current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2fyia1 c.94.1.1 (A:88-307) LysR-type regulatory protein Cbl {Escherichia coli [TaxId: 562]}, from SCOP206

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# E-value Template Links and tools%idFirst TNDTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPHDHPLTQISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKRQVMESLast
1 0.000e+00gi|504519078|ref|WP_014706180.1| CysB family transcriptional regulator [Methylophaga nitratireducenticrescens]  clstr ali  39  89.HEKKGTLSIGTTHTQARYALPKAIKAFSEQYPDVHLNIVQGTPPGVAEMVATGKVDLAIATEGLSKFDNLAILPCYEWNRTVITPPGHPLLKEKKLTLEAISRYPILTYVMGFTGRAQQDQSFIERGLKPNVIFTATDADVIKTYVELGLGIGIIASMAFDPHKDAPLQAMDASDLFKPSTTHMGIRKGSYLRGYSYAFIELFAPHLQRSTIQKAIA.. 305
2 0.000e+00gi|551358435|ref|WP_022977788.1| CysB family transcriptional regulator [Nevskia ramosa]  clstr ali  45  91...DKGELSIATTHTQARYALPPVIQRFRERYPHVTLHLHQGSPPQIAKMAVDGSADFAIATEALELFDELVMLPCYHWNRSVLVAPAHPLALRYRMTLEAIAEHPVITYTFGFTGRSKLDQAFSARGLKPDVVLTAVDADVIKTYVRLGLGVGIVASMAYDPIIDHDLVHLPADHLFERSTTHIGFRQGMFLRGYMADFITEFAPQLSREMVDEV.... 308
3 0.000e+00gi|1000288296|gb|KXK49743.1| transcriptional regulator CysB-like protein [Nitrosomonas europaea]  clstr ali  48  88SQHDQGELTIATTHTQAQYALPDVVRQFKKIFPKVHLVLHESSPGEIVSMLLNDQADIGIATEALESTSELVSFPYYTWHHAVIVPAGHPLQSVHPLTLEAVAQFPIITYHKGFTGRSRIDQAFSRAELIPNIAMSALDADVIKTYVALGMGIGIVASVAFTPERDTKLIKLDGSHLFEQNTTCISIRRNHYLRGYAYRFIELCIPSLSRDTICSEIQQN 307
4 0.000e+00gi|497351127|ref|WP_009665340.1| Regulatory protein CysB [Oxalobacteraceae bacterium IMCC9480]  clstr ali  44  88AAHDSGSFTIATTHTQARYALPKVVQAFTQRFPKVRLSLLQGNPKQVADLVLSGHADIALATESITTVAGLVSIPCYQWEHVVVVPPEHPLLKSKSLTLDEIAAYPLITYDSAFTGRAKIDHAFQLRNLKPDVLLEAIDADVIKTYVELGLGVGIIAGMAYDADRDKNLRMISAGHLFGTNVSRVALKQGAYLRSYVYTFIELLTPTLNRKLIEQVM... 304
5 0.000e+00gi|518403458|ref|WP_019573665.1| CysB family transcriptional regulator [Curvibacter lanceolatus]  clstr ali  47  90..QQNGQLSIAATHSQARYALPAAVQEFRQQFPNVKLNLHQGSPRQVAEMLLSGEADVGIATEALAQYEALVALPCYRWTHSVLVPPGHPLLD-APLTLERLAAWPLITYDNGFTGRTHIDEAFTQRKLNPHIVLSAMDADVIKTYVELGMGAGIVASIAYEAERDTGLRAIDAGHLFGINLTRLAVRRGSYLRGYVYAFIESFAPTLNRAIVEKALQD. 305
6 0.000e+00gi|497208942|ref|WP_009523204.1| CysB family transcriptional regulator [Ralstonia sp. PBA]  clstr ali  41  88AAQDQGNLVIATTHTQARYALPSVIAEFTKKYPKVRLSIQQGNPAQIADMVVRDQADLAIATEGIVHLKDLITLPSYQWQHVVVTPPGHPLLEKKHVTLEDLAAYPIITYDAHFAGRPKIDKAFALRQLQPDIVLEAIDADVIKTYVEVGMGIGIVAGVAFDAARDQNLRSVPVGHLFGTNVTHLAIKQGAYLRSFVYTFIELFSPTLNRKLIEQLMA.. 305
7 0.000e+00gi|935507071|ref|WP_054427604.1| transcriptional regulator [Achromobacter sp.]  clstr ali  45  88ADSRKGVLSIAATHSQARYALPPVIKEFRQRYPDVVLHLHQGSPKQVSEMLLEGEADIGVATEAVADYPGLVNLPCYRWSHSIIVPRGHPLEHQDGISLSQLSRYPIITYGRGYTGRAHIDEAFARAGITPDIVMTAMDADVIKTYVELELGVGIVAAVAWDAERDTRLCAIDARHLFEINLTRLAIRRGAWLRGYAFHFIEMFVPTLTREVVDREL... 305
8 0.000e+00gi|544831687|ref|WP_021247512.1| CysB family transcriptional regulator [Thauera terpenica]  clstr ali  42  88ANESVGELSIATTHTQARYVLPQVIRDFMRRYPQVRLSLHQGNPRQVCEMVLDGTADIAIATEAIADYDELLMLPCYQWNRCVVATPRHPILRASPLTLEAIARYPLITYDDAFTGRGLINKAFLGRGLKPNVVLSAIDSDVIKKYVEMDLGIGILARMAYDPAEDRRLGMVDASHLFESSTTRIGLRKRSWLRAYVYAFIEGFAPHLSRPMVEMALA.. 305
9 0.000e+00gi|497413027|ref|WP_009727225.1| LysR family transcriptional regulator [Methylophaga lonarensis]  clstr ali  47  88SQRDTGTLTLATTHTQARYVLPQVITPFKLRYPKVHLKLHQGSPDEIVEMLVDGRADIGIATEALGDIPELASFPYYSWHHAVIVPVDHPLSKLDKLTLADLAAWPIVTYHEGFTGRASIDRAFTHAGIEPDVVMSALDADVIKSYVELGLGIGIVAAMAFNAERDNQLQRIDTAHLFDANQTKIAVRRGHYLRQFAYDLINLCAPELDIEQMRREVA.. 305
10 0.000e+00gi|288566471|gb|EFC88031.1| transcriptional regulator CysB-like protein [Neisseria mucosa ATCC 25996]  clstr ali  41  109TEHDSGSLVVATTHTQARYALPLIVAEFVKRYPKVTLTIKQGSPAAIAQMVSNGEADIAIVTERIDEHPELGKLTCYEWNHAVIVPHEHPLLDKNPLSIEDLASFPLITYEFAFNQGSSIARAFNKARLEPDVVLSAADTDVLKTYVRLGLGVGLMAKMAYDPENDTDLELVDASHLFESSPTWIAVRKDTYLRGYAYDFIELFAPKLTREMVDRTLYA. 329
11 0.000e+00gi|495337030|ref|WP_008061766.1| CysB family transcriptional regulator [Methyloversatilis universalis]  clstr ali  42  91...EQGRLSIATTHTQARYVLPHVLSEFMRAHPGVQIELHQGNPTQCCEYVLSGAADLVIATEAIDEYDLLVSLPCYQWNRCLIAPPGHPLLDVKPLTLEAIADWPLITYDFAFTGGSRVNQTFAERGLTPRVAMSAIDADIIKTYVALGLGVGIVAQMAFDAEQDRGLRAIDCSHLFEPSTTRIGLHRNGWLRGYTYTFIQAFAASLTRETVDRALGRA 307
12 0.000e+00gi|494246807|ref|WP_007146052.1| CysB family transcriptional regulator [Methylophaga aminisulfidivorans]  clstr ali  39  90..EQSGTLSIGTTHTQARYALPSAIKKFSEHYPNIHLNMVQGTPTEVGEMAATGKIDLAIATEGLAQFESLAILPCYEWNRCVVVPPEHPLLSVKKLCLEDIAQYEILTYVMGFTGRAKQDQAFIEKGLHPNVIFTATDADVIKTYVELEMGIGIIASMAFDPDKDAPLQALDARHLFPPSVTHMGIRKGSYLRSYMYAFIEFFAAHLDKKTVEKAI... 304
13 0.000e+00gi|737045131|ref|WP_035040341.1| transcriptional regulator [Aquabacterium sp. NJ1]  clstr ali  49  93.....GPLSIAATHSQARYALPSAVKDFREMFPQVTLSLHQGSPQQVASMLINGEADIGIATESLTQYPQLVTLPCYTWSHAVVVPPNHPLLHGEALTLQRLAQFPLITYDEGYTGRSHIDDAFKREGIKPSIVLTAMDADVIKTYVELGMGVGIVAAIAFDEDRDLNLRGLGAGHLFAVNMTRLAFRKGAFLRNYVYSFIETFAPPLTRKVVEMAAGA. 306
14 0.000e+00gi|503058887|ref|WP_013293863.1| CysB family transcriptional regulator [Gallionella capsiferriformans]  clstr ali  46  88SQRDEGQLTVVATHTQARYALPKVITDFKKTYPKVHLKLHQASPNEIVTMLLSGEADIGMATEALADVTKLDSFPFYTWHHAVIVPVGHPLEQVKPLTLQALAEYPIVTYHEGLTGRAKIDQAFLDAGVTPDISMSALDSDVIKTYVELGLGIGIIASMAFNPAKDSDLRLLQCEHLFGVNTTYIALRRGHYLRSFAYRFIELCSPKLDEAVIRAGISPS 307
15 0.000e+00gi|498081843|ref|WP_010395999.1| CysB family transcriptional regulator [Janthinobacterium lividum]  clstr ali  43  88AAQDSGSFTIATTHTQARYTLPKVVQAFMLKFPKVRLSLLQGNPRQIAEMVQRDQADLAIATESIAAIDGLITLPCYQWEHVVVVPLDHPLLKSKSVTLEEIAAFPLITYDSAFAGRNKIDHAFVLRGLKPDVLLEAIDADVIKTYVELGMGIGIIAGMAFDAERDKGLRAIPVGHLFGMNVSRVAVKQGAYLRSYIYTFIELLTPTLNRKLIEQAM... 304
16 0.000e+00gi|948006112|ref|WP_056665570.1| transcriptional regulator [Pseudorhodoferax sp. Leaf265]  clstr ali  47  90..QQSGSLSIAATHTQARYALPTAVQEFRLQFPNVRLHLHQGSPRQVAEMLLSGEADIGIATEALAQYADLVALPCYRWTHSIIVPPNHPLLD-GPLSLEKLARYPLITYGAGFTGRGHIDQAFAKHRIEPRIVLSAMDADVIKTYVELGMGVGIVASIAFEAERDTQLRAIDAGALFGINLTKLALRRGSYLRAYVYALIESFAPTLQRSVVDQAMLA. 305
17 0.000e+00JCVI_PEP_1096676775917 /source_dna_id=JCVI_ORF_1096676775916 /offset=0 /translation_table=11 /length=332 /full_length=332  ali  46  90..EKTGTLTIATTHTQARYSLPKVVTEFKRRYPGVHLHLQQGSPPQLAQMIINGEADIAIATESLDRFPALLALPAYSWSHCVVVPRMHELARKTAVTLEDLEAYPIVTYDPTFTGRSRIDQAFAAKGLQPEIALSAIDSDVIKSYVELGLGIGIIASMAYDPERDRELVRVEAGHLFHSSTTRVAIKRGAYLRGFAYAFIEMFSPPLSRSAIEQ..... 302
18 0.000e+00gi|971094123|emb|CRI65361.1| HTH-type transcriptional regulator CysB [Thiocapsa sp. KS1]  clstr ali  42  88SDETAGRLAIATTHTQARYVLPEAIRRFIEEYPGVRLSLHQGTPRQICEMVLAGDADLAIATEAIADYDTLLMLPCYQWNRCIVAPLGHPILDAPALTLEQLARWPIVTYDSAFTGRGQINRAFLARGLEPRVVLSASDADVIKTYVRMGLGIGILAHMAYDASLDTGLGMLDAAHLFDSSTTRIGIRKNAWLRGYVYAFIEGFAPHLTRAVVERTLA.. 305
19 0.000e+00gi|517434681|ref|WP_018605584.1| hypothetical protein [Uliginosibacterium gangwonense]  clstr ali  47  88TQRDQGQLTVVTTHTQARYALPQVVTQFKQEYPKVHLALHQGSPQEIVQQLLSGDADIGIATESLAGETELVTFPYYDWHHAVLVPAGHPLLDLPSLTIEALAEYPLITYHAGFTGRAKIDKAFSTAGLSPDIVMSALDADVIKSYVELGLGIGIIAPGAFNPEKDQDLRLIDASHIFSRNTTLIAVRRGHYLRGYAYRFIELCAKELTETNVRAAIAP. 306
20 0.000e+00JGI.Meta 7000054717 SRS022530_LANL_scaffold_7906__gene_22955 sulfur assimilation transcriptional regulator, lysR family [Human Tongue dorsum  ali  40  75TDHDSGSLTIATTHTQARYALPKIVAEFVKNYPKVNLTIKQGSPSAIAQMVSSGEADLAIITEQIDDHPELGKLPCYEWNHAVIVPHDHPLLDRNPLSLEDLASFPLVTYEFAFNSGSSIARTFNKAHIEPDVALSAADTDVLKTYVRLGLGVGLMAKMAYDPAVDQDLQLIDAAHLFEPSPTWIALRTDTYLRGYAYDFIQMFAPKLTR.......... 286
21 0.000e+00JCVI_PEP_1096676809037 /source_dna_id=JCVI_ORF_1096676809036 /offset=0 /translation_table=11 /length=310 /full_length=310  ali  47  88ASTHAGPLSIAATHSQARYALPSAVRDFRQLYPAVTLNLHQGSPRHIAEMLLSGEADIGIATEALTQYEELVTLPCYRWTHSVVMRPDHPLADGQALTLERLSRFPLITYDAGYTGRSHIDNAFEQAGLVPSIVLSAMDADVIKTYVDLGLGVGIVASIAYDDQRDQHLTAIDAGHLFAVNTTRLAFKRGRFLRSYVYAFIEAFAPPLTRAVVQQAIDQA 307
22 0.000e+00gi|500088156|ref|WP_011764169.1| CysB family transcriptional regulator [Azoarcus sp. BH72]  clstr ali  42  88SNEAAGGLSIATTHTQARYALPPVVREFMRRYPQVKLSLHQGSPHQVCEMVLDGSADIAIATEAIAEYDELVMLPCHQWNRCVVASPRHPILREQPLTLEAIARYPLITYDDAFTGRSQINKAFLGRGLKPNVVLTALDSDVIKTYVAMDLGIGILARMAYDPEEDRKLGMIDAAHLFESSTTRIGLRRRAWLRGYVYAFVELFAPHLTRRMVETALA.. 305
23 0.000e+00gi|654995199|ref|WP_028444444.1| CysB family transcriptional regulator [Chitinimonas koreensis]  clstr ali  41  89.NEQEGSLVVATTHTQARYALPPTIHDFMTRYPGVKLSIKQGSPTQICEFVLDGSADIAIATEGIDQFPELAMLDCYAWNRSIIVPDNHPLLDKGRLRIEDVAKYPIITYDFAFTGRSKINRSFEEAGLTPNVVLTAIDTDVIKTYVGLGLGIGIVASMAFDVQRDVGLFAIDASHLFEPSTTHIGIRRDAYLRGYTYAFIERFAPHLSRPIVERALN.. 306
24 0.000e+00gi|751629299|ref|WP_041097108.1| CysB family transcriptional regulator [Sulfuritalea hydrogenivorans]  clstr ali  45  88AAESSGTLSIATTHTQARYTLPPVIQRFVRRHPAIRLHIQQGSPLQVAEWVMDGSVDLGIATEALDRYPDLVTLPCFQWAHKVVTPRDHPLLAMQPLTLAALAGYPLITYDATFTGRSRIDRAFERQNLRPNVMLTAIDSDVIKTYVALGLGVGIIAEMAFDPARDEALAAMPVSHLFEGNTTRVGFRRDIWLRGYEYDFMELLAPQLTRRMVEATL... 304
25 0.000e+00gi|947504134|ref|WP_056168222.1| transcriptional regulator [Acidovorax sp. Leaf78]  clstr ali  47  92....QGRLSVAATHSQARYALPQVVRDFRAMFPQVSLHLHQGSPRQVAEMLMSGEADIGVATEALASYDGLVTLPCYRWTHSIVVPPGHPLLDLGPVTLEQLAEHPIITYELGYTGRAHIDEAFAREGIAPDIVLTAMDADVIKTYVELGMGVGIVASIAVDAERDRHLRLIDAGHLFEVNLTRLGLRRGAWLRGYAYHFIESFVPTLTRDAVEKAVQQS 308
26 0.000e+00gi|502998695|ref|WP_013233671.1| CysB family transcriptional regulator [Herbaspirillum seropedicae]  clstr ali  45  88AGEQSGTLSIATTHTQARYVLPRVVQAFRDAFPQVRIALQQSAPEHIAEWVISGKADIGIATEGLSQFKELVSFPCYTWSHVIVVPKGHPLLGLEQVSLEDLGTWPLITYDVGFTGRGHIDEAFRQAGIEPDIVLTAMDSDVIQQYVSLGMGVGLVASMAVDQGKHQEMVAINASHLFKANIARLAVRRGAYLRGYAFDFIQQFAPELKRADIVNALNEA 307
27 0.000e+00gi|505092800|ref|WP_015279902.1| transcriptional regulator [Thioflavicoccus mobilis]  clstr ali  44  88SDKTKGRLAIATTHTQARYTLPTAIQAFIAAYPGVELSLHQGNPSQICEMVLRGEADMAIATEAIADHADLLTLPCYRWNRVVVAPLGHPLLAASRLTLEDLADWPIVTYDAAFAGRSRIDHAFQARGLAPRVVLSAADSDVIKTYVRMGLGLGIVAEMAYDPVQDADLGVLDAAHLFETSVTSIGLRRNAWLRSYVYAFIEGFAPHLTRAVVERTL... 304
28 0.000e+00gi|651963417|ref|WP_026685394.1| transcriptional regulator [Azovibrio restrictus]  clstr ali  47  88ASRETGHFVVATTHTQARYALPRVIKWFKEDYPKVHLTLHQGSPREIAEMLAAGEADVGIATEGLDGNDDLAAFPCYSWRHGVIVPQGHPLQGVEKLTLEAIGDYPIITYHAGFTGRSHIDQAFARAGIVPDVVLSAIDADVIKTYVGLGLGVGLIASMAFDPEQDRGLALLQAEDIFPLNTTRLAVRKGAWLRSYAHAFIEKVSPELSEAVVKEAMRQ. 306
29 0.000e+00gi|1000064374|gb|KXJ41660.1| transcriptional regulator CysB [Methylothermaceae bacteria B42]  clstr ali  43  89.DERKGALSIATTHTQARYALPSVVQKFMASYPEVTLTMHQGTPVQISDLASRGVADIAIATEAMELFENLIMLPCYQWNRCILVPLGHPLIDNQPLTIQDIAAFPLITYVFGFTGRSKLDEAFARENLHPQVALTAVDSDVIKTYVRLGLGVGIVAKMAYDPKTDQDLVALDASHLFGNSITKIGLRRDMFVRGFIFDFIELFAPHLTRSVVEEAI... 304
30 0.000e+00gi|938318204|ref|WP_054622430.1| transcriptional regulator [Rhodocyclaceae bacterium Paddy-1]  clstr ali  47  88ASRETGHFVVATTHTQARYALPQIIKWFKADYPKVHLTLLQGSPREIAEMLVAGEADIGIATEGLNKFPELVTFPCYTWSHAVIVPHGHPLLDLPEITLEALGDYPIITYHEGFTGRAHIDQAFAAAGVVPDIVLSAIDADVIKTYVGLDLGVGIVASMAYDAERDRNLVMIPVPGLFPANTTRLAVRRGAYLRSYAHAFIEKVSPDLGEEVVKSALKQ. 306
31 0.000e+00gi|495132441|ref|WP_007857252.1| CysB family transcriptional regulator [Acidovorax sp. CF316]  clstr ali  47  93.....GRLSIAATHSQARYALPQVVRDFRAMFPQVSLHLHQGSPKQVAEMLLSGEADIGVATEALAHYDALVTLPCYRWTHSIVVPPDHPLLELEPVTLQQLTEYPIITYELGYTGRAHIDEAFAREGLRPDVVLSAMDADVIKTYVELGMGVGIVASIAVDPERDRQLRMLDARHLFEVNVTRLAVRKGTWLRGYAYSFIETFAPTLQREAVEKAVRAT 308
