGDHTDLNVQAYFEYDGKKSGGLTRSHLRFGKAPIRSQYYVKKADFVGVHNQAYVNTDVVKDLKDGASLLLNCEWSSEEIADRLPKHIHLYTINAVDIAFQLGLGSRTNTVLQAAFFKITGIIPIDDMKEAIFKSYGRK-GEKIVNMNNAAVDAG........ 605
457 1.000e-70Oral.Meta HOMD lmon_c_1_1213 Listeria monocytogenes Clip81459 [856198 - 859860] pyruvate-flavodoxin oxidoreductase  ali  23  417..TSEKTFQCKFWGFGSDGTVGANKAIKIIGDNTDLYAQGYFSYDSKKSGGLTVSHLRFGEKRIRSAYLIQQADFVSCSTSAYLSYDLLKGLKPGGTFLLNTIWEGEQLERHLPNNIQFYTLNAMRIAGEAGLGRRINTVMQTAFFRVTDILPFEKALADLKETYGKKD-MAVAEKNILAMDQTVANLHKVE 620
458 1.000e-70gi|315607997|ref|ZP_07882990.1| pyruvate:ferredoxin oxidoreductase [Prevotella buccae ATCC 33574]  clstr ali  27  418....EGLFEAKFYGLGADGTVGANKNVKIIGDNTDKHCQAYFSYDSKKSGGFTCSHLRFGDSDIHSTYQVNTPNFVACHVQAYLHYDVTRGLRKNGTFLLNTIFEGQELVDFIPNKVKVYYINATKIAQEIGLGNRTNTILQSAFFRITEVIPIEQMKKFIVKSYGKK-GQDVVDKNYAAVDRGDEY..... 614
459 1.000e-70gi|9651770|gb|AAF91262.1|AF230199_4 pyruvate oxidoreductase delta subunit [Methanococcus maripaludis]  clstr ali  44  1......MKEVRFHGRGGQGAVTAAQILAKAAFYDGKFCQAFPFFGVERRGAPVMAFTRIDDEKIRLRSQIYEPDYVIVQDPTLMDVDVTSGIKDGGIILINTLKD----IKLNGYDVK--TIDATGIALDVLGVPIVNTTLCGAFAGLTGEVTIESLKKSILETFPGKLG----PKNADAAEKAYNLTK... 174
460 1.000e-70METAHIT V1 GL0029471 [Complete] locus=scaffold29499_17:520:1092:-  ali  46  1...MQNCVEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISPAPIRVHSNIYHPDYVVVVDEGLLDVHVTEGLSEDGAILINTSRDKSELTEKLGYKGAVYTIDAKKVSKACLGKYFPNTPMLAGIVKVSGVMDWDEFYNEMRASFLHKFKPEVIDGNMNALKMAFDEVK... 190
461 1.000e-70gi|340756116|ref|ZP_08692749.1| pyruvate:ferredoxin oxidoreductase [Fusobacterium sp. D12]  clstr ali  22  416......TKACLFYGLGADGTVGANKNIKIIGDKTDLYAQGYFAYDSKKSGGVTRSHLRFGKNPIKSTYLVSTPNFVACSVPAYLNYDMTSGLREGGKFLLNCVWDKEEALQRIPNNVKLYIINATKLAHDIGLGQRTNTIMQSAFFKLAEIIPFEDAQQYMKDYAKKKKGDDIVQLNYQAIDIGASGLVEIE 615
462 1.000e-70gi|308273555|emb|CBX30157.1| Pyruvate-flavodoxin oxidoreductase [uncultured Desulfobacterium sp.]  clstr ali  19  411.TTPEGTVQCKFWGLGSDGTVGANKAIKIIGDNTDLFAQGYFAYDSKKSGGITVSHLRFGKKPIQSTNLVSSADFIACHKANYVSYDILEGIKQGGTFLLNSPWSLQEMEEHIPKKLKFYNVDAVKIAGAVGLGVMINMIMQTAFFKLANVIPFEKLKDEINKVYGKK-GEKVVKMNTDAVDQTLANLVEI. 614
