current user: public


Query: TM0002 TM0002 281883 Purified-2001-08-29, from T.maritima

Results of FFAS03 search in PfamA26U
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst MSPEDWKRLICFHTSKEVLKQTLDDAQQNISDSVSIPLRKYLast
1 -5.760PF03004.9; Q9M9D8_ARATH/153-297; Plant transposase (Ptta/En/Spm family)  ali follow..  3  2..AAHWRVMVAYWRTPIAKERSEKARSSRLFNR........ 32
2 -4.620PF04369.8; LCNB_LACLC/1-60; Lactococcin-like family  ali follow..  36  39............RTGKTICKQTIDTASYTFG.......... 57
3 -4.480PF10414.4; A7C194_9GAMM/4-62; Sirohaem synthase dimerisation region  ali follow..  13  30.....WETILQGPIAEMLLSGHTQAATKALEDLLE...... 59
4 -4.240PF13999.1; D3RFX7_KLEVT/5-70; MarB protein  ali follow..  27  7........LLSLVSSLSYAEQNTTPVRQNQRDTMIIP.... 35
5 -4.100PF11034.3; Q0CDP7_ASPTN/1-68; Protein of unknown function (DUF2823 topsan)  ali follow..  40  22.............ASKEANKQVAKDSDASISTRAS...... 43
6 -4.040PF12944.2; Q5UDS9_9PICO/1-104; Protein of unknown function (DUF3840 topsan)  ali follow..  50  73................EVGKQRLKYAQEELSNEVLPPPRK. 96
7 -4.010PF09098.5; Q8VUT0_PARDE/120-187; Quinohemoprotein amine dehydrogenase A, alpha subunit, haem binding  ali follow..  53  19.TPEDWKHLVNFHLGQ......................... 33
8 -3.910PF03472.10; A5ES50_BRASB/22-165; Autoinducer binding domain  ali follow..  10  69LNPFAWSEAPYDRNDEPGAHEVMTRARDRLNEGFCVPIH.. 108
9 -3.880PF11298.3; A5CRR6_CLAM3/7-78; Protein of unknown function (DUF3099 topsan)  ali follow..  10  1.....................SVTSLPRSPQEDRHARMVKY 20
10 -3.870PF07119.7; Q3KJ40_PSEPF/18-106; Protein of unknown function (DUF1375 topsan)  ali follow..  25  70.....................LLDLTLSGVFDTAFLPYTIY 89
FFAS is supported by the NIH grant R01-GM087218-01
4 7 2 3 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
 Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.