32 0.000e+00gi|653252647|ref|WP_027458053.1| CysB family transcriptional regulator [Dechloromonas agitata]  clstr ali  44  91...DTGRLVLAATHTQARYALPLVVRDFVARHPSVKLEMHQGSPTQIAEWVVSGEADIGIATEAIDQYPQLITLPVRQWTHCVIVPEGHPLLAAQPLSLNELAKWPLITYDTAFTGRSRINRAFERVGVQPNVALTALDADVIKTYVSLGLGLGIISALAVDPQRDAGLVAIDAGHLFESNTTRLAVRRGTYLRRYDYDLIALFAPHLSKRVVEMAMQ.. 305
33 0.000e+00gi|805538158|ref|WP_046113226.1| transcriptional regulator [Aquincola tertiaricarbonis]  clstr ali  46  92....RGTLTIAATHSQARYALPTAVRDFRRSHPDVTLHMHQGSPQQVAQMLLDGSADIGVATEALTQYDELVALPCYRWTHVVITPPGHPLAEGGALTLQSLAAHPLVTYEAGYTGRGHIDEAFARHGLSPQVVLTAMDADVIKTYVELGLGVGIVAAIAYDEDRDRHLTAIDARHLFAANMTRLAVRRGSFLRDYAYAFIETFAAPLGRAVVEQALQSS 307
34 0.000e+00gi|771615467|ref|WP_045226352.1| transcriptional regulator CysB [Methylococcaceae bacterium 73a]  clstr ali  40  93.....GALSIATTHTQARYALPAIVQEFMRRYPGIKLNMHQGTPTQIAELASRGLVDMAIATEGMELFENLVMLPCYEWNRCVLVPRGHPLTLAKELRLEDVAAYPIITYVFGFTGRSQLDQAFEKRRIHPQVALTAVDADVIKTYVRLGLGVGIVARMAYDPVADRDLVPLDAGHLFGRSVTKIGLRRDMFVRGFIFDFIQLFAPHLNRELVEQALA.. 305
35 0.000e+00gi|655159230|ref|WP_028605834.1| transcriptional regulator [Ottowia thiooxydans]  clstr ali  45  93.....GTLSIAATHSQARYALPPVVRDFRARYPGVSLHLHQGSPRQVADMLMSGEADIGVATEALASHAGLLTLSCYRWSHSVVLPVGHPLLETSPLTLQALAEHPIVTYDLGFTGRSHLDDAFQRAGIQPNIVLTAMDADVIKTYVELGMGVGIIAMIAFDAERDRQLRMLDARHLFQLNTTRLGLRRGAWLRGYAYDFIEMFVPTMTRATVEQAMR.. 306
36 0.000e+00gi|494791630|ref|WP_007527038.1| transcriptional regulator CysB [Haemophilus sputorum]  clstr ali  40  88TRPNRGVLRIATPNTQARYVLPAVIEKFKAKYPNVSLHLHQGSPTQIYEALMNGTVDLAITTEAQYLFEETILLPCYTWNRSVIVKPEHPLAQSTDLTVEELSKYDLITYTFGFTGQSDLDKAFNQVGILPNIVFTATDADVIKTYVRLGLGVGIMASMAHTEA-DSDLIAIDASHLFSPSMTQIAFKRSTFLRNYMYDFIQYFSPHLTKMEVEKA.... 306
37 0.000e+00gi|756846772|ref|WP_042655128.1| transcriptional regulator CysB [Actinobacillus pleuropneumoniae]  clstr ali  40  94TRPNRGVLRIATPNTQARYVLPPIIEKFKAKYPEVSLQLHQGSPSQIYDALMAGEVDLAITTEAQHLFEDAILLPCYLWNRSVIVKPDHPLVQSENLTVEELGKYDLITYTFGFTGQSDLDHAFNKEGILPHIVFTATDADVIKTYVRLGLGVGIMASMAHTPA-DSDLVAIDASHLFQSSMTQIAFKRGTFLRNYMYDFINYFSPHLTKMQVEKA.... 312
38 0.000e+00gi|947679290|ref|WP_056341842.1| transcriptional regulator [Massilia sp. Leaf139]  clstr ali  46  88SAQDSGTLTIAVTHTQARYALPQVVQSFRNAFPNVRVALQQSAPEHIAEYVLSGRADIGIATEGLSTFPDLVSFPCYRWSHVVVAPDGHPLLSKTPLRLEDLAEYPLITYDVGYTGRRHIDDAFSTAGLAPDMVLTAMDSDVIKQYVSLGMGVGIIASMAFDHGRDRGLRAIESSHLFAPNVTRLAVRRGAYLRAYAYHFIERFAPGFTRADIEKSLQA. 306
39 0.000e+00JCVI_PEP_1096671249407 /source_dna_id=JCVI_ORF_1096671249406 /offset=0 /translation_table=11 /length=244 /full_length=244  ali  40  7SSQKEGRLSIATTNTQAKYALPQVVKEFREMYPDVTLQMQQGSPEQIAALAASGDVDFAITTEGLELFNDLIMMPCYKWNRSVVVPEGHPLTKQKEITLESLGNYPLVTYVFWATGRSKLDEAFKNIDVTPNVVFTATDADVIKSYVKLGIGVGIVAGMAFDAVADEGLVSMDASHLFDSSVTHIGFRRGTFLRRYMLDFIEKFAPHLDHWKVKDAVALA 226
40 0.000e+00gi|948002750|ref|WP_056662209.1| transcriptional regulator [Rhizobacter sp. Root1221]  clstr ali  46  88TQQANGRLSIAATHSQARYALPGAVRDFRQRYPQVTLNLHQGSPKQVAEMLISGEADIGIATEALDKYDNLVALPCYRWTHSVIVPPDHPLLDGEPLTLQRLSKFPIITYGAGYTGRIHIDEAFEAAGLPIDLVLTAMDADVIKTYVELGLGVGIVASIAFDEERDRNLRAIDAGQLIAINLTKLAVRRGSFLRSYVYDFIETFASTLTRDVVQKAMATS 307
41 0.000e+00gi|517439026|ref|WP_018609899.1| hypothetical protein [Uliginosibacterium gangwonense]  clstr ali  47  88TQRDQGQLTVATTHTQARYALPAVVATFKHEYPKVHLALHQGSPQEIVQLLLSGEADLGIATESLDNEPELVTFPFYEWHHAVLVQAGHPLLTEPRLSLEALAEYPIITYHSGFTGRSKIDRAFTDANLAPDIVLSALDADVIKSYVELGLGVGIIAPNAFNPSKDPDLRLIDASHLFARNTSLIAVRRGHYLRGFAYRFIELCSPDLDEAMVRTAIAP. 306
42 0.000e+00gi|506354407|ref|WP_015874126.1| transcriptional regulator CysB [Candidatus Hamiltonella defensa]  clstr ali  38  90..PDQGVLCIATTHTQARYTLPKLIKGFIKNYPKVSLHIHQGSPIQIADALSKGKVDLAITTEDEDLYGDAVMLPCYRWRRIIVVKPDHPLAHRTSFNIQELAAYPIVTYTFGFTGRSTLDKAFYASGLTPNIAFTATDADVIKTYVRLGLGVGVIANIAMDPIQDSDLIRIDARAIFDDSITHIGFRRHTFLRGYMYDFVKRFAPHLTRTLVDKA.... 303
43 0.000e+00gi|518703833|ref|WP_019864955.1| hypothetical protein [Methylovulum miyakonense]  clstr ali  42  88SQKETGTLTLATTHTQARYRLPAAVQAFIQRYPDVKLHIHQGNPTQVAEQVASGEADIGIATEVISNFDKLLCFPCYQWNRCIVAPHSHPLFDDRPLTLEKISRYPLITYDFTFTGGSLVNRIFTEAGLAPNVVLTAIDADVIKTYVNLGLGIGLLANIAYDPERDSGLGVIDASHLFPPSTTYLGIRRDAYLRGYMFELIQLLAPQFDRKAIETALQ.. 305
44 0.000e+00gi|495567322|ref|WP_008291901.1| CysB family transcriptional regulator [Methylophaga thiooxydans]  clstr ali  41  90..EQTGTLSIGTTHTQARYALPPAIKTFSEQYPHVHLNMVQGTPPEVAEMAATGQVDIAIATEGLSQFEQLAVLPCYEWNRCVVVPPEHPLLDEGKLTLEAIADYPILTYVMGFTGRAQQDQSFLERGLHPNVVFTATDADVIKTYVELELGIGIIASMAFDPVKDAPLKAIDASHLFNPSVTHMGIRKGSYLRGYMYAFIEYFAAHLDKATVERAIDQ. 306
45 0.000e+00gi|501529814|ref|WP_012536295.1| MULTISPECIES: CysB family transcriptional regulator [Bacteria]  clstr ali  47  91...DRGEFVIATTHTQARYSLPKAIKTFTERYPGVQLRLRQGNPTQIAEMLAAGEADVAIATESLNSYAGLVALPCYQWNRVVITPTGHPLLQSQPLTLEAVAAYPIVTYDQAFAGRSLIDKTFANRGLSPNIVLSAIDSDVIKAYVELGLGIGIVAKMAYDPVRDIKLEVIDASHLFDPSTTYLALRQGTYLRGYLYTFIALYAPHLDRNTVDRAL... 304
46 0.000e+00gi|659837908|ref|WP_029890189.1| CysB family transcriptional regulator [Polycyclovorans algicola]  clstr ali  46  91...DRGDLAIATTHTQARYSLPPVITSFRERYPRVALHLHQGSPPQIAKMAAEGEADFAIATEAIEHFEQLVMLPCYRWNRCVLVRPDHRLAREHRLTLPRLAEHPIVTYTFGFTGRSKLDQAFAAHGLRHDVVLTAVDADVIKTYVRLGLGVGIVADMAYDPKVDTDLVRLPADHLFEPSITHIGFRRGLFLRGYMLDFIHAFAPHLNREAVE...... 301
47 0.000e+00gi|954174594|ref|WP_058086704.1| transcriptional regulator [Aquabacterium parvum]  clstr ali  49  88ASHDTGPLSLAATHSQARYALPSAVRDFRLRFPKVTLSLHQGSPRQVAQMLIDGEADIGIATEALDQYPQLVTLPCYTWTHSVVVPPGHPLLDGQPLTLERLAKFPLITYDGGFTGRAHIDEAFSREGLQPSIVLSAMDADVIKTYVELGMGVGLVASIAFDEDRDRNLRALDAGHLFSVNMTRLAFRRGAFLRGYVYGFIETFASPLTREVVEQAIAKA 307
48 0.000e+00gi|655483849|ref|WP_028865548.1| transcriptional regulator CysB [Psychromonas aquimarina]  clstr ali  38  88TQPDQGTLNIATTHTQARYALPDVIQGFIKRYPKVSLHMHQGTPTQISESVVKGKTDFAIATEALHLYQDLIMLPCYHWNRSVIVPKGHPLADIKNISIEDIAKHPIVTYVFGFTGRSELDDAFNAAGYTPNVVFTATDADVIKTYVRLGVGVGVVATMAVDKDDNDDFCVIDASHIFKSSTTSIGFRKGSFLRDYMYDFMARFAPHLTRPLVEKAIQ.. 305
49 0.000e+00JGI.Meta 7066413196 C2660405__gene_83946 hypothetical protein [Human Buccal mucosa microbiome from visit number 2 of subject 159814214]  ali  39  66TRPNSGVLRIASPNTQARYVLPSVIELFKAKYPNVSLHLHQGSPTQIYDALMAGEVDLAITTEAQYLFEDAILLPCYMWNRSVIVKPDHPLAKYEKLTVEELGKYDLITYTFGFTGQSDLDKAFNKEGILPNIVFTATDADVIKTYVRIGLGVGIMASMAYTES-DSDLVAINASHLFQSSMTQIAFKRGTFLRNYMYDFINYFSPHLTRMQVEQA.... 284
50 0.000e+00gi|947657364|ref|WP_056320079.1| transcriptional regulator [Methylibium sp. Root1272]  clstr ali  48  88AQQDHGPLSIAATHSQARYALPPAVRDFRGSHPGVQLQLHQGSPKQVAQMLLDGEADIGIATEALAQYPDLVALPCYRWTHAVLVPPDHPLLDGAALTLQRLAAYPLITYDAGYTGRSHIDEAFEREGLAPTLALTAMDADVIKTYVELGLGVGIVASIAYDDERDRHLRALDARHLFAVNMTRLALKRGSYLRAYVYDFIESFAPSLTRKVVQRAL... 304
51 0.000e+00gi|821538366|ref|WP_046860246.1| transcriptional regulator CysB [Sedimenticola thiotaurini]  clstr ali  43  88SDPRSGSLSIATTHTQARYVLPPVIKAFRERYPEVDLQMHQGNPEQISELAAGGGADFAIATEATADFGNLIMMPCYHWNRTIITPSDHPLRAVAPLTLEAVAQFPIVTYVFGFTGRSQLDKAFRKQDLEPKVVFTATDADVIKTYVRLGIGIGILARMAYDPDQDQDLCSLDATALFPPSTTRLGFRPGLFLRSYHYDFIQLFAAHLTREVVDSAVEAA 307
52 0.000e+00gi|647646581|ref|WP_025918468.1| transcriptional regulator [Herminiimonas sp. CN]  clstr ali  46  88SGQTSGTLTVATTHTQARYVLPEVVQNFRVAFPDVRIALQQSAPEHIAEWVLSGKTDIGIATEGLSQFPDLVSFPCYSWHHLIVVPDEHPLLARASVSLSDLAAYPLITYDTGFTGRSHIDDAFSNAGVSTNIVLTAMDSDVIKQYVSLGMGVGLLATMAFEPKRDHGLRAIRAEHLFAPNVTRLAVRRGAYLRSYAYDFIMEFAPDLKRADIERALNQ. 306
53 0.000e+00gi|757540270|ref|WP_042801468.1| transcriptional regulator CysB [Mannheimia haemolytica]  clstr ali  40  88TRPNKGVLRIATTNTQARYMLPDVINKFKVRYPDVSLHLHQGSPNQIHDALMAGEVDLAITTEAQYLFEEAILLPCYWWNRSVIVRPDHPLAQSEDLTVEELGKYDLITYTFGFTGQSDLDHAFNKDGILPNIVFTATDADVIKTYVRLGLGVGIMASMAYTES-DKDLVAIKASHLFQSSMTQIAIKRGTFLRNYTYDFINYFSPHLTRAQVEKA.... 306
54 0.000e+00gi|880915095|ref|WP_048674570.1| transcriptional regulator CysB [Candidatus Competibacter denitrificans]  clstr ali  44  89.DDRRGSLSIATTHTQTRYALPPVIKTFRERYPAVTLRVHQGSPAQIAELVLSGEVDFAIATESLELFEDLVMMPCYVWQRCVLVPVEHPLTALDQLALHDIAQYPLVTYVFSFTGRSQLDEAFRSLQLKPLVAFTATDADVIKTYVRLGMGVGIVARMAYDPQQDQDLVQLDASHLFPMNLTKIGFRRGTFLRNYMYDFMQLFAGHLQPERVRAA.... 303
55 0.000e+00gi|490380831|ref|WP_004260349.1| CysB family transcriptional regulator [Thauera sp. 63]  clstr ali  48  88SNADAGQLTVVTTHTQARYALPKVVAAFKQAYPRVVLHLHQGSPQEIVQMLLDGEADIGVATEALADVPELASFPYYGWQHAVVVPAGHPLEAVRPLTLEAIAAYPVITYHEGFTGRTRIDQAFAQAGLKPDVVMSALDADVIKTYVELGLGVGILASMAFSPQRDPGLRQLDSSHLFPENVTRIAVRRGHYLRGFAYRFIALCAPELTEAAVADAV... 304
56 0.000e+00JGI.Meta 7068991069 SRS015063_WUGC_scaffold_45356__gene_53077 transcriptional regulator, lysR family [Human Supragingival plaque microbiome  ali  44  88SQQSAGKLSISATHSQARYALPDAVHDFRRRYPDVQLNLHQGSPQQVAEMLLSGEADIGIATEALTDYDGLVTLSCYRWTHSVIVPPNHPLLDDPELTLERVATFPVITYSPGFTGRLHIDEAFRVRGLEPNMVLTAMDADVIKTYVELGLGIGIIASIAFDEERDTRLRAIDAGHLFPVNVTRLAFRRGAFLRGYVYDFIETFASPLTREVVEQAALQ. 306
57 0.000e+00gi|495605687|ref|WP_008330266.1| MULTISPECIES: cys regulon transcription regulator protein [Herbaspirillum]  clstr ali  45  88AAHDSGSFTIATTHTQARYALPKVVQAFTQKYPKVHLSLLQGNPKQITEMVRNDQADIAIATEALASGEGLVSLPCYQWEHVVVVPPDHPLLQSKSLTLEEIAANPLITYDSAFSGRSKIDHAFSLRQLKPDVVLEAIDADVIKTYVELGMGVGIIAGIAFDAERDRGLRAIPAGHLFGTNVSRVALKQGAYLRGYVYTFIELLAPTLNRKLIAQVM... 304
58 0.000e+00gi|517932440|ref|WP_019102648.1| MULTISPECIES: CysB family transcriptional regulator [Chromobacterium]  clstr ali  41  88SKEAEGALTIATTHTQARYALPPAIAEFVRRYPKVRLSIKQGSPTQICEMVVSGEADLAIATEGIALYKELAMLPCYEWNRSIVVQEGHELTKLRPLTLADIARYPIVTYDFAFAGRSKINKAFADQGLAPNVVLTAIDTDVIKTYVGLGLGIGIIASMAYEPERDVNLQLLDASHLFEPSTTKIGIRKDAYLRGFAYTFIELFAPHLHRREVEAALLA. 307
59 0.000e+00JGI.Meta 7054308706 SRS019389_WUGC_scaffold_3251__gene_2860 sulfur assimilation transcriptional regulator, lysR family [Human Tongue dorsum  ali  40  58TDHDSGSLTIATTHTQARYALPKIVAEFVKNYPKVNLTIKQGSPSAIAQMVSSGEADLAIITERIDDHPELGKLPCYEWNHAVIVPHDHPLLDLNPLSLEDLASFPLVTYEFAFNSGSSIARTFNKAHIEPDVALSAADTDVLKTYVRLGLGVGLMAKMAYDPVVDQDLQLIDAAHLFEPSPTWIALRSDTYLRGYAYDFIQMFAPKLTREVVDRILY.. 277
60 0.000e+00gi|948284808|ref|WP_056929167.1| LysR family transcriptional regulator [Ferrovum sp. JA12]  clstr ali  40  88SHESAGSLTIATTHTQARYVLPPIIHQFAQRYPLVKLVLHQGNPIDVSEEVVAGKADIAIATEGMDQFADLCVLPCYQWNRCLVVQPTHPLLAEKKITLKQLAKYPLITYDFSFTGRSKINQAFEREELTPNMVLTALDADVIKTYVELDMGVGIIAAMAYDKERDSGLRAIDVSHLFENSTTRIGIRRGAFLRQYTYDFIELFAPQLTSDIVREAI... 304
61 0.000e+00gi|659873487|ref|WP_029920336.1| CysB family transcriptional regulator [Nevskia soli]  clstr ali  45  89.DTDKGDLSLATTHTQARYALPPVIQKFRQKYPLVRMHLHQGSPPQIAKQAAEGAVDFAIATEAIEHFEQLVMLPCYHWNRSVLVPPKHPLAGKAKLTLADIAEYPIITYTFGFTGRSKLDQAFHAHGLKPDVVLTAVDADVIKTYVRLGLGVGIVASMSYDAKQDADLVRLSADHLFEPSTTHIGFRQGMFLRAYMYDFIGEFAPHLTRELIDEV.... 307
62 0.000e+00gi|827204206|ref|WP_047196419.1| transcriptional regulator [[Polyangium] brachysporum]  clstr ali  45  88AQQSRGKISIATTHSQARYALPPAVSDFRKHFPHVTLNLHQASPKQVAEMLLTGEADIGIATEALARYDDLIALPCYRWTHCVIVPPGHELLDGEPVTLERIARYPVITYDEGYTGRAHIDEAFSRVEQKPDIVLTAMDADVIKTYVELGMGIGIVASIAYDEERDRGLRAIDARHLFAVNMTRLAIRRGTYLRAYVYAFIESFAPPLTRAVVDRALNAA 307