463 1.000e-70gi|17229403|ref|NP_485951.1| pyruvate flavodoxin dehydrogenase [Nostoc sp. PCC 7120]  clstr ali  21  423..EPDNIVRAIFYGLGADGTVGANKNIKIIGEETNNYAQGYFVYDSKKSGSVTVSHLRFGSQPIRSTYLIIQASFVACHQWDFLEKPILKDIVQGGTLLLNSPYDQDEVWERLPKQLKVYVINAYKVAREAGMAGRINTVMQVCFFALSNVLPREEIKKSIRKTYGKK-GDQIVQMNIKAVDTTLDNLYE.. 624
464 2.000e-70METAHIT V1 GL0121424 [Complete] locus=scaffold21908_2:36:3551:-  ali  23  414.....GEISCKIWGLGGDGTVGANKNISTIGLVANKYVQAYFSYDSMKSGGLTQSHLRFGDKPIRSTYLVSSADFVACHASTYVEKYLTEDLKDGGIFLLNCPWSIADLERRLPKHVQFYIIDAAKLAKEIGLGKHTNNILQSAFFALTKVIPMDVAVADMKKTYFKKSGQKIVDLNNKAIDVGVHAAIKV. 614
465 2.000e-70gi|163816675|ref|ZP_02208038.1| hypothetical protein COPEUT_02865 [Coprococcus eutactus ATCC 27759]  clstr ali  44  15....KDTIEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISSEPIRVHSNIYEPQYVVVVDESLIEVHVTAGLAEDGAIIINTPKTPDEVRPLLKYKGRVYTLDAKEISLKTLGKNFPNSPMLAAIVAVSGIMEEGPFLEDMRQSYQHKFKPEVIEGNMEALKLAFREVMK.. 204
466 2.000e-70gi|153003113|ref|YP_001377438.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Anaeromyxobacter sp. Fw109-5]  clstr ali  20  420.TEPADVVRALFYGLGADGTVGANKNIKIIGEDTPNFAQGYFVYDSKKSGSVTISHLRFGPRPIRSAYLISNANFVACHQFGFLEKYMVEQAVPGSTFLLNSPYGPDEVWQHLPKKLKLYVIDAYKVARETGMGVRINTIMQTCFFAISGVLPKDEIKKTIEKTYARK-GPEVVQKNFAAVDHTLAHLFEV. 623
467 2.000e-70gi|28212107|ref|NP_783051.1| pyruvate synthase subunit porC [Clostridium tetani E88]  clstr ali  47  1..MDKKLMEIRWHGRGGQGAKTASLLLAEAAFNAGMYIQGFPEYGPERMGAPITAYNRISNFPLRVHSNIYEPDYVVVVDETLLKTGVTKGLKKEGGIIVNTKKTPNEIRKELDYEGKVYTINARKISEEALGAYFPNTPMLGAIVRVTNIIDIDKFIGDMEGSFKHKFKPHFIPKNMEALKRGIQEVNGIE 194
468 2.000e-70gi|302344622|ref|YP_003809151.1| pyruvate/ketoisovalerate oxidoreductase, subunit gamma [Desulfarculus baarsii DSM 2075]  clstr ali  49  1......MIEVRFHGRGGQGAVTSAELMAQAAIAEGKYAQAFPSFGPERRGAPLQAFLRISDEQIRLREKIYEPDVVVVLDPSLLATNVNAGLKPDGVLVVNSAKNVEAVRGECQFNGRTAIVDASKIAEEELGVPITNTTMLGALLKAAGHVDL----KAIEKPLAARFG-RIAEKNLRALKRAYEE..... 177
469 2.000e-70gi|358068464|ref|ZP_09154926.1| pyruvate:ferredoxin oxidoreductase [Johnsonella ignava ATCC 51276]  clstr ali  21  412....ESIVNCKFWGLGSDGTVGANKNIKIIGDHTDLYAQAYFEYDTKKSGGLTRSHLRFGKKPIIGSYLITKADFVACHNQSYINYDIVEELKPEGTFLLNCTWDRQQLEDRLDNKIKFYTINAIDICKEIGLGNRTNGVLQAAFFALSNIIPMDDMKQAIVKTYGKK-GDKVIAMNNEAVELGAKKFVKI. 612
