current user: public

anford Burnham Prebys Medical Discovery Institute

Query: TM0002 TM0002 281883 Purified-2001-08-29, from T.maritima

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
1 -4.320PF17196.2; Q82NZ0_STRAW/1-65; Protein of unknown function (DUF5133 topsan)  ali follow..  16  36...DDAAYTLCVSTGTKDVEAALVAARRRLPLA........ 65
2 -4.180PF03004.12; Q9M9D8_ARATH/153-297; Plant transposase (Ptta/En/Spm family)  ali follow..  2..AAHWRVMVAYWRTPIAKERSEKARSSRLFNR........ 32
3 -3.940PF11034.6; G3JKJ7_CORMM/1-67; Glucose-repressible protein Grg1  ali follow..  36  22.............TSKEANKEVAKDSNANVGTRLS...... 43
4 -3.920PF13999.4; A8AGS3_CITK8/1-63; MarB protein  ali follow..  20  4........VLLVVSGQSIAEQTAQPGTQNDRDAMVMP.... 32
5 -3.900PF11081.6; SF33K_ADE02/1-225; Protein of unknown function (DUF2890 topsan)  ali follow..  34  190.SLRSLTRSCLYHKSEDQLRRTLEDAEA---------FSKY 221
6 -3.690PF00861.20; RL18_BACSU/5-120; Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast  ali follow..  32  26.......RLNVFRSNKHIYAQIIDDVNGVTLASAS...... 53
7 -3.680PF00181.21; RL2_ONYPE/42-118; Ribosomal Proteins L2, RNA binding domain  ali follow..  26  22.......RLIDFKRNKDNIVGKVATIEYDPNRSANIALIHY 55
8 -3.630PF10126.7; F4BUV1_METCG/1-107; Uncharacterized protein, homolog of nitrogen regulatory protein PII  ali follow..  20  37MAPTNWKSFQLSEDPDMALKAIRDHSEPGVMVNTVVGPDK. 76
9 -3.610PF00786.26; B4GET1_DROPE/83-138; P21-Rho-binding domain  ali follow..  29  26..PEAWARLL---MNSNISKQEQKKNPQAVLDVLKW..... 56
10 -3.610PF00106.23; YOXD_BACSU/7-201; short chain dehydrogenase  ali follow..  22  96LSADEWENIIVYHVTRAVLPEMIERKAGDIINISST..... 137

FFAS is supported by the NIH grant R01-GM087218-01
9 4 3 3 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.