63 0.000e+00gi|1017137650|gb|KZE26101.1| LysR family transcriptional regulator [Crenobacter luteus]  clstr ali  42  88SRESEGALTIATTHTQARYALPATIAEFVRRYPKVKLSIKQGSPTQICEMVVTGEADLAVATEGIALYKELAMLPCYEWNRSVVVPQDHPLLGLRPITLADIAAYPIVTYDFAFAGRSKINKAFEDAGLEPNVVLTAIDTDVIKTYVALGLGVGIIATMAYEPQRDLTLRAIDAAHLFDASTTKIGLRRDAYLRGFAYSFIEIFAPHLTRQVVD...... 302
64 0.000e+00gi|160366626|gb|ABX38239.1| transcriptional regulator, LysR family [Delftia acidovorans SPH-1]  clstr ali  48  133...EQGRLSIAATHSQARYALPHVVRDFRQRYPQVRLHLHQGSPEQVAQMLRSGEADIGVATEALAGYEGLVALPCYRWTHGVVVPPGHPLLQQQALTLEALSRFPIITYEQGYTGRAHIDEAFAREGLEPDVVLTAMDADVIKTYVELDMGVGIVASVALDAERDQGLRTLDAGHLFEVNTTRLGLRKGAWLRGYAYAFIETFVPTLTREVVEQAVRQ. 349
65 0.000e+00gi|736604831|ref|WP_034613474.1| transcriptional regulator CysB [Chelonobacter oris]  clstr ali  38  88TRPDHGVLRIATTNTQARYVLPKVVERFLTRYPDVSLQIHQGSPTQIYDALLSGEVDLAITTEAQYLFEGVVLLPCYNWNRSVIVKRNHPLVNCKNLTIEELGKYPLVTYTFGFTGASDLSQAFSSSGILPNIVFTATDADVIKTYVRLGLGVGIMASMAHTHE-DSDLVAIDASHLFKSSSTQIAFKRGSFLRHYMYDFINYFSDHLTRPMVEQA.... 302
66 0.000e+00JCVI_PEP_1096695726845 /source_dna_id=JCVI_ORF_1096695726844 /offset=0 /translation_table=11 /length=342 /full_length=342  ali  43  90SDATAGSLSLATTHTQSRYVLPPVISQFIEKYPGVSLQLHQGTPLQIAELAAKGTADFAIATEAMEKFSDLMMMPCYRWNRVVLVPKNHALVGVSKISLADLARFPLVTYVLGFTGRSRLDDAFASQGLQPRVVFTAADADVIKTYVRLGMGIGIVAGMAYDSDKDTDLVALDASHLFDYSVTRIGFRRGTVLRAYMYEFIAMFADHLQRPVVEQVL... 306
67 0.000e+00gi|503200887|ref|WP_013435548.1| CysB family transcriptional regulator [Paraburkholderia rhizoxinica]  clstr ali  46  88ADQDTGHLVVATTHTQARYSLPKVVHRFKEMYPKVHLALRQGSPHQIAQMVINGDADIGIATEGLDRYGEIVTFPGYSWHHTVVVRSEHPLATQPAVTLEDIADYPIITYDQDFTGRSHVDQAFVRAGVAPDIVLTAIDADVIKTYVELGLGVGIVAAMAYDPKRDSELVALDTQHLFEPSTTRVGLRKGAFLRAYAYRLIEMFAPHLTEAQVSGQLREA 307
68 0.000e+00gi|241320395|gb|EER56692.1| transcriptional regulator CysB-like protein [Neisseria flavescens SK114]  clstr ali  40  103TDHDSGSLTIATTHTQARYALPKIVAEFVKNYPKVNLTIKQGSPSAIAQMVSSGEADLAIITERIDDHPELGKLPCYEWNHAVIVPHDHPLLDRNPLSLEDLASFPLVTYEFAFNSGSSIARTFNKAHIEPDVALSAADTDVLKTYVRLGLGVGLMAKMAYDPIVDQDLQLIDAAHLFEPSPTWIALRTDTYLRGYAYDFIQMFAPKLTREVVDRILY.. 322
69 0.000e+00gi|511293845|ref|WP_016353524.1| transcriptional regulator CysB [Spiribacter salinus]  clstr ali  43  89.DEQTGSLSIATTHTQARHALPPAVSRFRDAYPGVSLHFHQGTPLQIAEMVMDGNVDFAIATEALELYEDLAILPCYRWNRSIIVPEGHPLCTVKPLTLEAVAEHPLVTYVFGFTGRSRLDDAFAHRGLAPDVVFTATDSEVIKTYVQLGLGVGIMASMAFDPDRDTGLVALDAGHLFAPSVTSIAFRRGAYLRGYMLAFIETFAAHLTPDTVEQ..... 302
70 0.000e+00gi|949080639|gb|KRO73351.1| LysR family transcriptional regulator [OM182 bacterium BACL3 MAG-120507-bin80]  clstr ali  43  89.DESKGALSIATTHTQCRYVLPSVIKTFRARYPNVSLHMHQGTPVQIAQAAADGTADIAIATEALELFEELTMLPCYRWNRAVIVPKGHPLASVKRLTLKKLSEYPLVTYNFGFTGRSKLDEAFTQESLTANVVFTAADADVIKTYVRLELGVGIVARMAFDEKQDADLIALDASHLFEPSVTKIAFRRGSHLRGYMAGFIEMFAPHISAVNLQRQINEN 307
71 0.000e+00gi|760085718|ref|WP_043768190.1| transcriptional regulator CysB [Algiphilus aromaticivorans]  clstr ali  42  91...DRGDLSVATTHTQARYALPPVIQRFRKDYPRVSLHLHQGSPPQIAKMAAGGEVDFAVATEAMEHFDELVMLPCYHWNRCVLVPPGHALAQKTRLKLEELGEHPIITYTFGFTGRSKLDQAFAARGIRPNVVLTAVDADVIKTYVRLGLGIGIIASMAYDPEADKDLIMRPADHLFEASTTHIGFRRGLFLRRYMYDFIEHFADHLKPEIVDEMAAIA 308
72 0.000e+00gi|491993294|ref|WP_005710365.1| transcriptional regulator CysB [[Haemophilus] parasuis]  clstr ali  39  88TSPHKGILRIATTNTQARYVLPKIIEKFKNKYPSVSLHLHQGSPTQIYDALMAGEVDLAIITEAQYLFENVILLPCYMWNRSVIVKPDHPLAKLNKLTIEELGQYDLITYTFGFTGRSDLDKAFNKHGILPRIVFTATDADVIKTYVRSGLGIGIMATMAYTKE-DKDLVAIDASHLFQSSMTQIAFKRGVFLRNYMYDFINYFSAHLTKIKVEEA.... 306
73 0.000e+00gi|504700729|ref|WP_014887831.1| transcriptional regulator CysB [secondary endosymbiont of Ctenarytaina eucalypti]  clstr ali  40  88TYPDQGSLYVATTHTQARYALPDVIKGFIERYPRVSLHMHQGSPTQISEALSKGGADFAIATEALHLYDDLVMLPCYHWNRAILVLPEHPLAGNKLLTIDELAAYPLVTYTFGFTGRSELDTAFHRAGLVPRIIFTATDADVIKTYVRMGLGVGVIANMAVNIQVDSDLVKINAADLFAQSTTKIGFRRSTFLRSYMYYFIYRFAPHLTRDVVDMAI... 304
74 0.000e+00gi|504003064|ref|WP_014237058.1| CysB family transcriptional regulator [Azospira oryzae]  clstr ali  46  88AGGDSGSLVIATTHTQARYALPQVVKRFTERYPRVRLNLHQGSPTQIAEWAANGEADIAIATEALDHVPNLVTMPCYQWSHCVIAPAGHPILEQGPLSLSVLARFPLITYDPAFTGGGRISSAFERHGLTPNVVLSAIDADVIKTYVTLGLGLGIIARIAFDPERDGGLVALDAGHLFESNTTRLALRRGTYLRRYEYDFIELFAPHLTRKAVEKSMEGA 310
75 0.000e+00gi|647288231|ref|WP_025733057.1| CysB family transcriptional regulator [Carnimonas nigrificans]  clstr ali  45  88SDERKGNLSIATTHTQARYALPPIIKSFRQRYPEVSLHIHQGTPRQIGQMVSDGQADIAICSEPLDMYADLVALPAYRWNRWLLVPEGHPLEALQQPSLEDVAHYPLVTYTFGFTGRSQLDDAFQTAGLTPDVVLTAVDADVIKTYVRLGLGVGIVAHMAIEDERDSDLKVIDASHLFTPSITRLALRRGAFMRRYMFDFIHRFAGHLDAATVEEAL... 304
76 0.000e+00JCVI_PEP_1096683420103 /source_dna_id=JCVI_ORF_1096683420102 /offset=0 /translation_table=11 /length=268 /full_length=268  ali  41  31SDETAGTLSIATTHTQARYVLPSVIKTFMTRYPDVSLVMKQGTPPQVAQMAADGEVDFVIATEALNQFSSLITLPCYRWNRCVVVPQGHPMTSLDHCSLEAIAEHPIVTYTTGFTGRSKLDEAFNDRGLTPRVVFTAVDSDVIKTYVRLGLGVGLIAGMAYDPPLDADLVKIDVSHLFASSVASLGFRKGTFLRGYMHDFIHELAPHLGRELVQEALSRA 250
77 0.000e+00JGI.Meta 7018150905 C2091918__gene_90491 HTH-type transcriptional regulator cysB [Human Supragingival plaque microbiome from visit number 1  ali  37  97TKPDHGMLRIATTNTQARYMLPSVVERFSKRYPNVSLHIHQGSPSQIYDALLSDEVDLAITTEAQYLFDGVVLLPCYLWNRSVIVRPDHPLAKCEQLTIEELGKYPLVTYTFGFTGVSDLDYAFNGAGILPNIVFTATDADIIKTYVRMGLGVGIMASMAHTAA-DTDLIAIKADHLFRPSMTQIAFKNSAFLRNYMYDFITYFSPHLTRENVEKA.... 311
78 0.000e+00gi|654058408|ref|WP_027705098.1| transcriptional regulator CysB [Zymobacter palmae]  clstr ali  45  89.DENQGSLTLATTHTQARYVLPEIIKQFGERYPGISLHMHQGNPRQIAQMVCDGQADIAICTEALTQFNDLAALPWYRWNRSVLVPKGHPLCDEEHLTLEALAKYPLVTYTSGFTGSAQLAENFLAKGLEPNVVLTAADADVIKTYVRLGLGVGIVAHMA-AEATDTDLVAIDARHLFDYSVTRIALRRGAYLRKYMYDFIERMAPHLTRERVDAVMQ.. 304
79 0.000e+00gi|515935564|ref|WP_017366147.1| transcriptional regulator CysB [Methylococcus capsulatus]  clstr ali  43  93.....GSLSIATTHTQARYALPPVVREFMQRYPGIKLNMHQGTPVQIAEEASRGLVDIAIATEAIELFGNLVMLPCYRWNRIALVPKGHPLTEKPGLTLEDLGEHPLVTYVFGFTGRSHLDQAFNRAGIKPRLALTAVDADVIKTYVRLGLGVGIIARMAYNPETDADLVALDASHLFESSVTNIGLRRDIFVRGFLYDFIELFAPHLTREVVDRAL... 304
80 0.000e+00gi|953548004|ref|WP_058021688.1| transcriptional regulator CysB [Pseudohongiella spirulinae]  clstr ali  42  88SDAAAGSLALATTHTQSRYVLPPVISQFITRYPDVSLQLHQGTPIQIAELAAKGVADFAIATEAMEKFSDLMMMPCYRWNRVVLVPRGHPLADVRKLTLADLARFPLVTYVLGFTGRSRLDDAFAAQGLQPKVVFTAADADVIKTYVRLGMGIGIVASMAYDSEKDADLVALDASHLFDYSVTRIGFRRGTVLRAYMFDFVAMFAKHLQRPIVEQVLQC. 306
81 0.000e+00gi|498503094|ref|WP_010803792.1| MULTISPECIES: CysB family transcriptional regulator [Pandoraea]  clstr ali  46  88ADQDSGHLVVATTHTQARYALPQVIKQFTSVYPKVHLALRQGSPRQIAQMVIDGEADIGITTEALDRFPDIVTFPCYSWHHVAVVPKDHPLVGRESVTLADIAEYPIITYDGDFTGRSHVDKAFSDQGLVPDIVLTALDTDVIKTYVELGLGVGIVAAMAVDPRKDQDLAVLELDNAFEPSTTRIGLRRGAFLRSYAYRFIEMLAPALKEQEISTQLREA 307
82 0.000e+00gi|930612106|ref|WP_054264225.1| transcriptional regulator [Janthinobacterium sp. CG23_2]  clstr ali  48  88AGQNSGTLTIAATHTQARYALPKVVQSFRKDFPEVRIALQQSAPDHIAEWVLSGKADIGIATEGLSQFPDLVSFPCYRWSHLIVVPDGHPLLNCSPIRLEDLAQYPLITYDVGFTGRGHIDAAFAKAGVRTDIVLTAMDSDVIKQYVSLGMGVGIVASMAFDHGRDKGLRAVEASHLFAPNVTRLAVRRGAYLRAYAYHFIEQFAPDVSRADIERALDA. 306
83 0.000e+00gi|817114836|ref|WP_046487962.1| CysB family transcriptional regulator [Candidatus Methylopumilus planktonicus]  clstr ali  41  93.....GVLTIATTHTQARYKLPNVVQAFMSKYPDVKLNIHQGNPTQVTDQVVKGEADIGIATESISHNDKLFCLPCYTWNRCLVMPAKHPLAKEKTVTLAKLATYPIITYDYAFTGSTIVSKVFHDAGLTPNIVLTAIDADVIKTYVNLGLGVGLIAQMAYDPKRDQGLVSIDVSHLFPTSTTYLGIRRDVFLRGFMYDFIEMFIPEYPKQIVKKLM... 304
84 0.000e+00gi|503207696|ref|WP_013442357.1| MULTISPECIES: CysB family transcriptional regulator [Methylovorus]  clstr ali  44  88TQKQAGTLVIATTHTQARYRLPVAVKAFTEQYPDVKLTIHQGNPSQVAEQVASGEADIGIATEAISKEEKLVALPCYDWNRCVVVPHGHPLLTDTPLTLKKIAQYPLITYDFGVTGGSVVSHVFEKENLTPNVVLTAIDADVIKTYVGLGMGIGLMASMAYDKDRDSGLAMLDASHLFPVSTTYLGFRRDTFLRGYIYGFIQLLAPHLDKKTVNAAIQSA 307
85 0.000e+00gi|556611022|ref|WP_023367186.1| transcriptional regulator CysB [Spiribacter sp. UAH-SP71]  clstr ali  44  88ADDQSGSLSIATTHTQARHALPEAVRRFRASYPRVSLHFHQGTPTQIAEMATAGEVDFAIATEALELYEDLVMLPCYRWNRSVIVPRGHPLCDARELTLEAVAEHPLVTYVFGFTGRSRLDAAFTARGLSPDVVFTATDSEVIKTYVQLGLGVGIMASMAFDPKRDEGLVALDASHLFEASTTQIGFRRSAYMRGYMFSFIETFAPHLDSAVVQQAIEA. 306
86 0.000e+00gi|299540641|gb|ADJ28958.1| transcriptional regulator, LysR family [Nitrosococcus watsonii C-113]  clstr ali  43  92TDEHQGILSIATTHTQARYVLPPVIKAFRDRYPQVRLRMFQGTPRQIAEMAAAGTVDLAIATEAIELFEDLIMLPCYEWNRSVVVPPTHPLLACQPLTLEAVAEYPIVTYVFGFTGRSKLDNAFTSKNLVPNVILTATDADVIKTYLHLGLGIGIIASMAFDPDQDAPLKAINASHLFEPSTTHLGIRRGAYLRGYIYAFIELFSPRLTRQIVDAAVHA. 310
87 0.000e+00gi|499424001|ref|WP_011111465.1| CysB family transcriptional regulator [Nitrosomonas europaea]  clstr ali  45  89.DKESGTFIIATTHTQARYVLPPVIKRFIEHYPKIRLSLRQGSPIEIATWVSSGEADLAIATEAIELFDKLVMLPCYEWNRCIVVPPRHPLLQLKELTLESIAQYAIVTYDFAFTGRSKINQAFESKGLKPNVVLTALDADVIKTYVEIGLGVGILAKMAFDPVRDKKLRAIDAAHLFEPSTTRIGICRNSYIRHYVYDFIEMFAAHLDMETVNKLL... 304
88 0.000e+00gi|491710725|ref|WP_005556732.1| transcriptional regulator CysB [Aggregatibacter actinomycetemcomitans]  clstr ali  41  88TKPDHGVLRIATTNTQARYMLPHVVERFAKRYPDVSLHIHQGSPMQIYDVLLSGEVDLAITTEAQYLFDGVVLLPCYMWNRSVIVKSDHPLAKCELLTLEELGKYPLITYTFGFTGVSDLDYAFNSAGILPNIVFTATDADVIKTYVRLGLGVGIMASMAHTPA-DVDLVALKADHLFRASMTQIAFKHGAFLRNYMYDFINYFSPHLTRENVERA.... 302
89 0.000e+00gi|654356017|ref|WP_027848474.1| transcriptional regulator CysB [Marinospirillum minutulum]  clstr ali  45  88SNERRGSLVLATTHTQARYILPEVIQQFMERYPDVTLSLKQGTPPQIAQMVAEGEADLAVATESIANTSDLVTFPCYQWNRCILVPKKHPLAKVKKLTLKNLADYPLVTYINGFTGRAKVDEAFVKAGLEPKIVFTAADSDVIKTYVRLGVGVGIVAHMA-ADKRDDDLEVIDASHLFEPSITRLGIRRGTFMRGYLYHFIEKLAAHLDKETLDKGLMAA 306
90 0.000e+00JCVI_PEP_1096686522483 /source_dna_id=JCVI_ORF_1096686522482 /offset=0 /translation_table=11 /length=349 /full_length=349  ali  46  112SNEAKGALTIATTHTQARYALPGVISRFRERYPDVALHMNQGSPTQIAAMAAEGTVDFAIATEALSAVNELVVMPCYRWNRTIIVPVGHPLAAMASPTLEAVASYPIVTYVQGYTGRKRLDDAFADAGLAPRIVLTATDADVIKTYVRLGLGIGILAEMAYDDVLDQDLVALPGRQLFEPSTTYIAFRRGSFLRRFMYEFLELFAPQLTAEQVDAAVAA. 330
91 0.000e+00gi|938997308|ref|WP_054773575.1| transcriptional regulator CysB [Methylogaea oryzae]  clstr ali  43  89.DNRKGTLSVATTHTQARYVLPRVLRDFMERYPGISLNLHQGTPMQIAEMASRGGADVAIATEALELFDNLVMLPCYRWNRCILVRQEHPLAQKAKVTLEDVARHPLITYVFGFTGRSQLDQAFGKAGLHPQVVLTAVDADVIKTYVRLGLGVGIVAHMAYDPVVDQDLVAIDAGPLFGASVTSIGLRRDMFLRGYLYDFMALFAPHLSREMVDKAMA.. 305
92 0.000e+00gi|503512497|ref|WP_013747024.1| transcriptional regulator CysB [Gallibacterium anatis]  clstr ali  41  90..PDVGTLRIATTNTQARYKLPEVVKKFVKRYPDVSLHIHQGSPQQIYELLLSGEIDLAIITEAQYLFEDAILLPCYMWNRSVIVKKDHPLAKVEHLTIEELGKYPLVTYIFGFTGRSDLDYAFNREGILPNTVFTATDADVIKTYVRLGLGVGIMASMAYSDQ-DNDLVAIDASHLFKASMTQIAFKKGSFLRRYTYDFINIFAPHLTRSQVETA.... 302
93 0.000e+00gi|499513575|ref|WP_011200215.1| transcriptional regulator CysB [[Mannheimia] succiniciproducens]  clstr ali  38  88TQPNHGVLRIATSNTQARYMLPAVIERFSKQYPNVSLHVHQGSPNQLYDALLSSEVDLAITTEAQYLFDDVVLLPCYMWNRSIIVKADHPLAKLSHVTIEDLGKYPLITYTFGFTGVSDLDQAFNSAGILPNIVFTATDADVIKTYVRLGLGVGIIASMAHTDA-DTDLIRIDASHLFKSSMTQIAFKHSTFLRNYMYDFINYFSPHLTRAKVEKAERA. 305
94 0.000e+00gi|651615555|ref|WP_026609676.1| transcriptional regulator CysB [Methylocaldum szegediense]  clstr ali  42  93.....GSLSIATTHTQARYALPPVIKEFMNRYPGIKLNINQGTPMQISELASRGVVDMAIATEAMELFENLVMFPCYRWNRCVLVQQGHPLTEKKELTLQDVAEYPIVTYVFGFTGRSQLDQAFEKANLHPQLALTAVDADVIKTYVRLGLGIGIVARMAYDPVADADLVPLDASHLFGSSTTKIGLRRDMFIRGFIYEFIRLFAPHLTRELVEQAMAQ. 306