470 2.000e-70gi|302390657|ref|YP_003826478.1| pyruvate ferredoxin oxidoreductase subunit gamma [Thermosediminibacter oceani DSM 16646]  clstr ali  52  1...MAKVMEIRWHARGGQGAKTAALMLAESVAAMGKYVQGFPEYGPERMGAPMLAFNRISDEPIYIHSNVINPNVVIVLDPTLIGKAITEGVPEDGIYIINTTKTPAEVREMLDKGGKIYTLDANQISLDTIGRAIPNTPMMGAFIRATGIIPFDQFMSHIKELLSKKFKPEVVEGNLKAIERAYREVKE.. 191
471 2.000e-70JCVI_PEP_1096698961205 /source_dna_id=JCVI_ORF_1096698961204 /offset=0 /translation_table=11 /length=1016 /full_length=1016  ali  23  250....ESVIRAVFYGLGSDGTVGANKNVKIIGEETENYAQGYFVYDSKKSGAVTISHLRFGPEVIRAPYLIRNASFVGCHQAQFLDQYVLESAAPGGVFLLNSIYGREQVWAHLPKELRFYVIDAYKVAREAGMGGRINTIMQTCFFAISGVLPKDEIKEAIEKTYGKK-GPEIVQKNFAAVDQTLAALEQVE 451
472 2.000e-70METAHIT MH0071 GL0073463 [Lack 3`-end] locus=scaffold29820_1:1:2598:-  ali  23  406..VAADYTSCLFYGLGSDGTVSANKNIKIIGDNTDLYAQAYFAYDSKKAGGATRSHLRFGKKPIHSTYYIEHADLISCSLDSYVFKYMLKSLKKGGTFLLNTTFTPEELEQNLPKKAKFYIIDATSIAHKIGMGRRTNTILQSAFFKLANIMPYDQMKAAAKKSYGKK-GEEIVKLNYLAIDKG........ 601
473 2.000e-70gi|332800133|ref|YP_004461632.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Tepidanaerobacter acetatoxydans Re1]  clstr ali  52  1..MSEKVLEIRWHGRGGQGAKTAALMLAETVAQMGKYVQGFPEYGPERMGAPILAFNRISDEPIHIHSNVINPDIVIVLDATLLGEKVTAGVPEDGIYIVNTTKTPQEVRKKLNKGGKIFTVDANQISLDTIGRVIPNTPLMGAFVKATGLMSYDEFIENVKGELEKKFKPEVIAGNIKAIERAYQEVK... 190
474 2.000e-70gi|336477924|ref|YP_004617065.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanosalsum zhilinae DSM 4017]  clstr ali  39  1......MKEIRIHGRGGQGSVTAAELLAVAAFADGKYSQAFPAFGVERRGAPVQAFTRLSDRPIRLRSQVYQPDYVIVQDPTLIEVDVANGIKDNGTIIINSEFEPEQFSFS--TGAKVMTVDATRIALDVIGRPIVNTILLGAFAAATGEIQPGSIADAVKQRFSGKIG----EKNAEAIDRAYNMTMEAK 181
475 2.000e-70METAHIT unmapped GL0311727 unmapped_[Complete]_[mRNA]_locus=scaffold179434_2:266:844:+  ali  43  1...MKNGIEIRWHGRGGQGAKTAALLLADVAFKTGKHVQGFPEYGPERMGAPITAYNRISSDVIRVHSNIYDPDFVAVVDETLLHVDVTAGLKKEGAIIVNTAKSKEEIMPQLGYEGRVVTIDARTISEEALGKYFPNSPMLAAVVATTGVMPKETFLHEMRASYKHKFKPEVIDGNMKALEMAFAAVEEA. 192
