current user: public

anford Burnham Prebys Medical Discovery Institute

Query: TM0020 TM0020 281901 Purified-2001-08-24, from T.maritima

Results of FFAS03 search in COG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
3 -8.180[T] KOG4293 Predicted membrane protein, contains DoH and Cytochrome b-561/ferric reductase transmembrane domains  ali follow..  11  216MNMFGWGILIIVGAI--VARHMKQWDPTWFYAHIALQTTGFLLGLTG-VICGLVLENRLKANNVSKHKGLGITILVMGVLQMLALLARPDKQSKYRKYWNWYHHNILLIILAISNIFYGIHLAKA.. 339
4 -7.990[S] KOG4147 Uncharacterized conserved protein  ali follow..  18  6......................................VTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVF---NLPPPFRNYKYDALKIIHQAHKSKTNELVLSL.................. 82
7 -7.440[A] KOG4676 Splicing factor, arginine/serine-rich  ali follow..  14  9....STAGPGPSGGPGGGGGGGGGGGGTE----------VIQVTNVSPSA-------------SSEQMRTLF--GFLGKIDELRLFPPDDSPLPVSSRVCFVKFHDPD--AVVAQHLTNTVFVDRAL 105

FFAS is supported by the NIH grant R01-GM087218-01
9 5 7 5 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Dunbrack RL Jr, Dunker K, Godzik A. Protein structure prediction in biology and medicine. Pac Symp Biocomput. 2000;(12):93-4.