95 0.000e+00gi|551336627|ref|WP_022956056.1| transcriptional regulator CysB [Perlucidibaca piscinae]  clstr ali  42  88SDEARGSLSVATTHTQARYRLPPVIEAFRQRYPDVALHMHQGTPQQIAEMAADGTVDFAIATEALEHFSDLVMLPAYQWNRTVVVPKGHPLCDVHPLTLEAIADYPIVTYVFGFTGRSKLDEAFSQAGLAANVVFTATDADVIKTYVRLGLGVGIIAQMAYEPARDKDLVALDAGHLFEPSVTHIGFRRGTFLRGFMFDFISTFAPHLERAVVESVLN.. 306
96 0.000e+00gi|654999472|ref|WP_028448669.1| MULTISPECIES: CysB family transcriptional regulator [Chitinibacter]  clstr ali  43  91...ENGSLTIATTHTQARYALPKVIQAFLQRYPKVRLSIKQGSPTQISEMVVDGSADLAIATEGIDHYPELAMLDCYDWNRCIIVPKGHPLTQLRPLSMHDIAAWPLITYDFAFTGRSKINRAFAALQLEPNVVLTAIDSDIIKTYVELGLGVGILASQAFEPERDLNLVAIDASHLFEKSTTHIGVRKDAYLRGYAFDFIALFAPHLTREVVQDAL... 305
97 0.000e+00gi|1011806652|ref|WP_062627035.1| LysR family transcriptional regulator [Ferriphaselus amnicola]  clstr ali  49  90..QDTGSLTIATTHTQARYALPPVVKQFIERYPGVKLNLHQGNPTQIAEQALNGEADIAIATEALDQYDELVTLPCYEWHHCLIVPQDHPLLNEDELTLAKLAEYPIITYDFAFSGRSKINQAFEAEGLTPNIVLSAIDADVIKTYVDLGLGIGIVAEMAFVPERDVRLRRLPLDHLLKSNVTRLALRRNEFLRGYTYHFIELFASHLTRDVV....... 300
98 0.000e+00gi|517815420|ref|WP_018985628.1| hypothetical protein [Methylophilus methylotrophus]  clstr ali  39  88SQEDRGELTIATTHTQARYRLPAAVKQFMAQYPNVKLTIHQGNPSQVTEQVAAGEADIGIATENISKDERLSCLPCYEWNRCLVVPPGHPLLEKKNLGLKDLVNYPLITYDFAFTGGTLVSKVFHDAGLQPNVVFTAIDADVIKTYVNLGLGIGLIANMAYDDTRDAPLKSLDCSHLFPNSTTYLGVRRDAFLRDYMLNFITMLSPQYDKRSVQRALHQ. 306
99 0.000e+00gi|338220617|gb|EGP06082.1| transcriptional regulator CysB [Pasteurella multocida subsp. gallicida str. Anand1_poultry]  clstr ali  42  88TQPNHGVLRIATTNTQARYVLPPVIERFSKKYPDVSLHIHQGSPTQIYDALLSGEVDIAITTEAQYLFDDVVLLPCYMWNRSVLIKHDHPLAQCKNLTLEELGKYPLVTYTFGFTGVSDLDYAFNRAGILPNIVFTATDADVIKTYVRLGLGVGIMASMAHTK-DDGDLLALNADHLFNPSTVQIAFKHSTFLRAYMYDFIQYFSPHLTRELVEKA.... 302
100 0.000e+00gi|491140126|ref|WP_004998542.1| transcriptional regulator CysB [Nitrococcus mobilis]  clstr ali  42  90..ESRGSLSIATTHTQARHTLPLVVGAFRTRYPNVSLHMHQGTPLQIAEMAARGSVDFAIATEALELFEDLVMMPCYRWNRSIIVPAEHSLCNEQPLTLETVARYPIVTYVFGFTGRSKLDKAFATAGLNPEVVFTATDSEVIKTYVELGLGVGIIATMAFNPERDTGLTALDASHLFEPSITSIGFRRGMYLRGYMFDFIEAFAPHLTHSVVERAIAA. 306
101 0.000e+00gi|737402376|ref|WP_035383550.1| CysB family transcriptional regulator [Ferriphaselus sp. R-1]  clstr ali  45  90..QDSGTLTIATTHTQARYALPQAVKRFIEHYPGVKLNLHQGNPTQIAEQALSGEADIAIATEGLDQYDELMTLPCYEWSHSVIVPPDHPLLDVGELSLSALADYPIITYDHAFSGRGKIDQAFRAAGAVPNIVLTAIDADVIKTYVELGLGVGIVAEMAFVPERDTHLRCLSASHLFKPNITRLALRRNEFLRGYTYHFIELFAPKLSRELVVNALR.. 305
102 0.000e+00gi|517576741|ref|WP_018746949.1| CysB family transcriptional regulator [Chitiniphilus shinanonensis]  clstr ali  42  91...EGGSLTIATTHTQARYALPPTVKAFLERYPKVRLSIKQGSPTQISEMVVEGEADLAIATEGIDHYPELAMLDCYDWNRDVVVPSGHPLASLRPITLEDVCGYPLITYDFAFTGRSRINQAFENAGLVPNVVLTAIDTDVIKTYVRLGLGIGLIASMAFEPEHDLGLTAVEAGHLFEKSTTHIGVRKDAYLRGYAFDFIQLFAPHLTREVVRENL... 305
103 0.000e+00gi|503058946|ref|WP_013293922.1| CysB family transcriptional regulator [Gallionella capsiferriformans]  clstr ali  45  91...DTGQLTIATTHTQARYALPPVVKQFIERYPKVKLGLHQGTPTQIAEQVLHGEADLCIATESLSSYEGLVTLPCYDWHHCVITPPGHPLLKIQTLTLKDIVQYPIITYDHAFSGRSKVNEAFEKAGLTPDIALTAIDADVIKTYVELGLGIGILAEIAFIPERELHLRMMNARHLFKPSTTRIAIRKNEYLRAYTYEFIELFAPHLTRKVIAEAMRLS 307
104 0.000e+00gi|652564485|ref|WP_026957984.1| MULTISPECIES: transcriptional regulator CysB [Aliagarivorans]  clstr ali  38  88THPDRGSLNISTTHTQARYALPSVIQDFIKRYPNVSLNMHQGTPAQINEAVSKGTADFAIATEAMHYFSDMVMLPCYYWNRSILVTKEHELAKREQITVEHLAQFPLVTYIFGFTGRSELDEAFNQAGKEPKIVFTATDADVIKTYVRMGIGVGVLASMAINEEQDSDLVAIDGSHLFKASTTQICFRKGTFLRTYMYDFIEGFAPHLNRNLVDLAVQA. 310
105 0.000e+00gi|493769341|ref|WP_006717887.1| transcriptional regulator CysB [Aggregatibacter segnis]  clstr ali  38  88TKPEQGVLRIATTNTQARYMLPAVVEKFSQRYPNVSLHIHQGSPTQIYDALMSDEVDLAITTEAQYLFDDVVLLPCYFWNRSVIVKPDHPLAQCEHLTIEELGKYPLITYTFGFTGASDLDYAFNSAGILPNIVFTATDADIIKTYVRMGLGVGIMASMAHTSA-DKDLVAIKADHLFRPSMTQIAFKNGAFLRNYMYDFINYFSPHLTRTNVEKA.... 302
106 0.000e+00gi|506312177|ref|WP_015831952.1| CysB family transcriptional regulator [Methylotenera mobilis]  clstr ali  41  88SDVETGTLTIATTHTQARYKLPAAVKAFMTNYPRVKLNIHQGNPSQVAEQVESGEADIGIATESISERESLLCLPCYHWNRCVVVPPGHPLLDDVPLTLEKLAKYPLITYDFAFTGGTLVSKTFTDAGLTPNVVLTAIDADVIKTYVSLGLGVGLLANMAYDAERDTHLAKIDVDHLFADSTTYLGVRKDAFLRGYMYGFIELIAPHFNRAAVNQAL... 304
107 0.000e+00gi|998620671|dbj|BAU56603.1| Cys regulon transcriptional activator CysB [Halorhodospira halochloris]  clstr ali  43  50AAEERGHLSIATTQTQAKHALPAVIRKFRQRYPEVTLQMHQGTPLQIAELAARGQVDLAIATEGIEHFEDLVMMPCYRWNRSVVVPHDHPLAHQETLTLEDLNAYPLVTYLFGFTGRSRLDEAFQAAGLAPQVVFTATDAEVIKTYVSLGLGVGIIARMSFDPDQDHGLVALDASHLFAPSTTNLGFRRGSHLRSFIYEFIQLFAPHLTPEVVDQAINA. 268
108 0.000e+00gi|652426636|ref|WP_026821994.1| transcriptional regulator CysB [Arsenophonus nasoniae]  clstr ali  40  88TYPDRGILAIATTHTQARYALPPVIKQFIEHYPQVSLHMSQGSPIQIAEDVSKGNSDFAIATEALHLYKDLVMLPCYHWNRSVVVKADHPLVSKKNITINELAQYPIVTYTHGFTGRSELDEAFLKAGLQAKIIFTATDADVIKTYVRLGLGIGIIASMAVDPSLDQDLVIIDMRDKFSYSTTKIGFHRNSFLRSYMYDFIWRFAPHLTPDVVDKAI... 304
109 0.000e+00gi|654647777|ref|WP_028108827.1| transcriptional regulator CysB [Ferrimonas futtsuensis]  clstr ali  40  88TQPDRGDLVIATTHTQARYALPEVIKGFIERYPQVNLHMHQGTPDQICEMAVRGDADFAIATEGMHMYHDLLMLPCYHWNRSIVFRRDHPLASASRVTLADVAQYPLVTYVFGFNRSSALEKAFNAQGLEPRVVFSATSADVLKTYVRLGLGVGVMATMALDEMEDSDLVVVDASDLFEPNTTKIGFRKGSFLRSYMYEFMERFAPHLTRERVEKA.... 303
110 0.000e+00JGI.Meta 7017906428 SRS017013_Baylor_scaffold_9628__gene_9444 HTH-type transcriptional regulator cysB [Human Buccal mucosa microbiome from v  ali  40  88TQPNHGVLRIATTNTQARYMLPAVVERFSKQYPDVSLHIHQGSPTQIHDALMSGEVDLAITTEAPHLYDDLIQLPCYWWNRSVIVKPDHPLVNAEKLTIEALGKYPLVTYTFGFTGVSDLDYAFNSAGILPNIVFTATDADVIKTYVRLGLGVGIMASMAHT-ELDKDLVAIDASHLFRASMTNIAFKHSTFLRNYMYDFMEYFSPHLTRPVVEKA.... 302
111 0.000e+00gi|550891915|ref|WP_022652740.1| CysB family transcriptional regulator [Aquaspirillum serpens]  clstr ali  42  88AHEDQGSLTIATTHTQARYALPHTVRRFRERYPDVGLSIKQGSPTQICEMVVTGEADFAIATEGISSFPELAALPCYQWNRAIVVPEGHPLLALRPLTLADIGRWPIITYDFAFTGRSKINRAFADAGVEPNVVLTAIDTDVIKTYVNIGLGIGIIAAMAFEPERDHGLRLIDAAHLFQPSTTRIGIRRDAYLRGFAYHFIELFAGHLTRKEVDKVMFA. 307
112 0.000e+00gi|751600556|ref|WP_041068716.1| transcriptional regulator CysB [Candidatus Ishikawaella capsulata]  clstr ali  37  88TGPDKGSLYVATTHTQSRYILPQVIKGFISRYPYVSLHMHQGSPIQIAETVLKGNADFAIATESLYLYNDLVMLPCYHWNRTIVVTPNHPLAKKQQISIQDLAQFPLVTYNFGFTGRSELDAAFNQVGLTPRIAFTATDADVIKTYVCLGLGVGVIASIAINPVSDINLVFIKASDIFIKSTTKIGFRRTTFLRGYMYDFIQRFAPHLTREVVDTAI... 304
113 0.000e+00gi|928912285|ref|WP_053937479.1| CysB family transcriptional regulator [Amantichitinum ursilacus]  clstr ali  43  91...EGGSLTIATTHTQARYALPRTIKAFLSRYPKVRLSIKQGSPTQISEMVVEGAADLAIATEGIDHYHELAMLPCYDWNRSIVVPADHPLTALDHIRLEDVAAYPLITYDFAFTGRSLINRAFEQRGLTPNVVLTAIDSDVIKTYVGLGLGVGILASMAFEPDRDHGLVAIDASHLFEPSTTRIGVRRDAYLRGYAFDFIELFSPHLNREVVHAAL... 305
114 0.000e+00gi|492993808|ref|WP_006081957.1| transcriptional regulator CysB [Shewanella baltica]  clstr ali  37  88TKPDQGELNISTTDTQARYALPTIIRQFIDRYPKVNLHMHQGTPSQISEQAARGDADFAIATEAMHLYSDLIMLPCYHWNRSIVVPKDHPLATRSPISIEDLARFPLVTYVFGFDRASEIEKAFNRANLEPRVVFSATSADVLKTYVRLGLGVGVIASMAIDPNVDKDLVAIDAGHLFAHSTTKIGFRKGSFLRSYMYDFIQHFAPHLTRDVVEKAVA.. 308
115 0.000e+00JCVI_PEP_1096700631343 /source_dna_id=JCVI_ORF_1096700631342 /offset=0 /translation_table=11 /length=341 /full_length=341  ali  41  103SDETKGVLSIATTHTQARYVLPPIINQFMQEYPEVSLHMQQGTPAQIAEMAASGDVDFAIATEGLEHFANLLLMPCYQWNRAVIVPKGHPLSDLDPLKLSELARYSIVTYVFGFTGRSRLDEAFEKEGLAPKVVFTAADADVIKTYVRLGLGVGIVADMAFDPNTDADLVKVSAAHLFSPSVTSIAFRRGTFLRGYMYRFVNLFAPHLSRDVIGQFLR.. 321
116 0.000e+00JCVI_PEP_1096685015791 /source_dna_id=JCVI_ORF_1096685015790 /offset=0 /translation_table=11 /length=311 /full_length=311  ali  49  90ADQDSGHLVVATTHTQARYALPKVIRQFTDVFPKVHLALRQGSPQQIAQMILNGEADLGISTEALDRYPDIVTFPCYSWHHTVVVPKGHPLVGRENLTLEEIAEYPIITYDQDFTGRSHIDQAFTQAGAVPDVVLTAIDADVIKTYVELGMGIGVVAAMAYDPQRDTGLVALDTQHLFEASTTRVGLRKGAFLRAYAYRLIEMFAPHLNEAEIAGLLREA 309
117 0.000e+00gi|502912929|ref|WP_013147905.1| CysB family transcriptional regulator [Methylotenera versatilis]  clstr ali  42  88SNIETGTLTIATTHTQARYKLPAVVKAFMTAYPHVKLNIHQGNPSQVAEQVAKGDADVGIATEYISDFENLLCLPCYEWNRCVVVPHGHPLLLDGALTLEKLAAYPLITYDFGYTGGSLVSKTFSEAGVSPNVVLTAIDADVIKTYVTLGLGVGLLANMAYDPERDSNLAMVDVSHLFPNSTTYLGVRKDAFLRGYMYGFIELMAPKFNRKAVNEAL... 304
118 0.000e+00gi|494432231|ref|WP_007225537.1| transcriptional regulator CysB [marine gamma proteobacterium HTCC2143]  clstr ali  42  88SNEKKGSLSIATTHTQARYALPNTIQTFIETYPEVSLHMHQGTPMQISELAADGTVDFAIATEALELFSDLIMMPCYRWDRAIVVPKGHALAQKSELTLEDVAAHPIVTYVFGFTGRSKLDEAFIDKGLAPKVVFTAADADVIKTYVRLGLGIGIVAKMAYDAELDDDLVALDASHLFESSITKIGFRRGTFLRGFMLDFIQQFAPHLTQDIVEEACR.. 305
119 0.000e+00gi|736633557|ref|WP_034641519.1| CysB family transcriptional regulator [Chitinilyticum aquatile]  clstr ali  43  91...EGGSLTIATTHTQARYALPPVVHAFLEKYPKVSLSIKQGNPTQISEMVVEGMADIAIATEGIDHYPELAMLPCYEWNRSIVVQSGHPLTQLDPISLADVAAYPLITYDFAFAGRSKINRAFADAGLEPNVVLTAIDSDVIKTYVGLGLGIGILAGMAFEPDRDTGLEAIDASHLFEPSTTRIGIRKDAYLRGYAYDFIELFAPHLTRQVVQSAL... 305
120 0.000e+00gi|653099068|ref|WP_027349185.1| transcriptional regulator CysB [Halotalea alkalilenta]  clstr ali  44  88SDERKGSLSIATTHTQARYSLPPIIQAFRRRYPEVSLHIHQGTPRQIGQMVSDGQADFAICTEPLDMYSDLVSLPCYRWNRWLLVPEDHPLCAVERPTLAQLAEHPLVTYTFGFTGRSQLDDAFDAAGLTPDVVLTAVDADVIKTYVRLGLGVGIVAHMAIDATQDGDLRAIDASHLFSHSITRLAIRRGTFMRRYMFDFIHRFAAHLDASTVEEAL... 304
121 0.000e+00gi|498009798|ref|WP_010323954.1| transcriptional regulator CysB [Marinobacterium stanieri]  clstr ali  42  88SDERKGKLEVATTHTQARYALPQTIHDFIKDYPDVSLHIHQGTPMQISEMAADGTVDFAIATEAMSHFSDLIMMPCYRWNRSVVVPEGHPLTELPELTLEALAEWPIITYVFGFTGRSKLDEAFINKGLEPKVVLTAVDSDVIKTYVRLGLGVGIIATMAFEDGQDDGLVALDASHLFEHSVTRIGFRKGTFLRGYMYDFIQTFAPHLTPDLVRRVQSCS 307
122 0.000e+00gi|516416853|ref|WP_017806251.1| transcriptional regulator CysB [Avibacterium paragallinarum]  clstr ali  40  88TRPDYGVLRIATTNTQARYMLPTVVKQFSEKYPKVSLHIHQGSPTQIYDALLSDEVDLAITTEGQNLFENLVLLPCYIWNRSVIVKVDHPLAKCNNLTINELSNYPLVTYTFGFTGVSDLDYAFNSAGLLPNIVFTATDADVIKTYVRLGLGVGIMASMAYTEE-DKDLVALDAKHIFRSSMTQIAFKRSVFLRNYMYDFIHMFSPHLTRSLVEKA.... 302
123 0.000e+00gi|500137153|ref|WP_011813158.1| transcriptional regulator CysB [Halorhodospira halophila]  clstr ali  42  88AGQERGQLTIATTQTQAKYALPRVIQRFRARYPNVSLHMHQGTPMQIAELAARGEVDFAIATEAMEHFEDLVMMPCYRWNRSVVVPADHPLAETEPLTLEALAAHPLVTYVFGFTGRSQLDAAFQGAGLDPEVVFTATDAEVIKTYVQLGVGVGIIASMAFDPDTDEGLVARDASHLFAPSTTSIGFRRGSHLRGFMYAFIHLFAPHLTEAVVEQATRA. 306
124 0.000e+00gi|494440547|ref|WP_007233826.1| transcriptional regulator CysB [marine gamma proteobacterium HTCC2080]  clstr ali  44  88SDETSGTLSIATTHTQARYVLPPIIKDFMSGYPNVSLQMQQGTPPQIAEMAAEGSVDFAIATEALQQFNSLVLLPCYRWNRCIVVPKGHPLTQVERLTLEAVAEHPIVTYTFGFTGRSKLDDAFKSRGLVPHVVFTAVDSDVIKTYVRLGLGIGIIAGLAHDEDLDEDLVKLNVDHLFASSVTSLAFRKGSFLRGYMYDFIQALAPHLTRDIVVEALSRS 307
125 0.000e+00gi|496312271|ref|WP_009021449.1| transcriptional regulator CysB [Luminiphilus syltensis]  clstr ali  43  88SDETSGNLAIATTHTQARYALPSVIGEFIKRFPDVSLHMQQGTPTQIAQMAADGVVDFAIATEALGLMSDLITLPCYRWNRCVVVPKDHPLTKLDKLTLESVAEHPIVTYTFGFTGRSKLDEAFSSRDLTPKVVFTAVDADVIKTYVRLGLGIGIIAGMAYDERLDDDLVKLDAQHLFASSVTSLAFRKGTFLRGYMYDFISELAPHLTKDIVSDAL... 304