476 2.000e-70gi|218960661|ref|YP_001740436.1| putative pyruvate-ferredoxin oxidoreductase (por-like) or pyruvate-flavodoxin oxidoreductase (ydbK-like), 4Fe-4S dom  clstr ali  20  411.TVPEGTISCKFWGLGSDGTVGANKNIKIIGDHTDMYVQGYFQYDSKKSGGITRSHLRFGKTPIHSQYLVAQEDFVACHNQAFIGRDLLGGIKENGVFLLNSNWSRDEALYNLNKKIKFYNIDGLKIAEEVGLGGRINTTMQTAFFLISGVLERNEIKDSIRKTYARK-GEKVVQMNLEAVDKVNEALVQIE 615
477 3.000e-70gi|325958248|ref|YP_004289714.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Methanobacterium sp. AL-21]  clstr ali  44  1......MIEVRFHGRGGQGAVTAAEILAKAAFEDGKYCQAFPFFGVERRGAPVMAFTRIDDKPIRRRYQVYNPDYVVVLDDGLLEVDVFSGIKEGGNVIINTNNGVE-----NSNGVKINKIDATGIALDILGVPIVNTILLGAFAGVTGQVSIESLIKIINETFSG----SVAEKNVKAAKMAYDAAKK.. 176
478 3.000e-70gi|310828377|ref|YP_003960734.1| hypothetical protein [Eubacterium limosum KIST612]  clstr ali  44  1...MKDNLEIRWHGRGGQGAKTAALLLADVAFSTGMYVQGFPEYGPERMGAPITAYNRLSQSKIRVHSNIYEPDYVVVVDETLLEVDVTKGVSPEGAVIINTSKDKSEIIKHLKYTGRVFTIDARKVSIEALGKYFPNTPMLASIVKVSGVMENEAFLSEMRHSFEHKFKPEVIEGNMKALSLALQEVK... 190
479 3.000e-70gi|397903829|ref|ZP_10504766.1| 2-oxoglutarate oxidoreductase, gamma subunit [Caloramator australicus RC3]  clstr ali  30  5........EIIFAGFGGQGILSMGKFLAHAGLEENLNVSWFPSYGPEMRGGTSNCSVIVSDEPIGA-PLVTDATAVVVMNRPSLDK-FERYVVKGGLLIMDSDLVNREPE---RTDIEVIKIPAQRIAEEVGSKKIANMVLLGALVEKTKIVSMESLLKALKE----HGKEQFYELNKKALERGAEFAK... 176
480 3.000e-70gi|186684257|ref|YP_001867453.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Nostoc punctiforme PCC 73102]  clstr ali  21  445.TESDNVVRAMFYGLGSDGTVGANKNIKIIGEETDNYAQGYFVYDSKKSGSMTVSHLRFGKEPIRSTYLIDQANFIGCHHWGFLERDILKAAIPGATLLLNSPYNADNVWENLPKHLKLYVINASQVARESGMGGRINTIMQVCFFALAGVLPQEEIKQAIEKTYGKK-GVEVVRMNLQAVDNTLGNLHKV. 648
481 3.000e-70gi|160902063|ref|YP_001567644.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Petrotoga mobilis SJ95]  clstr ali  63  1..MPEKYFEIRWHARAGQGAKSASQFLTEAAEEAGKYSSSFPEYGAERSGAPMKAFNRVADVPIRLKSNIETPDVVVVIDDTLLNSEVTSGLAEDKLLLVNTSRSIEEVRKLSGYKGRIGVIPATEIALEEIKRGIPNTVMIGALIRATDVVPLDAVKEKIKAAFSKKFSDEVVRANIRALERGYQEVKLSE 191
482 3.000e-70METAHIT MH0034 GL0008886 [Lack both end] locus=scaffold5861_12:2:2479:+  ali  19  255..EPDDVVRAVFFGLGADGTVGANKNIKIIAEDAGKYGQGYFVYDSRKSGSMTTSHLRFSDNPIRSAYLITSADFVACHQFQFMNKDILRIAKDGATFLLNAPYKADEVWNHLPKHLKLYTINAVEVARATGMGQRINTVMQTCFFAISNILPKDEIKAAIKKTYSKK-GDAIVQKNYAAVDASLEHLFEV. 457
483 3.000e-70METAHIT V1 GL0028706 [Lack 5`-end] locus=scaffold106782_2:1132:1731:-  ali  44  8....ENLVEIRWHGRGGQGAKTASLLLADAAFNTGKYIQGFPEYGPERMGAPITAYNRISNSPIVIHSNIYEPDYVVVVDDTLLEVDVTAGLKETGAIVINTVKDADYLKKALKYKGGIYCIDARKVSEEALGRYFPNTPMLAAIVKVANIMDEKDFLNDMKGSFKHKFKPEVIEGNMKALEMALNEVKKI. 198
484 4.000e-70gi|167766959|ref|ZP_02439012.1| hypothetical protein CLOSS21_01476 [Clostridium sp. SS2/1]  clstr ali  47  1...MNNGLEIRWHGRGGQGAKTAALLLADVAFKTGKYVQGFPEYGPERMGAPITAYNRISDKVIRVHSNIYTPGLVVVVDETLLHVDVTAGLKEDGAIIVNTPKSADEIKPILGYQGKVYTVDARKISVQALGKYFPNSPMLAAAVAVSGIMKKDAFISEMRASYQHKFKPEVIDGNMQALELTYEELKDV. 192
485 4.000e-70gi|73748520|ref|YP_307759.1| pyruvic-ferredoxin oxidoreductase subunit gamma [Dehalococcoides sp. CBDB1]  clstr ali  43  1...MKHFIEIRWHGRGGQGAVTSAELIAQAAIGKGKYAQAFPSFGPERRGAPVQSFNRISDNPIRERSGINQPDIVVVLDPSLVIINVISGLKDGGTLIINTTKPLEHFASQYGDRWKVATVDATAIAKEVLGVNIVNTTMLGALIKATGLADMEAFEEPLKHRFGK-----LAAKNMAAMKKAFEEVKELK 188
486 4.000e-70gi|193214460|ref|YP_001995659.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Chloroherpeton thalassium ATCC 35110]  clstr ali  21  420..EPNHVVRAMFYGLGSDGTVGANKNIKIIGENTDNYAQGYFVYDSKKAGSMTVSHLRFGPKPIRSTYLISRANFIGCHQWLFLQTDILKNLVEGGTLLVNSHHATEEVWEHLPKKAKLYVIDGYKVAGESGMGRRINTVMQVCFFAISGVLPREEIKDSIRATYGKK-GEEIVRMNINAVDNALSHLHEVK 623
487 4.000e-70gi|404492641|ref|YP_006716747.1| pyruvate:ferredoxin/flavodoxin oxidoreductase [Pelobacter carbinolicus DSM 2380]  clstr ali  25  417....SGIYSAMFYGLASDGTVGANKNIKIIGDLTDNHVQAYFVYDSKKAGTITTSHLRFGKTPLRSPYLVSNADFVACHNFTFLEKDMLSKAKPGAMFLLNSLFDKDTVWEQIPKNLRLFVINAVDIAEKIGLGGRINVIMQTAFFKITGILPLDAIKDAIRKTYG-KAGEKVVDMNCRAADAALNDIAEV. 617
488 4.000e-70METAHIT O2 GL0068735 [Complete] locus=scaffold8164_11:13707:17246:-  ali  18  413.TTPSGTTSCKFWGLGSDGTVGANKSIKIIGDNTDMYAQGYFFYDSKKSGGITVSHLRFGVNPITSSYLINKANFVACHCPSYVTKYMVQDLVPGGTFLLNCIWSPEELDKELPNDINFYIINGIKIAEEVGLRGRASTILQSAFFTISGILPVDQAIELMKAKATAKFGDAVVAANHQGIDRGSKELIKVE 617