126 0.000e+00gi|518389903|ref|WP_019560110.1| MULTISPECIES: CysB family transcriptional regulator [Caldimonas]  clstr ali  49  89.QQSRGRLSIAATHSQARYALPPAVSEFRRHFPEVMLHLHQGSPRQVAEMLLSGEADIGIATEALALYEDLVALPCYRWTHCLLVPPGHELLEGGPLTLERIAGYPIVTYDEGYTGRSHIDEAFARAGLTPNIVLTAMDADVIKTYVELGLGLGIVASIAYDEERDRQLRAIDARHLFAMNMTKLAIRRGTFLRGYVYAFIESFAPTLSRAVVEQAMAAA 307
127 0.000e+00gi|923014021|ref|WP_053408199.1| transcriptional regulator CysB [Vibrio hepatarius]  clstr ali  37  88THPDMGTLNISTTHTQARYALPEVIKGFTARYPKVTLHMHQGTPAQMSESVAKGTANFAIATEALHLYQDAIMLPCYHWSRSIVVPKNHPLATKEKLSVQDLASYPLVTYIFGFSAGTELDNAFHKHGLTPRVVFTATDADVIKTYVRMGLGVGVIASMAIDKELDSDLVVLDASHIFGRTTTSIGFRRGTFLRSYMYDFMERFAPHLTRPVVEQAV... 304
128 0.000e+00gi|647529900|ref|WP_025820582.1| transcriptional regulator CysB [Shewanella marina]  clstr ali  38  88TQPDRGDLNIATTDTQARYALPNVIGTFINRYPKVNLHMHQGTPSQISELAARGDADFAIATEAMHLYHDLIMLPCYHWNRSIVVKKDHPLAQLSNVSIETLAQYPIVTYVFGFDRASEIERGFNQAGLEPRVVFSATSADVLKTYVRLGLGVGVIASMSIDPKIDDDLVAIDASHLFAYSTTKIGFRKGSFLRGYMYDFIEFFAPHLTRPVVEQAMA.. 305
129 0.000e+00gi|492896220|ref|WP_006026626.1| MULTISPECIES: CysB family transcriptional regulator [Burkholderia]  clstr ali  48  88ADQDSGHLVVATTHTQARYALPKVVRQFTEVYPKVHLALRQGSPQQIAQMILNGEADLGISTEALDRYPDIATFPCYSWHHVVVVPKGHPLVGRENVSLDDIAEYPIITYDQDFTGRSHIDQAFANAGAVPDVVLTAIDADVIKTYVELGMGIGVVAAMAYDAQRDTGLVALDTQHLFEASTTRVGLRRGAFLRAYAYRLIEMFAPHLSESEIAGQLREA 307
130 0.000e+00gi|391859075|gb|EIT69604.1| transcriptional regulator CysB [Hydrocarboniphaga effusa AP103]  clstr ali  45  93.DTDRGDLSIATTHTQARYALPPVIQRFKGRFPRVSLHLHQGSPPQIAKMAAEGQADFAIATEALEHFEQLVMLPCYHWNRCVLIKPDHPLAQVSRLTLKELAEFPIITYTFGFTGRSKLDQAFAASGLRPDVVLTAVDADVIKTYVRLGLGVGIIADMAYDEKTDADLVCLKADHLFEQSTTHIGFRRGLFLRGFMYEFMQTFAPHLTRELVDSV.... 307
131 0.000e+00gi|506314436|ref|WP_015834211.1| transcriptional regulator CysB [Photorhabdus asymbiotica]  clstr ali  40  88TYPNRGSLYIATTHTQARYALPPVIKGFIERYPQVSLHMHQGSPTQIAEAVCKGSADFAIATEALHLYEDLIMLPCYHWNRTLVVTPDHPLAGKENVSIEELAEYQLVTYTFGFTGRSELDVAFDKVCLKPKIVFTATDADVIKTYVRLGLGVGVIASMAVDPVQDKDLICIDMRDKFGYSTTKIGFRRSSFLRSYMYDFMWRFAPHLTRDVVDQAVA.. 305
132 0.000e+00gi|499839749|ref|WP_011520483.1| transcriptional regulator CysB [Candidatus Baumannia cicadellinicola]  clstr ali  40  88TYPDKGSLYVATTHTQARYALPEIIKSFIDRYPRVSLHMHQGSPSQIAEAVSKGLADFAIATEALHLYDDLVMLPCYHWNRAIVVLPHHPLASKTQITIEELASYPLVTYTFGFTGRSELDIAFNHAGLKPRIIFTATDADVIKTYVRMGLGIGVIANMAVSAESDHDLVKINADILFPQSTTKIGFRRSTFLRSYMYDFLQRFAPHLTREVVDMAV... 304
133 0.000e+00gi|821526895|ref|WP_046848817.1| CysB family transcriptional regulator [Nitrosomonas communis]  clstr ali  46  88SDKASGTLIIATTHTQARYALPPVIKRFTEKYPKVKLILRQGNPTQISTLVSSGEADLAIATEAIELFQELVMLPCYQWNRSIIVTPKHPLLKQHPLTLEAIAQYPIITYDFAFTGRSKINQAFASKGLTPNVVLTAIDADVIKTYVELGLGIGILAKMAFDTHRDKHLRAIDASHLFEPSTTRIGISRNSYIRSYIYDFIEMFAPHLDEATVKAAM... 304
134 0.000e+00gi|849031814|ref|WP_047976384.1| transcriptional regulator CysB [[Actinobacillus] muris]  clstr ali  41  88TCPDKGVLRIATTNTQARYTLPNVIKTFKEKYPEVSFHLHQGSPSQIYDALMAGEVDLAITTEAQYLFENVVLLPCYLWNRSVVVKADHPLVQNRKLTVEELGKYDLITYTFGFTGQSDLDRAFNKEGILPNIVFTATDADVIKTYVRLGLGVGIMASMAYT-EDDSDLVAIDASHLFQSSMTQIAFRRGTFLRNYMYDFIHYFSPHLTKMQVEKA.... 306
135 0.000e+00gi|499928454|ref|WP_011609188.1| transcriptional regulator CysB [Histophilus somni]  clstr ali  40  88TRPNCGVLRIATTNTQARYMLPSVIRRFSKQYPEVSLHIHQGSPTQIYDALLFGEVDFAITTEAQYLFDDVILLPCYMWNRSVIVKPEHPLAQCKKLTIEALGQYPLVTYTFGFTGGSDLDYAFNSAGLLPNIVFTATDADVIKTYVRLGLGVGIMASMAHTEA-DNDLVALDASHLFRSSMTQIAFKHGIFLRNYMYDFIQYFSPHLTRTLVEQA.... 302
136 0.000e+00gi|495523107|ref|WP_008247752.1| transcriptional regulator CysB [Zhongshania aliphaticivorans]  clstr ali  45  89.NPKKGSLSIATTHTQARYALPKVIKTFIERYPEVSLHMHQGTPMQISELAANFGVDFAIATEALELFSDLIMMPCYRWNRTILVPKDHPLAAFKTLRIEDVALHPIVTYVFGFTGRSKLDEAFLNKGLEPRVVFTATDADVIKTYVRLGLGIGIVAEMAYDPVTDADLVALDASHLFEPSVTKVGFRRGTYMRKFMYDFVELFAPHLTPDLVDKA.... 303
137 0.000e+00gi|150837287|gb|ABR71263.1| transcriptional regulator, LysR family [Marinomonas sp. MWYL1]  clstr ali  41  99SDERKGSLDIATTHTQARYALPKVINQFIEGYPDVSLHMHQGTPMQIAEMANDGLVDFAIATEALELFGNLVMLPCYTWNRSVVVPKDHPLAKVNKLTLQALAEYPIVTYVFGFTGRSQLDQAFQEAELQPNVVFTAADSDVIKTYVRLGLGVGIVASMAHDEMQDADLVALDASHLFADSCTKIGIRSNTFIRGYMYKFIESFAPHLTKDVVMAAMEA. 317
138 0.000e+00gi|1002799659|gb|KXU34226.1| transcriptional regulator CysB [Ventosimonas gracilis]  clstr ali  44  88SNQKKGTLSIATTHTQARYALPSVIKGFIRQYPEVALHMHQGSPVQIAEMAADGTVDFAIATEGLELFDDLLMMPCYRWNRCVVVPKGHPLTQK-PLTLQALAEHPLVTYVFGFTGRSRLDEAFDREGLLPKVVFTAADADVIKTYVRLGLGVGIVAQMAFDPIQDSDLVSLDASALFEPSVTKIGFRRGTFLRGFMCDFIERFAPHLTRRIQTQLMNC. 305
139 0.000e+00gi|504819389|ref|WP_015006491.1| transcriptional regulator CysB [Cycloclasticus sp. P1]  clstr ali  44  89.NQTKGLLSIATTHTQARYALPSIIKTFMQEMPDVSLDIQQGTPVQISEMVSQGKVDLAIATEALELFDNLVMMPCYSWERCILVPKGHALTKIDRLSLIDVALHPLITYVFGFTGRSKLDDAFKAQGLSPDIALTAVDADVIKTYVRLGLGVGIVARMAYDEQVDNDLVALDAGHLFGTSITKIGIRKDAFLRGYMYEFIHLFAPHLTQAVINQAM... 304
140 0.000e+00gi|954629238|gb|ALP54322.1| LysR family transcriptional regulator [Candidatus Tenderia electrophaga]  clstr ali  43  88SDEASGRLAIATTHTQARYALPPVVTIFKQKYPDVRLELHQGSPSQAADQAARGEVDIAIATEAISDYPDLVMMPCYEWNRCVVCPPGHPLLDEAPLSLAALARYPIITYDFAVAGRTKINKAFDAAGLEPNVVLTAIDSDVIKTYVELGLGVGVLAKMAFNPARDINLRAVDAAHLFEPSTTRVGIRRGAFLRRYVYDFIEMFASHLTRAVIDEAM... 304
141 0.000e+00gi|522139177|ref|WP_020650386.1| transcriptional regulator CysB [Solimonas variicoloris]  clstr ali  45  89.DADRGDLAIATTHTQARYALPRVIQPFRQLYPRVSLHLHQGSPPQIARMAAEGQADFAIATEAMHHFETLVMLPCYHWNRAVLVRPDHPLAGKSRLTLQDIAAHPIITYTFGFTGRSKLDQAFAARGLKPDVVLTAVDADVIKTYVRLGLGVGIIASMAFDEKTDRDLVCLPADHLFEDSVTHIGFRRGLFLRGYMYDFLKLFAPHLTREVVDEAIADA 309
142 0.000e+00gi|640517896|ref|WP_024952396.1| transcriptional regulator CysB [Cobetia crustatorum]  clstr ali  45  88SDDRRGSLSIATTHTQARYALPPVIADFTRKYPDVALHMQQGTPKQIASMVSEGQADFAICTESLELFNDLILLPCYRWNRCILVPKDHPLVAVSELTLECLADYPLVTYTFGFTGRSQLDDAFKTQGLTPNVVLTASDADVIKTYVRLGMGIGIVAHMAVDEVADQDLVALDATHLFDSSTTKIGIRRGTFMRSYMFEFVERFAPHLTRDRVEAALAA. 309
143 0.000e+00gi|654847486|ref|WP_028299983.1| transcriptional regulator CysB [Oceanospirillum beijerinckii]  clstr ali  44  88SDDRIGSLTLATTHTQARYALPGVIKDFISKYPDVSLHVKQGTPMQISEMVSEGAADFAIATEAMELFSDLIMLPCYRWNRCVLVPKDHPLTKRAPLTLEHVAEHPIVTYVFGFTGRSKLDEAFSEKGLKPKVVFTAADSDVIKTYVRMGMGVGIVARMAYDEEVDKDMVALDASHLFQSSTTKIGIRRGTFMRGYMYEFVTRFAPHLDRDLIDEALA.. 306
144 0.000e+00gi|938317544|ref|WP_054621770.1| LysR family transcriptional regulator [Rhodocyclaceae bacterium Paddy-1]  clstr ali  45  88AGGDSGSLTIAATHTQARYALPAVVKRFVDKYPNVRLSLHQGSPTQIAEWVSNGEADIGIATEAMDQYPQLVMLPCYQWSHVVIAPEGHPILAEPALTLQEMARYPLITYDPAFTGRSRINRAFERAGITPNVVLAAIDADVIKTYVGLGLGLGVIAAMAFDAERDVGLRALDASHLFERNTTRIGLKRGTYLRRFEYDFIEYFAPQLTRKAVEMAMAGA 307
145 0.000e+00JGI.Meta 7005157338 SRS013170_Baylor_scaffold_56480__gene_64492 HTH-type transcriptional regulator cysB [Human Supragingival plaque microbio  ali  39  89TQPNHGILRIATTNTQARYVLPSVVERFSGQYPDVSLHIHQGSPTQIYDALLSGEVDLAITTEAQYLFDDVVLLPCYRWNRSVIVKSDHPLAKYKKLTLEELGKYPLVTYTFGFTGMSDLDYAFNKEGILPNIVFTATDADTIKTYVRLGIGVGIIASMAHTEA-DTDLVAIDASHLFKSSTTQIAFKHSTFLRNYMYDFINFFSPHLTRSLVEKA.... 303
146 0.000e+00gi|549801187|ref|WP_022564616.1| transcriptional regulator CysB [Candidatus Pantoea carbekii]  clstr ali  39  90..PDKGSLYVATTHTQARYALPNVIKGFIKRYPRVSLHMHQGSPIQIMEAVSKGNADFAIATEALHLYDDLIMLPCYNWGRSVIVMKNHSLARKKHITLQELADFPLITYTFGFTGRSELDTAFNSIGLTPRIVFTATDADIIKTYVRLGLGVGVIASMAVDSITDTDLVCINMPEIFATNTTKIGFKRSTFMRSYMYDFIQLFAQHLTRNIVDKAL... 304
147 0.000e+00gi|517522338|ref|WP_018692546.1| transcriptional regulator CysB [Algicola sagamiensis]  clstr ali  42  90..PDQGKLNIATTHTQARYALPDVIKGFMQRYPKVSLHMHQGTPQQISDAAVRGDADFVIATEALHLYNDLVLLPCYHWNRSIIVNKSHPLANKHKITIEEVARHPIVTYVFGFTGRSELDRAFNEHGLEPQIVFTATDADVIKTYVRLGVGIGVVASMAVNPELDDDLVLIDASHLFEASTTMIGFRKGNFLRTYMYDFIERFASHLTRDVVERA.... 304
148 0.000e+00gi|493755809|ref|WP_006704668.1| transcriptional regulator CysB [Candidatus Regiella insecticola]  clstr ali  37  88TCPNKGSLCIATTYTQARYVLPKIIKSFIKHYPCVSLHMHQGSPVQIAQAVVKGDADFAITTEALHLYDDLIMLPCYHWNRGVVVRQDDPLAGKKNLTITELAAYPIVTYTLGFTGRATLDSAFKRAGLTPRIVFTATDADVIKTYVRLGLGVGIIANMAVNPQQDPDLVTVEAKEIFTCSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDRVDRAL... 304
149 0.000e+00gi|494434521|ref|WP_007227800.1| transcriptional regulator CysB [marine gamma proteobacterium HTCC2148]  clstr ali  44  88SNEKKGSLSIATTHTQARYALPATISAFIDRYPDVSLHMHQGTPMQISEMAADGTVDFAIATEALELFSDLIMMPCYRWNRCILVPRDHPLTQVSVLGLEDVAAHPIVTYVFGFTGRSKLDEAFVEKGLTPRVVFTAADADVIKTYVRLGLGIGIVAGMAHDPEMDPDLVALDASHLFASSVTRIGCRRGTFLRGYMYEFIEDFAPHLTRDLVQEA.... 303
150 0.000e+00gi|499799157|ref|WP_011479891.1| CysB family transcriptional regulator [Methylobacillus flagellatus]  clstr ali  42  88SHEDSGTLTIATTHTQARYRLPAAVKEFMQRYPKVKLTIHQGNPTQVAEQVQKGEADIGIATESISSYSDLLCLPCYQWNRCIVMPQGHPLLAEQPITLEKITRYPLITYDFAFTGGSLVSKVFEKAGLNPNVVLTAIDADVIKTYVNLGLGVGLVANMAYDPQRDSHLAMLDVSDLFPPSTTYIGLRRDAYLRGYAYAFIELLAPHYPRKAVEAEL... 304
151 0.000e+00gi|499907984|ref|WP_011588718.1| MULTISPECIES: transcriptional regulator CysB [Alcanivorax]  clstr ali  44  89.DESRGELSIATTHTQARYALPPVIRHFTGLFPDVSLHMHQGTPMQISEMAANGSVDFAIATEALDLFSDLIMMPCYRWNRTVVVPQGHPLAEAKPLTLEALADYPLVTYVFGFTGRSKLDDAFVDKGLDPKVVFTAADADVIKTYVRLGMGVGIIAHMAVDPVEDKGLIALDASHLFEPSTTRIGFRKGTFLRGFMYDFLEAFAPHLTRERVDAAIKA. 307
152 0.000e+00gi|653021171|ref|WP_027273072.1| transcriptional regulator CysB [Leminorella grimontii]  clstr ali  41  88TYPDRGSLYVATTHTQARYALPKAIKAFIDRYPKVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYEDLVMLPCYHWNRAIVVKDDHPLASKSHIPIEELASYPLVTYTFGFTGRSELDIAFNRAGLTPKIVFTATDADVIKTYVRLGLGVGVLANMAVDALEDPDLVAIDASHIFAPSTTKIGFRRTTFLRSYMYSFIEGFAPHLTRDIVDKAVA.. 305
153 0.000e+00gi|498233283|ref|WP_010547439.1| transcriptional regulator CysB [gamma proteobacterium HIMB30]  clstr ali  44  88SDETKGVLSIATTHTQARYVLPPIINQFMRDYPEVSLQMQQGTPAQIAEMAAGGEVDFAIATEGLEYFSNLLLMPCYQWNRAVIVPKDHPLAQLGPLTLAELARHPIVTYVFGFTGRSRLDEAFEQEGLSPKVVFTAADADVIKTYVRLGLGVGIVADMAHDPQTDGDLVTVDASHLFSPSVTSIAFRRGTFLRGYMYRFVNLFAPHLSRELIGKFLR.. 306
154 0.000e+00gi|736413450|ref|WP_034435922.1| transcriptional regulator CysB [Candidatus Contendobacter odensis]  clstr ali  45  89.DDRRGSLSIATTHTQARYALPPVIKIFRERYPAVTLQIHQGSPAQIADLVQSGEVDFAIATESLELFEDLVMMPCYVWQRCVLVPSGHPLADIDRLTLHDVAQYPLVTYVFGFTGRSQLDETFRNAQLKPTVAFTATDADVIKTYVRLGMGVGIIARMAYDSRQDQDLIQLDASHLFSTNITKIGFRRGMFLRFYMYDFIELFAPHLTRDRVR...... 301
155 0.000e+00gi|559231493|ref|WP_023582276.1| transcriptional regulator CysB [Proteus hauseri]  clstr ali  41  88TYPDRGSLSIATTHTQARYVLPPVIKGFIERYPDVSLHMNQGSPTQIAEDVCRGKSDFAIATESLHLYNDLVMLPCYRWNRIVVVSKDHPLAQKREVTLKELAGYDIVTYTQGFTGRSDLDDAFGKVGLKPKIVFTATDADVIKTYVRLHLGIGVIASMAFDPVLDSDLVAIDMRDKFSYSTTKIAFRRSGFLRGYMYDFMWRFAPHLTRNLIEQAVA.. 305
156 0.000e+00gi|515588599|ref|WP_017021271.1| transcriptional regulator CysB [Aliivibrio logei]  clstr ali  40  88THPEKGLLNITTTHTQARYALPDVIKGFTSRYPQVSLHMHQGTPTQMSDAIAKGTADFAIATEALHLYHDAIMLPCYHWNRSIVVNKDHPLAQKKHVTVQDLAAYELVTYVFGFTGRSELDSAFNKAGLTPKIVFTATDADVIKTYVRLGIGVGVIASMAMDPERDSDLVAIDASHIFDASTTTIGFKRGSFLKSYMYDFMERFAPHLTRPIVEQA.... 303
157 0.000e+00gi|495571074|ref|WP_008295653.1| transcriptional regulator CysB [Congregibacter litoralis]  clstr ali  44  88SDEKRGALSIATTHTQARYVLPDVIRSFIGKYPEVSLHMNQGTPMQISEMAADGTVDFAIATEALELFSDLIMMPCYRWNRCVIVPRDHALAQVSRLSLEDVAAHPIVTYVFGFTGRSRLDDAFVTAGLTPRVVFTAADADVIKTYVRLGLGIGIVADMAHDEEIDDDLVALDARHLFASSVTSIGCRKGTFLRGYMYDFIEDFAPHLSRDLVKDA.... 303
158 0.000e+00gi|522173003|ref|WP_020681552.1| transcriptional regulator CysB [Marinobacterium rhizophilum]  clstr ali  41  88SDERKGSLAIATTHTQARYALPWSITQFIKSYPDVSLHMHQGTPMQISEMAADGTVDFAIATEAMSHFSDLIMMPCYRWNRSVVVPQDHPLCQVSRLTIKELAAYPLVTYVFGFTGRSKLDDAFIREGLTPKVIFTAVDSDVIKTYVRLKLGVGIIATMAYEPDIDSDLVALDASHLFEASTTRIGFRKGTFLRGYMYYFIQKFAPHLTEDVVRQVQACS 307
159 0.000e+00gi|491058515|ref|WP_004920151.1| transcriptional regulator CysB [Providencia stuartii]  clstr ali  38  88TYPDKGTLHIATTHTQARYALPPVIKGFIERYPHVSLHMQQGSPTQIAEEVCKGNSDFAIATEALHLYSDLIMLPCYHWNRCVVVQKGHPLAEKKNVTIEDVAQYQIVTYTHGFTGRSELDVAFQKANLEPKIIFTATDADVIKTYVRLGLGIGIIASMAVNPELDSDLVVIDMRDKFSYSTTKIGFKRTSFLRSYMYDFIWRFAPHLTRDVVDRAIA.. 305
160 0.000e+00JCVI_PEP_1096684923503 /source_dna_id=JCVI_ORF_1096684923502 /offset=0 /translation_table=11 /length=349 /full_length=349  ali  37  112TKPDQGELNIATTDTQARYALPHIIRQFIDRYPKVNLHMHQGTPSQISEQAARGDADFAIATEAMHLYSDLIMLPCYHWNRSVVVPKDHPLATRTHISIEDLARFPLVTYVFGFDRASEIEKAFNRANLEPRVVFSATSADVLKTYVRLGLGVGVIASMAIDPNIDKDLVAIDAGHLFAHSTTKIGFRKGSFLRSYMYDFIQHFAPHLTRDVVEKAVA.. 329
161 0.000e+00gi|505299672|ref|WP_015486774.1| transcriptional regulator CysB [Thalassolituus oleivorans]  clstr ali  42  88SDERRGSLSISTTHTQARYALPGVIEGFMKHYPDVSLHMHQGTPMQIAEMAANGTTDFAIATEAMELFGDLIMMPCYRWNRSILVPKNHPLAQHPKPSLEQVAAYPLVTYVFGFTGRSKLDEAFKSRGLTPRIAFTAADSDVIKTYVRLGVGIGIVATMAVDKDLDEDLVALDASHLFASSVTKVGFRKGTFLRGFMFDFIAAFAPHLTREVIEKAAQC. 306
162 0.000e+00gi|497816188|ref|WP_010130344.1| transcriptional regulator CysB [Microbulbifer agarilyticus]  clstr ali  45  88SNDKRGSLAIATTHTQARYALPTVIKGFISRYPEVSLHMHQGTPMQISEMAADGTADFAIATEALELFSDLVMMPVYRWNRCILVPKGHELAQVPKLTLEEVAKYPIVTYVFGFTGRSKLDEAFLEKGLSPKVVFTAADADVIKTYVRLGLGIGIVADMAAVEDEDSDLVALDASDLFESSVTKIGFRKGIFLRGFMYEFFQQFAPHLTRELVDQAAQAS 307
163 0.000e+00gi|499948703|ref|WP_011629437.1| transcriptional regulator CysB [Alkalilimnicola ehrlichii]  clstr ali  44  89.DEQRGSLSIATTHTQARHALPPVVSQFRTRYPNVSLHIHQGTPMQIAEMAARGQVDFAIATEALELFEDLVMLPCYRWNRSVIVPEGHELAEVEPLTLEAIAEWPLVTYVFGFTGRSKLDEAFDARDLEPNVVFTATDSEVIKTYVRLGLGVGIIATMSFEPERDQGLLALDAGHLFEDSVTNIGFRRGAYLRGYMYEFMELFAPHLTTEVVERALQ.. 305
164 0.000e+00gi|1001839077|gb|KXS33640.1| Transcriptional regulator, LysR family [Gallionella sp. ShG14-8]  clstr ali  41  90..QNSGSLTIATTHTQARYALPPTVKQFIKRYPGVKLGLHQGNPTQIAEQVLGGAADIGIATESLALYNELVTLPCYEWNHCVIAPPRHPLLNEKKLTLAKIAQYPIITYDFAFSGRGKINAAFEAANIQPNIALTAIDADVIKTYVELGLGVGILAKMAFIPERDKHLRMMDAGHLFKPSTTRIAIRQNEYLRGYTYDFIELFAPHLTREVIAKAMHAS 307
165 0.000e+00gi|518797182|ref|WP_019953136.1| transcriptional regulator CysB [Kushneria aurantia]  clstr ali  42  88SDDRRGSLSIATTHTQARYALPAVISEFTRRYPDVALHMQQGTPRQIAQMVCEGTADFAICTESLELFNDLVLLPCYRWNRCVLVPKGHPLAALENLTLAELGQHPLVTYTFGFTGRSQLDDAFHAEGITPNVVLTAADADVIKTYVRLGLGVGIVAHMAVDPVADSDLVAIDAGHLFASSVTRIGIRRGTFMRNYMFDFLQGFAAHLDRDTVEAALEA. 306
166 0.000e+00gi|496235709|ref|WP_008949744.1| transcriptional regulator CysB [Alishewanella jeotgali]  clstr ali  43  90..PDQGKLNIATTHTQARYALPPVIRTFMQKFPRVSLHMHQGSPQQISEAASRGDADFAIATEALHLYGDLVMLPCYHWNRSIIVRKDHPLTQLTKVQIEDVARFPIVTYVFGFTGRSELDRAFAAHQLEPQIVFTATDADVIKTYVRLGLGVGVIASMAIDPQLDQDLVAIDASHLFEASTTKIGFRKGAFLRSYMYDFIERFAPHLTKDVVERA.... 304
167 0.000e+00gi|780804634|gb|KJS10008.1| CysB family transcriptional regulator [Gammaproteobacteria bacterium BRH_c0]  clstr ali  43  88SAPNRGSLSIATTHTQARYALPSVIESFIQKYPGVALHMHQGTPVQISEMAAEGNVDFAIATEALELFSDLLMMPCYRWNRCILVPKDHPLTQCERLTIEDVAAHPIVTYVFGFTGRSRLDEAFGARGLTPNVVFTATDADVIKTYVRLGLGIGIVAHMAYDPVEDDDLVALEANHLFKPSVTSIGFRRGTYLRGFMYDFIVRFAPHLTRDVVDRA.... 303
168 0.000e+00gi|517859183|ref|WP_019029391.1| transcriptional regulator CysB [Colwellia piezophila]  clstr ali  41  88TQPDEGKLRIATTHTQARYALPDVIKGFIKRYSKVSLQMSQGTPAQISDAAAKGDADFAIATESLHLYNDLVMLPCYHWNRSIIVRPDHPLANKKNITINDIAGYSLVTYVFGFTGRSELDAAFDAAGAKPQIAFTATDADVIKTYVRLGVGVGVIASMAIDKRIDGDLVVIDASHLFKASTTKIGFRRGTFLRAYMYDFIERFAPHLTKDIVTRAM... 304
169 0.000e+00gi|505245851|ref|WP_015432953.1| transcriptional regulator CysB [Bibersteinia trehalosi]  clstr ali  42  88TRPNKGVLRIATTNTQARYMLPAVISRFKTKYPEVSLHLHQGSPTQIYDALMAGEVDLAITTEAQYLFEDVISLPCYRWNRSVIVKPDHPLAQKQQLTVQQLAQYELITYTFGFTGRSDLDQAFNQEGLEPNIVFTATDADVIKTYVRLGLGVGIMASMAHTQEDD-DLIAIDASHLFQSSMTRIAFKRGMFLRNYMYDFIHYFSPHLTKMQVEQA.... 306
170 0.000e+00gi|511822724|ref|WP_016401866.1| transcriptional regulator CysB [Agarivorans albus]  clstr ali  41  88THPDQGSLNISTTHTQARYALPEVIQGFIHRYPNVSLNMHQGTPNQINEAVAKGSADFAIATEALHIFSDLVMLPCYHWNRSILVPKEHELAKKEVVTINDLAKHSIVTYIFGFTGRSDLDDAFGRAGKVPKIVFTATDADVIKTYVRMGIGVGVLASMAIDKQQDQDLVAIDASHLFRASTTKICFRKGTFLRTYMYDFIERFAPHLTRDIVDRAVQA. 310
171 0.000e+00gi|503026781|ref|WP_013261757.1| transcriptional regulator CysB [gamma proteobacterium HdN1]  clstr ali  44  88SDETKGSLSIATTHTQARYALPKVIQDFIGRFPEVALHMHQGSPVQISEMAADGTVDFAIATEALELFGDLIMMPCYIWNRAVIVPKDHPLAQVSKLTLEDIARQPIVTYTFGFTGRSRLDDAFMNAGLTPKVVFTAADADVIKTYVRLGLGVGIVARMACND-DDEGLVVLDASHLFAPSVTKIGFRKGTFLRGFMYDFIELFAPHLTKDVVDEAV... 303
172 0.000e+00gi|736861680|ref|WP_034861518.1| transcriptional regulator CysB [Enterobacteriaceae bacterium B14]  clstr ali  42  88TYPDKGALYIATTHTQARYALPQVIKGFMGRFPRVSLHMHQGSPTQIADVVAKGNADFAIATEALHLYEDLVMLPCYHWNRSVVVTSDHPLAGKTRITINDLAAYPLVTYTFGFTGRSELDAAFSRSGLTPNIVFTATDADVIKTYVRLGLGVGVIANMAVDPIEDPDLVKLDASNIFPHSTTKIGFRRSTFLRTYMYEFIYRFAPHLTRDVVDAAVA.. 305
173 0.000e+00gi|497355020|ref|WP_009669233.1| transcriptional regulator CysB [gamma proteobacterium IMCC1989]  clstr ali  43  88SNDKKGSLSLATTHTQARYMLPKIIKGFIEQYPDVSLHMNQGTPMQISEMAAGGSVDFAIATEAMELFSDLVMMPCYQWNRSIVVPKNHPLCQVSELTLEEIAKHPIVTYVFGFTGRSKLDEAFMERGLAPKIVFTAADADVIKTYVRLGLGVGIIASMAHDEELDSDLVCLDAGHLFRPSITKIGFRRGTFIRGFMYEFMENFAPHLTRTMVDEA.... 303
174 0.000e+00gi|504684338|ref|WP_014871440.1| transcriptional regulator CysB [Marinobacter sp. BSs20148]  clstr ali  40  88SNQRAGDLSIATTHTQARYALPPVIRGFLDAYPDVSLHMNQGTPTQISEMAATGTADFAIATEGMEMFNDLIMMPCYRWNRCIVVPKDHPLAAEPELTLSKLAEYSLVTYVFGFTGRSRLDEAFKSASLTPKVVFTAADADVIKTYVRLGLGVGIIASMAYDPKVDTDLVVIDASKLFDSSITHIGFRKGTFLRGYMYDFIQRFAPHLTRDVVDQVV... 304
175 0.000e+00gi|490358366|ref|WP_004238139.1| MULTISPECIES: transcriptional regulator CysB [Morganella]  clstr ali  40  88TYPEQGTLSIATTHTQARYALPPVIKGFIERYPHVSLHMHQGTPTQIAEDVCKGNSDFAIATEALHLYNDLIMLPCYQWNRAVVVRRDHPLAQRRDLTIADIAEYEIVTYTHGFTGRSELDSTFEKQGLKPKVVFTATDADVIKTYVRLGLGIGIIASMAVDPETDKDLVSIDMRDKFSYSTTKIGFRRGSFLRTYMYDFMWRFAPHLTRDVVDKAIA.. 305
176 0.000e+00gi|494014278|ref|WP_006956652.1| transcriptional regulator CysB [Idiomarina baltica]  clstr ali  42  88TQPDCGKLNIATTHTQARYALPKVIKRFIEQYPKVSLHMHQGSPTQISEAAAKGKADFAIATEALHLYQDLIMLPCYHWNRSIIVPKDHPLVQIDKLSIQDIAQHPIVTYVHGFTGRSELDKAFNAAGEEPQIVFTATDADVIKTYVRMGIGIGVVATMAYDAEEDTDLVALPAAHLFEPSTTKIGFRRGSFLRTYMFDFIENFAPHLTKSRVEEAMQ.. 305
177 0.000e+00gi|737497397|ref|WP_035476935.1| transcriptional regulator CysB [Gammaproteobacteria bacterium MFB021]  clstr ali  43  88SDERRGSLAIATTHTQARYVLPGVIGEFRQQYPDVALHMQQGTPKQIAQMVSDGTADFAICTESLELFNDLVLLPCYRWNRCVLMPKGHPLAS-GELTLERVAEHPLVTYVFGFTGRSQLDDAFKSRGLTPNVVLTAADSDVIKTYVRLGLGVGIVAHMAVDPVADADLVAVDASHLFESSTTKIGIRRGTFMRSYMYDFVKRLAPHLDRDTVEAALAA. 305
178 0.000e+00gi|696544979|ref|WP_033077868.1| transcriptional regulator CysB [Thalassotalea sp. ND16A]  clstr ali  41  88TQPDEGKLRIATTHTQARYALPEIIKGFVKKYDRVSLHMYQGTPAQISDAAAKGDADFAIATESLHLYNDLIMLPCYHWNRSIIVRKDHPLAKIGKITINDVAAHPLVTYVFGFTGRSVLDKAFQKADLEPKIVFTATDADVIKTYVRLGVGIGVVATMAIDAEQDKDLVVLDASHLFEQSTTKIGFRRGTFLRGYMFDFIERFAPHLNRDIVTKAM... 304
179 0.000e+00gi|518451510|ref|WP_019621717.1| transcriptional regulator CysB [Amphritea japonica]  clstr ali  43  88SDEKMGSLELATTHTQARYALPVTINSFMKSYPEVSLHMHQGTPMQIAEMAADGAVDFAIATEAMAHFNDLIMMPCYRWNRSVVVPKDHPLAQVSKLTLQDVAKCPIVTYVFGFTGRSKLDDAFSREGLEPKVVFTAVDSDVIKTYVRLGLGVGIIATMAFDEKLDSDLVALDASHLFEFSTTKIGFRKGTFLRGYMYDFIQQFAPHLTPDVVRQVQSCS 307
180 0.000e+00gi|1000086755|gb|KXJ54433.1| transcriptional regulator CysB [Colwellia sp. Phe_37]  clstr ali  41  88TQPDEGKLRIATTHTQARYALPEVIQGFMKKYSKVSLHMYQGTPAQISDASSKGEADFAIATESLHLYNDLVMLPCYHWNRSIIVKADHPLASKQNITIEDIAKYSLVTYVFGFTGRSELDAAFSQIGVEPKIAFTATDADVIKTYVRLGVGVGVIATMAMDPKIDNDLVTIDASHLFSPSTTKIGFRRGTFLRGYMFDFIERFAPHLNRDLVTRAI... 304
181 0.000e+00gi|736727741|ref|WP_034732084.1| transcriptional regulator CysB [Idiomarina atlantica]  clstr ali  38  88TQPDQGKLHIATTHTQARYALPSKIKLFMERYPKVSLHMHQGSPEAISAAAAKGKADFAIATEALHLYQDLIMLPCYHWNRSIIVPRGHALAAESKVSIEALGAQPIVTYVHGFTGRSELDKAFSQAGIEPNVVFTATDADVIKTYVRAGLGVGVVATMAYDPSVDGDLVALPAEHLFAPSTTKIGFRRGTFLRGYMYDFIETFAPHLTKPKVEEAMQQ. 306
182 0.000e+00gi|931447653|gb|KPK31769.1| CysB family transcriptional regulator [Betaproteobacteria bacterium SG8_40]  clstr ali  45  88TREDSGSLTIATTHTQARYALPPVIKAFREKYPGVRLSLYQGSPTQISELTSSGQADIAIATEAIEHYKDLAMLPCYQWNRCVLTPPRHPLLKVKKLTLADIARYPVITYDFAFTGRSKINQAFAAEGLTPEVVLTAIDADVIKTYVELGLGVGIVAMMAYDPDRDQRLRALDASHLFEPSTTRFGIRKDAYLRGYVYDFIEMFAPHLGRDVVDATLR.. 305
183 0.000e+00gi|738976939|ref|WP_036860349.1| transcriptional regulator CysB [Porticoccus hydrocarbonoclasticus]  clstr ali  46  89.DPRRGSLTIATTHTQARYALPPVIEAFIDKYPEVSLHMHQGTPMQISEQAVDGSVDFAIATEALELFHDLLMMPCYRWNRCILVPRDHPLAQVSKLTLEEVSTYPLVTYVFGFTGRSRLDEAFNDRGLIPKVVFTATDSDVIKTYVRLGLGIGIVAHMAYDPLKDSDLVALDASHLFKPSITSIGFRRGTYLRGYMYDFIELFAPHLTRDRITEA.... 303
184 0.000e+00gi|497408505|ref|WP_009722703.1| transcriptional regulator CysB [Halomonas sp. TD01]  clstr ali  44  88SDERRGSLSIATTHTQARYALPPIISEFTLKYPDVALHMQQGTPKQIAQMVSEGQADFAIATESLELFTDLVLLPCYRWNRCVLVPKDHPLALNKPLTLQALAEHPLVTYVFGFTGRSQLDDAFKAQGLTPNVVLTAADADVIKTYVRLGMGVGIVAHMAVDPVLDEDLVALDASHLFASSTTKIGIRRGTFMRGYMYDFLARFAPHLTRDLVDEALLA. 307
185 0.000e+00gi|325159995|gb|EGC72124.1| transcriptional regulator CysB [Haemophilus parainfluenzae ATCC 33392]  clstr ali  40  92TCPNHGVLRIATTNTQARYMLPAVVERFSKQYPDVSLHIHQGSPTQIHDALISGEVDLAITTEAPYLFDDLIQLPCYLWNRSVIVKPDHPLAKVKNLTVEELGKYPLVTYTFGFTGVSDLDYAFNRAGILPNIVFTATDADVIKTYVRLGLGVGIMASMAHTPA-DKDLVAIDAGHLFRASMTQIAFKHSTFLRNYMYDFIEFFSPHLMRPMVEKA.... 306
186 0.000e+00gi|652465619|ref|WP_026860369.1| transcriptional regulator CysB [Idiomarina sediminum]  clstr ali  41  90..PDRGKLSIATTHTQARYALPAKISKFMQRYPQVSLHMHQGSPQQISALAAKGEADFAIATEALHLYQDLIMLPCYHWNRSIIVPKDHPLANTTEVSIAQLAALPIVTYVHGFTGRSELDRAFSDAGLTANVVFTATDADVIKTYVKAGLGVGVVASMAFDPVSDEGLVALPAAHLFAASTTKIGFRKGTFLRGYMYEFLETFAPHLTKPVVEEAMQQ. 306
187 0.000e+00gi|502794190|ref|WP_013029166.1| CysB family transcriptional regulator [Sideroxydans lithotrophicus]  clstr ali  43  90..QDSGSLTIATTHTQARYALPPVVKQFTQSYPGVKLGLHQGNPTQIAEMVLGGEVDIGIATESLALYDELVTLPCYEWHHCVVVPPRHPLLQEKRLTLKKLAEYPIITYDFAFTGRNKINQAFHDAGIEPNIALTAIDADVIKTYVELGLGVGIVAQMAFIPDRDRHLRMIDAGHLIQPSTTRIAIRKNQYLRGFGYHFIELFAPHLTRDVVSKALH.. 305
188 0.000e+00gi|943608690|ref|WP_055438642.1| transcriptional regulator CysB [Idiomarina woesei]  clstr ali  38  88TQPNQGKLNIATTHTQARYALPAMIKDFMLRYPDVSLHMHQGSPEQISEAAAKGKADFAIATEALHLYQDLIMLPCYHWNRSIIAPPDHPLGQLDKVSVTDLGQYPIVTYVHGFTGRSELDKAFGEAGIKPNVVFTATDADVIKTYVRMGLGVGVVASMAIDKSHDSDLLSISAGHLFAPSTTKIGFRKGTFLRSYMYDFLEGFAPHLTRSRVDEAI... 304
189 0.000e+00gi|522072207|ref|WP_020583416.1| transcriptional regulator CysB [Endozoicomonas elysicola]  clstr ali  42  88SDERKGSLSIATTHTQARYALPGIIQQFIGQYPDVALHMHQGTPIQIAEMAADGSVDFAIATEALELFNDLVMMPCYRWNRCVLVPKDHPLAQISELTLKDIARFALVTYVFGFTGRSKLDEAFMNEGLSPRVVFTATDADVIKTYVRLGLGVGIIAKMAYDPELDSDLVPLNADHLFEPSITKIGFRRGTFLRGFMYDFIEEFAPHLTKDVVQEAI... 304