489 5.000e-70gi|116626038|ref|YP_828194.1| pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein [Candidatus Solibacter usitatus Ellin6076]  clstr ali  17  418.TETPGTVRALFYGLGADGTVGANKNIKIIGEETDNFAQGYFVYDSKKSGSITTSHLRFGPKPIRSSYLITKANFVACHQFSFLERDMLKAAEQGATFLLNSPFGQDEVWDKLPKKLKFYVINGDQVAKDTGMGGRINTIMQTCFFAISGVLPREEAIAAIKKTYGKR-GESVVKKNYAAVDAALSHLYEV. 621
490 5.000e-70gi|332295340|ref|YP_004437263.1| pyruvate/ketoisovalerate oxidoreductase subunit gamma [Thermodesulfobium narugense DSM 14796]  clstr ali  51  1...MKSYWEIRWHARGGQGAWTASQFLASAALSVNKYFQSFPEFGAEREGAPIVAYTKISDMPIKNYSQIEEPDAVVVLDPTLFSVNFLNGLKSDGYLIVNYPGDPKQLREELPPGIKVFTVDATKIALETLKRPITNTTMAGALVKATGILNFEDVVNEMIRSFSGKFKQEIIDANVNAIRRAYEEVKQ.. 190
491 5.000e-70METAHIT MH0038 GL0015286 [Complete] locus=scaffold3532_1:274:3852:-  ali  18  418.TEPKDVVRAVFYGLGADGTVGANKNIKIIAEDAGKYGQGYFVYDSRKSGSMTTSHLRFSDNPIKSAYLINKADFVACHQFPFMNKDILKIANPGAASVLNAPYAAEEVWNHLPKKLNFYSINAVEVARETGMGQRINTVMQTCFFAISNILPKDEIKNAIKKTYSKK-GDAIVQKNFAAVDASLAHLHKVE 622
492 6.000e-70gi|51246738|ref|YP_066622.1| pyruvate-flavodoxin oxidoreductase [Desulfotalea psychrophila LSv54]  clstr ali  21  420....DDVYRAMFYGLGSDGTVGANKNIKIIGTETDNYAQGYFVYDSKKSGSITTSHLRFGKNPITAPYLIEKANFIACHNPTFLEYDMVGNLADGGIFLLTTGHSKDEIWNHLPKNAKFFIIDAVSLGQELGLGARINMIMQTAFFLISGILEKDEIKKAIYKTYGKK-GDKVVQMNYDAVDGAVENIVEV. 620
493 6.000e-70gi|298530074|ref|ZP_07017476.1| pyruvate/ketoisovalerate oxidoreductase, gamma subunit [Desulfonatronospira thiodismutans ASO3-1]  clstr ali  43  1......MWEIRLHGRGGQGAVTSAELLARAAISREKFAQAFPSFGPERRGAPVQAFVRVDDKKIRKREKIYQPDMVLVLDPSLLDVNVAEGLKEDGIVVVNSPQDSAELKQKHNWPG-AYTVDATKIAMDILSVPITNTTMLGALLKASGILEPQDMEEVIMDRFGPKLG----PKNFEALKKAYELA.... 178
494 6.000e-70gi|386002895|ref|YP_005921194.1| Pyruvate:ferredoxin oxidoreductase subunit C [Methanosaeta harundinacea 6Ac]  clstr ali  43  43.......KEIRFHGRGGQGAVTAAELIAIAAFEDKKYSQAFPAFGVERRGAPVMAFARIASEPIRIRSQIYEPDYVIVQDVTLLEVDVASGLKPEGKIIINTDRDPKDLK--LKTGAEVVTIDATRIALEKLGRPIVNTTMLGAFCGATGEVSLESVNKAILSRFSGSLG----EKNLAAIKTAYEGV.... 218