190 0.000e+00gi|494663126|ref|WP_007421070.1| transcriptional regulator CysB [Idiomarina sp. A28L]  clstr ali  40  90..PDQGTLNIATTHTQARYALPKVIQGFIDKYPDVSLHMHQGSPEQISEFAAKGKADFAIATEALHLYQDLIMLPCYRWNRSILVPPNHPLASKVDVSIQDIAEFSLVTYVHGFTGRSRLDQAFSEAGLVPKIVFTATDADVIKTYVRMGLGIGVIATMAYEKEKDSDLVAIPADHLFAPSTTKIGFRKGVFIRSYMYDFIERFAPHLTRSVIDEAIR.. 305
191 0.000e+00gi|387938592|gb|EIK45144.1| transcriptional regulator CysB [Cellvibrio sp. BR]  clstr ali  43  107SNERKGTLTLATTHTQARYALPPVIGSFIKQYPEVALHMHQGTPMQISEMAADGTVDFAIATEAMELFSDLIMMPCYRWNRSIVVPKNHPLAQVANLTLEDVAKYPIVTYVFGFTGRSKLDEAFINRGLAPKVVFTAADADVIKTYVRLGLGVGIIASMAYNETTDTDLVALDASHLFEDSVTKIGFRRGTFLRGFMYDFIEKFAPHLTKDIINEA.... 322
192 0.000e+00gi|495759527|ref|WP_008484106.1| transcriptional regulator CysB [Gallaecimonas xiamenensis]  clstr ali  40  88TQPDRGKLHIATTHTQARYALPPVIRGFIDRYPKVSLHMHQGTPTQIAEAVVRGDADFAIATEALHLYDDLIMLPCYHWNRSIVVKKDHPLAKLASIGIDELAKYPIVTYVFGFTGRSDLDEGFAKEGLEPHIVFTATDTDVIKTYVRLGLGVGVIASMAHDPVLDADLVAIDASHLFRASTTKIGFRKSSFLRGYMYDFIEGFAPHLTRAVVDEAIR.. 305
193 0.000e+00gi|738235850|ref|WP_036191164.1| transcriptional regulator CysB [Marinobacterium sp. AK27]  clstr ali  42  88SDEKKGSLSIATTHTQARYALPSAINEFIKAYPDVSLHMHQGTPMQISEMAADGTVDFAIATEALQHFSDLIMMPCYRWNRSVMVPKGHPLTQVSELTLKDVAAYPIVTYVFGFTGRSKLDDAFRHHGLEPKVVFTAVDSDVIKTYVRLGLGVGIVASMAHEAGVDDDLVALDASHLFEASTTKIGFRKGTFLRGYMYDFIRLFAPHLTPDVVRQVQAC. 306
194 0.000e+00gi|800982885|ref|WP_046009160.1| transcriptional regulator CysB [Oleispira antarctica]  clstr ali  41  88SDETKGSLSISTTHTQARYALPSVIESFMGKFPDVSLHMHQGTPMQIAEMAANGGVDFAIATEAMESFGDLIMMPCYRWNRSILVPKGHPLAGHSAPTLEEVAAYPLVTYVFGFTGRSKLDEAFKSRNLTPRVVFTAADADVIKTYVRLGVGIGIVATMAIDDELDDDLVAIDASHLFASSITQIGFRKGTFLRGYMYDFIERFAPHLTSNMVNKAI... 304
195 0.000e+00gi|551346418|ref|WP_022965829.1| transcriptional regulator CysB [Pseudomonas caeni]  clstr ali  39  88SNERIGSLSIATTHTQARYALPQVISGFMQQYPDVALHMHQGTPTQIAEMAADGTVDFAIATEGMEQFGDLIMMPCYRWNRCVVVPKGHPLASLPKLSLEALSEFPIVTYVFGFTGRSKLDEAFTEMGLIPKVIFTAADADVIKTYVRLGLGVGIVAGMAVDALQDQDLVALDASHLFESSVTKIGFRRGTFLRGFMSDFIERFAPHLDREIQAKVIQA. 306
196 0.000e+00gi|494074746|ref|WP_007016802.1| transcriptional regulator CysB [Bermanella marisrubri]  clstr ali  43  88SNENKGSLALATTHTQARYALPAIIQEFIKEFPEVSLHMHQGTPTQIAEMAADGTVDFAIATEAMDHFNDLIMMPCYRWNRSILVPKNHPLAQRSQPTLEEVATFPLVTYVFGFTGRSRLDEAFKSKGLTPKVVFTAADADVIKTYVRLGLGVGIVATMSIDPEKDNDLVAIDASHLFEDSVTKIGLRKGTFLRGFMYDFVKRFAPHLDRATIDKA.... 303
197 0.000e+00gi|517548143|ref|WP_018718351.1| transcriptional regulator CysB [Arhodomonas aquaeolei]  clstr ali  42  89.DESRGSLSIATTHTQARHALPPVVNTFRPRYPNVSLHMHQGTPMQIAEMAARGNVDFAIATEALELFEDLVMMPCYRWNRSIIVPEGHPLCSVPRLSLEAVADYPLVTYVFGFTGRSKLDQAFSDRGLEPEVVFTATDSEVIKTYVGLGLGVGIMASMAFDPERDRGLVALDASELFEPSVTSIGFRRGTYLRGYMYDFIEAFAPHLTREVVDRAVAA. 306
198 0.000e+00gi|803552786|ref|WP_046073507.1| transcriptional regulator CysB [Salinivibrio sp. KP-1]  clstr ali  42  88THPEMGNLNISTTHTQARYALPDVIKAFTARYPKVSLHMHQGTPTQISSSVAKGTSDFAIATEAFHLYEDLVMLPCYHWNRSIIVTPDHPLAQKKNITIEDLAAYSLVTYVFGFTGRSELDEAFHRANLTPKIVFTATDADVIKTYVKLGLGVGVIASMAMDSQADSDLVAIDASHIFGASTTKIGFRKGTFLRSYMYDFIERFAPHLTRNMIDKAVA.. 306
199 0.000e+00gi|654496547|ref|WP_027966332.1| transcriptional regulator CysB [Halomonas halocynthiae]  clstr ali  43  88SDESRGSLSIATTHTQARYALPPVISNFTQTYPEVALHMQQGTPRQIAHMVSEGQADFAIATESLELFSDLVLMPCYRWNRCVLVPRDHPLASETTLSLASLAKYPIVTYVFGFTGRSQLDDAFYAEGLNPNVVLTAADADVIKTYVRLGMGVGIVADMAVDRELDTDLVALDASHLFASSTTKIGIRRGTFMRGFMYDFLQGFASHLDRDLVDAALAA. 306
200 0.000e+00gi|737540158|ref|WP_035513437.1| transcriptional regulator CysB [Pseudohaliea rubra]  clstr ali  44  89.DEKKGALSIATTHTQARYVLPPVIRGFIERYPDVSLHMHQGTPMQIAELASDGTADFAIATEAMELFGDLVMLPCYRWNRSVIVPRNHPLAQGGALTLADVAAHPLVTYVFGFTGRSRLDEAFSVAGLTPRVVFTAADADVIKTYVRLGLGIGIIASMAYDPNNDQDLVALDAGHLFAPSVTRIACRRGTFLRGYMYDFIEDFAPHLTRELVQEA.... 303
201 0.000e+00gi|906863266|ref|WP_049721704.1| transcriptional regulator CysB [Gilvimarinus polysaccharolyticus]  clstr ali  45  88SNERKGSLSIATTHTQARYALPRVIKEFIGQYPDVSLHMHQGTPMQISEMAADGTVDFAIATEALELFSDLVMMPCYRWNRCIVVPRNHPLTQLSELTLEDIAQHPIVTYVFGFTGRSKLDEAFINKGLAPRVVFTAADADVIKTYVRLGLGIGIIAKMAFDETVDNDLVALDVDHLFAASITKIGFRRGTFIRGFMFDFIQQFAPHLTREVVNQA.... 303
202 0.000e+00gi|497261153|ref|WP_009575370.1| transcriptional regulator CysB [gamma proteobacterium IMCC3088]  clstr ali  44  88ADNTRGTLSVATTHTQARYVLPMVIKEFMARYPNVTLNMQQGTPAQIAAMASDGEVDFAIATEALELYDNLIMMPCYRWNRCILVPKEHPLTKVKRLTLEEVAQHPIVTYVFGFTGRSKLDSAFKRQNLTPQVVFTAADADVIKTYVRLGLGIGIVAHMAYNPSADSDLVALPAEHLFDSSVTRIGCRRGTFMRGYMYDFIELFAPHLTKERVAAAMQ.. 305
203 0.000e+00gi|495318911|ref|WP_008043658.1| transcriptional regulator CysB [Reinekea blandensis]  clstr ali  42  88SNDKKGSLSIATTHTQARYALPNVIEGFIHDYPDVSLHMHQGTPMQIAEMAADGTVDMAIATEGMDHFSDLVMMPCYRWNRSIVVPRDHPLAQKGTLTLDDVASYPIVTYVFGFTGRSKLDDAFIDKDLKPRVVFTATDADVIKTYVRLGLGVGILAHMAIDPETDRDLVSIDASHLFEASITKIGMRKGTFLRGFQYRFIERFAPHLTKAVIEEAMAC. 306
204 0.000e+00gi|495763834|ref|WP_008488413.1| transcriptional regulator CysB [Idiomarina xiamenensis]  clstr ali  41  90..PDQGKLNVATTHTQARYALPQVIKGFIERYPKVSLHMHQGSPQQISEAAAKGKADFAIATEALHLYQDLVMLPCYHWNRALIVRPDHPLAQLDNISIEDVARYPIVTYVYGFTGRSELDKAFGAAGLEPHIVFTATDADVIKTYVRMGIGIGVVASMAYEPKQDSDLVALPAGHLFAHSTTKIGFRRGTFLRTYMYDFMEAFAPHLTRDRVDKAAA.. 305
205 0.000e+00gi|921155576|ref|WP_053101673.1| MULTISPECIES: transcriptional regulator CysB [unclassified Pseudomonadaceae]  clstr ali  44  88SSESSGVLSIATTHTQARYALPSVIKRFISQYPEVSLNMQQGTPQQIAEMAADGTVDFAIATEGFEQFNELIMMPCYRWNRCVIVTRDHPLAEVKKLTLEHLAQYPLVTYVFGFTGRSKLDDAFEKAGLTPRVVFTAADADVIKTYVRLGIGVGIVARMAVDELEDDDLVILDASELFESSVTKIGFRRGTFLRGYMRDFIHRFAPHLTDEQQQKVMECS 307
206 0.000e+00gi|504807477|ref|WP_014994579.1| transcriptional regulator CysB [Alcanivorax dieselolei]  clstr ali  44  89.DETKGDLSIATTHTQARYALPPVIQKFTQRFPDVSLHMNQGTPMQISEMAADGSVDFAIATEALDLFSDLVMMPCYRWNRTVVVPEGHPLTKIKPLTLDALAEYPIVTYVFGFTGRSKLDDAFARQGLEPKVVFTAADADVIKTYVRLGMGVGIVAHMAVDPVQDKGLVNLEAGHLFEPSTTRIGFRKGTFLRGFMYEFIQLFAPHLTRDVIDAAVRAS 307
207 0.000e+00gi|258581260|gb|EEW06167.1| transcriptional regulator for cysteine regulon [Vibrio mimicus VM603]  clstr ali  40  100THPEMGTLNISTTHTQARYALPEVIKGFTKRYPKVSLHMHQGTPTQMSEAIAKGTANFAIATEALHLYQDAIMLPCYHWNRSIVVPKDHPLTKKERVTIEDLASYPLVTYVFGFTGRSELDSAFNRVGMTPKVVFTATDADVIKTYVRMGIGVGVIASMAVDKKQDTDLVAIDASHIFSASTTSIGFRRGTFLRSYMFDFMERFAPHLTRPVVEQAI... 316
208 0.000e+00gi|496173655|ref|WP_008898162.1| transcriptional regulator CysB [Rheinheimera sp. A13L]  clstr ali  43  90..PDQGKLNIATTHTQARYALPPVISGFMKKFPKVSLHMHQGTPSQIAEAASRGDADFAIATEAMHLFNDLVMLPCYHWNRSVIVRHDHPLASLSRIAVEDVAEHPIVTYVFGFTGRSELDRAFGEKGLEPKIVFTATDADVIKTYVRLGLGVGVIASMAMDKDLDKDLVSIDASHLFAASTTKIGFRKGTFLRTYMYDFIERFAPHLTREVVEKA.... 304
209 0.000e+00gi|551328181|ref|WP_022947624.1| transcriptional regulator CysB [Methylohalobius crimeensis]  clstr ali  44  89.DERSGSLTIATTHTQARYALPRVVDRFMARYPKVTLTMHQGTPMLISDLVSRGVVDLAIATEALELFDNLIMLPCYQWNRCILVPKDHPLTEKEPLTLQDVAEWPLITYVFGFTGRSRLDEAFTQQGLQPRLALTAVDADVIKTYVRLGLGVGIVARMAYDPATDSDLVALEAGHLFGPSVTKIGLRKDKFLRGYIYDFIELFAPHLTRDRVEQAM... 304
210 0.000e+00gi|515787877|ref|WP_017220318.1| transcriptional regulator CysB [Moritella dasanensis]  clstr ali  42  88THPSKGTLNISTTHTQARYALPKVIKGFIERYPDVSLNMHQGTPAQISDSVSKGTADFAIATEALHLYSDLVMLPCYHWNRSIIVKPGHPLTKVGKITVEDIAKYALVTYVFGFTGRSELDCAFDAAGLEPKIVFTATDADVIKTYVKLGIGVGVLATMAFDDATDDDLVRIDASHLFTSSTTKIGFRKGTFLRTYMYDFMERFAPHLTRDVVDKAIM.. 305
211 0.000e+00gi|654066610|ref|WP_027708234.1| transcriptional regulator CysB [Zooshikella ganghwensis]  clstr ali  45  88SNEQKGSLSIATTHTQARYALPQVIKKFIKQYPDVSLHMHQGTPMQIAELANDGTVDFAIATEALEHFSDLIMMPCYCWNRCILVPQGHPLTQVSQLTLEEVAKHPIVTYVFGFTGRSKLDEAFFNRGLTAKVIFTATDSDVIKTYVRLGLGIGIVAKMAYDAEQDSDLVALDASHLFEPSITKIGFRKGTFLRRFMYDFIEQFAPHLTREIVEEA.... 303
212 0.000e+00gi|654840223|ref|WP_028292874.1| transcriptional regulator CysB [Oceanobacter kriegii]  clstr ali  41  88SDEAKGSLTIATTHTQARYALPSVIQRFMSKYPDVSLHMNQGTPTQISEMAANGSVDFAIATEGMELFNDLIMMPCYRWNRSILVPRNHPLAQFKRPSLEQVAAYPLVTYVFGFTGRSKLDDAFKSRGLTPRVAFTAADADVIKTYVRLGVGVGIVASMAVDEEADSDLVAIDGSHLFAPSVTRIGFRKGTFLRGYMYDFIAEFAPHLTKAVIEEASACS 307
213 0.000e+00gi|739122777|ref|WP_036992366.1| transcriptional regulator CysB [Pseudomonas bauzanensis]  clstr ali  43  88SHERKGVLTLSTTHTQARYALPPVISRFMQRYPDVALNMHQGTPTQISEMAVNGTADFAIATEGMELFNELVMMPCYRWNRCVIVPKGHPLTEVGKLTLEVLSEQPLVTYVFGFTGRSKLDDAFNHQGLAPKVVFTAADADVIKTYVRLGLGVGIVAKMAVDPKIDDDLVVLDASHLFESSVTHLGFRRGTFLRGFMYDFIEEFAPHLTRERIEEVLQC. 306
214 0.000e+00gi|397744402|gb|EJK91614.1| cys regulon transcriptional activator CysB [Klebsiella pneumoniae subsp. pneumoniae DSM 30104]  clstr ali  40  149..PDKGSLYVATTHTQARYALPGVIKGFIEGYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPEHPLATKGSVSIEELAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPVSDPDLVKLDANGIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVA.. 364
215 0.000e+00gi|496010937|ref|WP_008735516.1| transcriptional regulator CysB [Alcanivorax pacificus]  clstr ali  42  89.DETRGELSIATTHTQARYALPPVIRAFTERFPDVSLHMHQGTPMQISEMAANGTVDFAIATEALDLFSDLIMMPCYRWNRTVVVPQGHPLTKVKTLTLDTLAEHPLVTYTFGFTGRSKLDEAFRSRGLTPRVVFTAADADVIKTYVRLGMGVGIIAHMALDPEQDKGLVKLDASHLFEPSTTRIGFRKGTFLRGFMYEFIRQFAPHLTRELVDSAL... 304
216 0.000e+00gi|512442491|ref|WP_016418150.1| transcriptional regulator CysB [Halomonas anticariensis]  clstr ali  44  88SDERRGSLSIATTHTQARYALPPVIREFTRKYPDVALHMQQGTPKQIAQMVSEGLADFAICTESLELFNDLVLLPCYRWNRCVLVPDDHPLAKLEELTLEALAEYPLVTYVFGFTGRSQLDDAFRAKNLTPNVVLTAADADVIKTYVRLGLGVGIVAHMAVDPESDTGLIALDAGHLFESSTTKIGIRRGTFMRSYMYDFVQGFAPHLDRDIVEAALA.. 305
217 0.000e+00gi|653061956|ref|WP_027313276.1| transcriptional regulator CysB [Balneatrix alpica]  clstr ali  42  88SNEKKGSLSIATTHTQARYALPPVIQTFMGRYPEVSLHMHQGTPMQIAELAADGTVDFAIATEAMEHFHDLIMMPCYTWNRSIVVPKDHPLAKLPKLTLEAVAEYPIVTYVFGFTGRSKLDEAFTSRGLQPKVVFTAVDADVIKTYVRLGLGVGIIATMAFQPGSDEDLVALDASHLFEPSITKIGFRRGTFLRGYMYDFIEAFAPHLRRSLVQKAI... 304
218 0.000e+00gi|494278606|ref|WP_007160555.1| MULTISPECIES: transcriptional regulator CysB [Pseudomonas]  clstr ali  43  88SNERKGTLSIATTHTQARYALPDVISEFIKQYPDVALHMHQGSPTQIAEMAADGTVDFAIATEGLERFNDLVMMPCYRWNRCVIVPQGHPLAKVEHLTLEHLAEQPLVTYVFGFTGRSKLDEAFARQGLEPNVVLTAADADVIKTYVRLGLGVGIVADMAVDHKADADLVCLDASHLFEASVTKIGLRRGTFLRGFMCDFIGRFAPHLTRDVLTEAMQ.. 305
219 0.000e+00gi|935648547|ref|WP_054488359.1| transcriptional regulator CysB [Idiomarina abyssalis]  clstr ali  42  90..PDQGKLNIATTHTQARYALPDVIERFIQHYPKVSLHMHQGSPEQISEAAAKGRADFAIATEALHLYHDLIMLPCYHWNRSIVVPKSHPLTQLSKISIDDIAQFPLVTYVHGFTGRSELDKAFAAAGHEPKIVFTATDADVIKTYVRMGLGIGVLASMAYDPKVDTDLVAIPAEHLFAHSTTKIGFRRGTFLRTYMYDFIENFAPHLTREQVQKA.... 303
220 0.000e+00gi|554245302|gb|ESG82091.1| transcriptional regulator CysB [Salmonella enterica subsp. enterica serovar Kentucky str. ATCC 9263]  clstr ali  42  52..PDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVA.. 267
221 0.000e+00gi|499150936|ref|WP_010863935.1| MULTISPECIES: transcriptional regulator CysB [Plesiomonas]  clstr ali  42  88THPERGTLNISTTHTQARYALPKVIKAFIERYPKVSLHMHQGTPAQISEAVAKGAADFAIATEALHLYHDLVMLPCYHWNRSIVVSPNHPLAHKSQITIHDLAAYPLVTYIFGFTGRSELDSAFNRAGLTPRIVFTATDADVIKTYVRLGIGVGVIASMAVDPALDKDLIAIDASHIFDASTTKIGFRKGTFLRTYMYDFMQRFAPHLTKDLVNTAI... 304
222 0.000e+00gi|488495762|ref|WP_002539206.1| transcriptional regulator CysB [Grimontia indica]  clstr ali  42  88TNPERGQLNIATTHTQARYALPDVISRFVKRYPKVSLHMHQGAPSQIADFVLKGASDFAIATEASHLYEDLLMLPCYHWTRSLIVRKDHPLAQRSSISIYDIAQYPLVTYVFGFTGRSSLDTAFNKAKLKPNIVFTATDADVIKTYVRLGVGIGVMARMAYDNELDRDLVAIDASHIFDASTTRIGFRRGTVLRSYMYDFIESFAPHLTRETIEKVMQ.. 305
223 0.000e+00gi|852217880|ref|WP_048307974.1| transcriptional regulator CysB [Halomonas sp. PR-M31]  clstr ali  44  88SNERCGNLSIATTHTQARYALPPLISEFTRKYPDVALHMQQGTPKQIAQMVCEGQADFAICTEALELFTDLILLPCYRWNRCILVPKDHPLTQVDKLTLEVLAEYPLVTYVFGFTGRSQLDDAFRNGGLKPNVVLTAADADVIKTYVRLGLGIGIVAHMAVDSELDSDLVPLDASHLFESSTTKIGIRRGTFMRGYMYDFVQRFAPHLDRDTVDAAMAA. 306
224 0.000e+00gi|516889813|ref|WP_018149999.1| CysB family transcriptional regulator [Leeia oryzae]  clstr ali  42  88SSQNAGSLTIATTHTQARYALPSVIQQFLKAYPNVSLSIKQGSPTQICEMVLSGEADLAIATEGIELFKELVMLPCYQWNRSVIVPEGHRLLDFSEITLEDIAKYPLVTYDFAFSGRSKMQKAFHAAGLEPNIVLTAIDADVIKTYVSLGLGVGIVATMAFEPARDVGLRAIDASHLFEPSTTRIGFRKDTYLRGFAYDFIHLFAPHLTRDAIERQL... 304
225 0.000e+00gi|49083660|gb|AAT51092.1| PA1754, partial [synthetic construct]  clstr ali  42  88SNEKKGTLSIATTHTQARYALPNVISGFIKQYPDVSLHMHQGTPMQIAEMAADGTVDFAIATEALELFGDLIMMPCYRWNRCVIVPHGHPLTKLPKLTLEALAEQPIVTYVFGFTGRSKLDEAFSQRGLVPKVVFTAADADVIKTYVRLGLGVGIVAHMAVDPKLDNDLVILDASHLFESSVTKIGFRRGTFLRGFMCDFIEKFAPHLTRELLAKAVQC. 306
226 0.000e+00gi|495447106|ref|WP_008171800.1| MULTISPECIES: transcriptional regulator CysB [Marinobacter]  clstr ali  41  88SNQRKGDLSIATTHTQARYALPPIISGFIEEYPDVSLHMHQGTPMQISEMAASGAVDFAIATEGMELFNDLIMMPCYKWNRSVIVPKDHPLAKLPELTLPELAEYPLVTYVFGFTGRSKLDEAFQSQGLTPKVVFTAADADVIKTYVRLGLGVGIVASMAFDPKTDTDLVALDARKLFRPSVTRLGFRKGTFLRGYMYDFIHRFAPHLTKEKVDEAV... 304
227 0.000e+00gi|938268421|gb|KPQ03620.1| transcriptional activator of cys regulon CysB [Idiomarinaceae bacterium HL-53]  clstr ali  40  88THPRKGKLNVATTHTQARYALPQVIKSFIEKYPDVSLHMHQGSPTQISEAAAKGTADFAIATEALHLYEDLIMLPCYHWNRSLLVPKGHPLTKLTQVSIQDLAAYSIVTYVYGFTGRSQLDEAFNKARLEPKIVFTATDADVIKTYVRMGLGVGVLATMAYEPSRDTDLVAIPANHLFAPSTTKIGFRRGSFLRSYMYDFMEAFAPHLTRERVDKAI... 304
228 0.000e+00gi|494438826|ref|WP_007232105.1| transcriptional regulator CysB [gamma proteobacterium HTCC2207]  clstr ali  41  90..PNKGSLSIATTHTQARYALPSVIQGFIAKYPEVSLHMHQGTPVQISEKAADGTVDFAIATEAMELYNDLLMMPCYRWNRCILVPKNHPLAQLANLTIEDVAKHPIVTYVFGFTGRSRLDDAFSKKNLEPKVVFTATDADVIKTYVRLGLGIGIVAHMAYDPELDTDLVAIEAGHLFESSVTSIGFRKGTYLRGYMYEFIHAFAPHLTRTVVDEAMA.. 305
229 0.000e+00gi|504058610|ref|WP_014292604.1| transcriptional regulator CysB [Oceanimonas sp. GK1]  clstr ali  41  88THPDQGSLNISTTHTQARYALPEVIKGFIQRYPKVSLHMHQGTPVQISESVAKGSSDFAIATEAMHLFQDLIMLPCYHWNRCILVPKDHPLASVTRPSIADIAGFPLVTYVFGFTGRSQLDVAFNRAGYEPRVVFTATDADVIKTYVRLGIGIGVLASMAVDPKEDSDLVAIDAGHLFAPSTTKIGFRKGTFLRSYMYDFMERFAPHLTRERVDKAI... 304
230 0.000e+00gi|441430021|gb|ELR67472.1| Cys regulon transcriptional activator CysB [Photobacterium marinum]  clstr ali  41  92THPEMGTLNIATTHTQARYALPSVIQGFTARYPKVSLHMHQGTPSQIADAVAKGTTDFAIATEALHLYQDMIMLPCYHWNRSIVVKADHPLAKKSEITIHDLAAYSLVTYVFGFTGRSELDSAFNRSGLTPRIVFTATDADVIKTYVRLGIGVGVIASMAMDPATDSDLVAIDASHIFDASTTKIGFKKGTFLRSYMYDFMERFAPHLTRNVVDQAV... 308
231 0.000e+00gi|765292351|ref|WP_044620063.1| transcriptional regulator CysB [Gynuella sunshinyii]  clstr ali  43  88SDEKKGSLSIATTHTQARYALPDVIEDFIKDFPDVSLHMHQGTPMQIAEMAANGTVDLAIATEAMEHFADLIMMPCYRWNRSVIVPKSHPLAHRSTLTIEELATFPLVTYVFGFTGRSKLDDAFTSRGLNPKVVFTAADTDVIKTYVRLGLGVGIVASMSMDPEQDHDLVTIDASHLFEASITKIGIRKGTFLRAYMYKFIERFAPHLTRNVVDEAM... 304
232 0.000e+00 [KEGG:K13634] LysR family transcriptional regulator, cys regulon transcriptional activator;|[COG0583] Transcriptional regulator  ali  41  129..PDKGSLYVATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLASKGSVTIEELAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPVSDPDLVKLDANGIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVA.. 344
233 0.000e+00gi|502192425|ref|WP_012729361.1| transcriptional regulator CysB [Tolumonas auensis]  clstr ali  43  88TNPDQGSLNISTTHTQARYALPEVIKGFIKRYPMVSLHMHQGSPAQISESVAKGTSDFAIATEALHLYEDLVTLPCYHWNRSVIVPKDHPLATCQQLTVEELSKYPLVTYTFGFTGRSELDAAFSRAGLIPKIVFTATDADVIKTYVRLGLGVGVIATMAIDAEADKDLVLLDGSHLFQSSTTKICFRKGIFLRSYMYDFIERFAPHLTREIVDKAIA.. 305
234 0.000e+00gi|736773367|ref|WP_034776780.1| transcriptional regulator CysB [Idiomarina salinarum]  clstr ali  38  88TQPDQGKLNIATTHTQARYALPPVIKRFMHTYPKVSLHMHQGSPEQISEAAAKGRADFAIATEALHLYHDLIMLPCYHWNRSIIVPANHPLSKQLQISITDLADYPIVTYVHGFTGRSELDRAFGAAGIKPEVVFTATDADVIKTYVRMGLGIGVIASMAYDPKVDTDLVSIPAQHLFGPSTTKIGFRKGTFLRSYMYHFIEGFAPHLTRNKVDEAMA.. 305
235 0.000e+00JGI.Meta 7045184171 C3784601__gene_310268 HTH-type transcriptional regulator cysB [Human Stool microbiome from visit number 1 of subject 158  ali  41  90..PDKGSLYIATTHTQARYALPNVIKGFIERYPRVSLHMHQGSPTQIADAVSKGNADFAIATEALHLYEDLVMLPCYHWNRAIVVTPDHPLAGKKAITIEELAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPVADPDLVRVDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDAAVA.. 305
236 0.000e+00gi|521077888|ref|WP_020408795.1| transcriptional regulator CysB [Hahella ganghwensis]  clstr ali  41  88SNQKKGELSVATTHTQARYALPSIIRSFIQEYPDVSLHMHQGTPMQIAELAADGTVDFAIATEALEHFSDLVMMPCYRWNRCVVVPKNHPLAEKRKIEIEELAGFPLVTYVFGFTGRSKLDEAFNEKGLTPKVVFTAADADVIKTYVRLGLGVGIIARMAYDPQADSDLVALDASRMFRPSTTKIGFRRGTFLRGYMYEFIHRFAPHLTRELVDEVV... 304
237 0.000e+00gi|493845306|ref|WP_006792362.1| MULTISPECIES: transcriptional regulator CysB [Pseudoalteromonas]  clstr ali  45  90..PDQGKLNIATTHTQARYALPSVIQGFMKKYPAVSLHMHQGTPQQISDAAARGDADFAIATEALHLYSDLVMLPCYHWNRSIVVAKDHPLAKKASLTVADIAEYPLITYVFGFTGRSELDKAFSAHGLEPHIVFTATDADVIKTYVRLGLGVGVVASMAIDEITDTDLVCIDASHLFEASTTKIGFRKGSFLRTYMYDFIERFAPHLTKERVERA.... 304
238 0.000e+00gi|515419080|gb|EPJ47701.1| cys regulon transcriptional activator [Osedax symbiont Rs1]  clstr ali  42  89.DERKGSLSIATTHTQARYALPLAITQFIQSYPDVSLHMQQGTPMQISEMAANGKVDFAIATEALSHFSDLIMMPCYRWNRSVVVPKNHPLAQLSELTLEALAKYSIVTYVFGFTGRSKLDDAFKQQGLEPKVVFTAVDSDVIKTYVRLNLGVGIIASMAFDPDVDTDLVAIDASHLFESSTTQIGFRKGTFLRGYMYEFISLFAPHLTPDLVREVMNC. 306
239 0.000e+00gi|488761133|ref|WP_002684341.1| transcriptional regulator CysB [Beggiatoa alba]  clstr ali  43  89SDNQSGTLSIGTTHTQARYALPPIIKQFIKKYPKVVLHMHQGTPVQISQLAAEGTVDFAIATEALELFDNLVMMPCYRWNRGILVPPEHPLAKIDKPSLADIAQYPLVTYTFGFTGRSQLDHAFTAAGLEPQVVFTASDADVIKTYVRLGLGVGIVAHMAFDPDLDEDLRMIDASHLFEPSTTRLGCRRGTFLRSYMYDFMQLFAPHLTRERVEKAMEMS 308
240 0.000e+00gi|738602480|ref|WP_036512939.1| transcriptional regulator CysB [Nitrincola nitratireducens]  clstr ali  43  88SDERKGSLSIATTHTQARYALPPTINEFIKMYPDVALHMHQGTPMQISEMAADGEVDFAIATEALAHFPDLIMMPCYHWNRSVVVPKDHPLAQVKELTLERLADFPIVTYVFGFTGRSKLDDAFIKRGLEPKVVFTAVDSDVIKTYVRLGLGVGIIASMAVDPLQDSDLVALDASHLFEASTTRIGFRKGSFLRSYMYDFIRLFAPHLTPEMVDKVQAC. 306
241 0.000e+00gi|515523948|ref|WP_016957202.1| transcriptional regulator CysB [Catenovulum agarivorans]  clstr ali  40  90..PDQGKLNIATTHTQARYALPPVIKGFMQKYPKVSLHMLQGTPSQISDAAAKGEADFAIATEALHLYNDLIMLPCYHWNRSVVVTRDHPLAKKKQITLEDVAQHSIVTYVFGFTGRSELDSAFSKAGLEPKIVFTATDADVIKTYVRMGVGVGVIATMAVDARNDTDLVAIDASHLFKPSTTKIGFRKGTFLRHYMYDFIERFAPHLTRDIVDKAIA.. 305
242 0.000e+00gi|797009676|ref|WP_045819287.1| transcriptional regulator CysB [Teredinibacter sp. 1162T.S.0a.05]  clstr ali  43  88SNERKGSLSIATTHTQARYALPKVIGSFIEKYPDVSLHMHQGTPMQISEMAADGTVDFAIATEAMDLFSDLIMLPCYTWNRCVLVPKNHPLCQLSSLTLEEVAKHPIVTYVFGFTGRSKLDEAFMEHGLAPKVVFTAADADVIKTYVRLGLGVGIVAKMAFDPEEDSDLVALDASHLFKSSTTKIGFRRGTFLRGFMFEFIEEFAPHLTKEMVSEA.... 303
243 0.000e+00gi|498320098|ref|WP_010634254.1| MULTISPECIES: transcriptional regulator CysB [Aeromonas]  clstr ali  43  88THPEQGTLHIATTHTQARYALPDVIKGFIKRFPKVSLHMHQGTPTQISEAVVKGQADFAIATEALHLYEDLIMLPCYHWNRSVIVPKGHPLTQVGKLSIADIARFPLVTYVFGFTGRSELDTAFNRAGFEPNIVFTATDADVIKTYVRLGVGIGVMATMALDPQVDTDLVALDASHLFAHSTTKIGFRKGSFLRTYMYDFMTRFAPHLTRDVVERAIA.. 305
244 0.000e+00gi|347946715|gb|AEP30065.1| transcriptional regulator CysB [Glaciecola nitratireducens FR1064]  clstr ali  44  107..PDQGKLNIATTHTQARYALPDVIKGFMSKYPRVSLHMHQGTPSQISDLAAKGEADFAIATESLHLYNDLVMLPCYHWNRSVIVNKEHPLAKKTSITIQDIAKYPLVTYVFGFTGRSELDQAFNIAGLEPKIVFTATDADVIKTYVRLGVGIGVIASMAVSDDLDSDLVKIDASHLFDYSTTKIGFRKGSFLRNYMYDFIERFAPHLTKDVVERAMMQ. 323
245 2.000e-98gi|761528689|gb|AJP49008.1| CysB family transcriptional regulator [Rhodocyclaceae bacterium PG1-Ca6]  clstr ali  45  88TAESNGTLSIATTHTQARYTLPPVIQRFLHRHPAIRLHLQQGSPAQIAQWLLDGKADLGIATETLDQHAELLTLPCYQWSHLVVAPKDHPLIAQGAPTLATLAAYPLITYDATFTGRSHIDRAFERQGLQPNVMLTAIDSDVIKTYVSLGLGLGIIAEMAFDPLRDDALAALPASHLFEANTTRLGFRRDVWLRGFEYDFIELLAPQLTKRVVAAAL... 304
246 2.000e-98gi|517971372|ref|WP_019141580.1| CysB family transcriptional regulator [Herbaspirillum massiliense]  clstr ali  45  88TGEKTGVLKIATTHTQARYVLPRVVQGFRAAFPQVRIALQQGTPEHIAEWVISGKADIAIATEGLSRFDELVSFPCYSWSHTVVVPQDHPLASRTHIRLQDLAAYPLITYDIGFTGRSHIDEAFREAGIEPDIVLTAMDSDVIQQYVALGMGVGIIASMAIDQNRTQGLQSIEAAHLFAPNVARLAVRRGAYLRSYIYDFILQFAPELKRAEIENAL... 304
247 2.000e-98gi|517544592|ref|WP_018714800.1| CysB family transcriptional regulator [Brachymonas chironomi]  clstr ali  48  88ADSAQGRLSIAATHSQARYALPHAVRDFRALFPDVTLHLHQGSPRQVADMLLSGEADIGVATEALSSHEALVTLSCYRWTHSIVLPHGHPLALQAPVSLEQLAQYPIITYEQGYTGRSHIDQAFARAGLVPEIVLTAMDADVIKTYVELGMGVGIVASIAFDPDRDRHLQALDARHLFALNVTRLGLRKGVWLRGYAYRFIEAFAPTLTMEVVERALRQ. 307
248 2.000e-98gi|498503688|ref|WP_010804378.1| CysB family transcriptional regulator [Pandoraea sp. SD6-2]  clstr ali  42  88AAQDQGSLTIATTHTQARYSLPHAVAEFKKRFPKVRLSILQGSPTQIAEMVLHDQADLAIATEAIAGYKDLVSLPCYQWQHVAVVPPDHPLLQLPSVGIEDLAKYPLITYDPQFAGRAKIDQAFALRHIQPDIVLEAIDADVIKTYVELGLGVGILAGVAFDPERDRNLRAIHVGHLFGTNVTRVALKQGAYLRGYVFTMVELLSPILTRKLVEQALR.. 305
249 3.000e-98gi|503712289|ref|WP_013946365.1| MULTISPECIES: CysB family transcriptional regulator [Hyphomicrobium]  clstr ali  51  91...DRGEITIATTHTQARYALPGPIAAFRKEFPNVHMILQQGTPKEIAAMLSDGTADIGIATEALEDTPEHVSFPFYSWHHAVIVPKGHPLADGAPLTLDKIADWPIITYHEGFTGRPAIDAAFASANLAPDIVMAALDADVIKTYVEVGLGIGIVASMAYDEQRDTGLTLLDTTHLFPQSTSRIALRRGRFLRGFAYRFIELCAPALTEKIVKAGTAA. 306
250 4.000e-98gi|647287847|ref|WP_025732748.1| CysB family transcriptional regulator [Carnimonas nigrificans]  clstr ali  46  88SNEARGELTIATTHTQARYALPPVIQAFGERYPGIALHMHQSDPRQIAQLVVDGKADFAICTEALALFNDLVVLPLYQWNRSVLVPEQHPLATLGELTLEALADLPLITYTRGFTGRSQLDSAFRKMGLSPNVVLTAADADVIKTYVRLGMGIGIVAHMA-APSQEEGLVAIDASHLFDSSLTSVGIRRGTFLRRYMLDFLERLAPHLTRERVEAAMAA. 307
251 4.000e-98gi|495148868|ref|WP_007873675.1| CysB family transcriptional regulator [Polaromonas sp. CF318]  clstr ali  47  90..QQSGLLSIAATHSQARYALPHAVQEFRSQFPNVKLHLHQGSPKQVADMLVSGEVDVGIATEALNDYPELVALPCYRWTHSVIVPPGHPLLD-GPLTLEGLARFALITYDTGFTGRSHIDGAFTQRGLAPNIVLTAMDADVIKTYVELGMGVGIVASIAYEAERDTALRALDAGALFGINLTKLAVRRGGYLRGYVYAFIESFAPTLSRAVVEKTLSE. 305
252 4.000e-98gi|501317176|ref|WP_012348811.1| CysB family transcriptional regulator [Leptothrix cholodnii]  clstr ali  47  88ASQDTGRLSIAATHSQARYALPQVVRDFRTLYPHVTLNLHQGSPRQVAEMLLSGEADIGVATEALAQYEQLVALPCYRWTHSVVVPVGHPLLDVGPITLAQLAREPIVTYDTGYTGRTHIDEAFARAGLKPAVVLTAMDADVIKTYVELGIGVGLVASIAFDAERDRNLQALDAGHLFEINLTRLAIRRGTWLRGYVYAFIEAFAPTLTREAVEQAL... 305
253 4.000e-98gi|909831314|gb|AKU14112.1| transcriptional regulator CysB-like protein [Azoarcus sp. CIB]  clstr ali  43  90TNEVAGDLSIATTHTQARYVLPRVIRDFMQRFPQVKLSLHQGSPRQVCDMVMSGEADIAIATEAIAEYDELVMLPCYQWNRCIVATPRHPILKEHPLTLEAISRYPVITYDDAFTGRSLINKAFLGRGLRPNVVLTALDSDVIKTYVAMDLGIGIVARMAYDASADKALGMADASHLFESSTTRVGLRRNAYLRGYVYAFIELFAPHLTRRMVDVALA.. 307
254 5.000e-98gi|503111289|ref|WP_013346026.1| transcriptional regulator CysB [Ferrimonas balearica]  clstr ali  38  88TQPDRGDLNIATTHTQARYALPSVIQGFIHRYPNVNLHMHQATPDQICEMAVRGDADFAIATEGMHLFHDLVMLPCYHWNRSIVFPKDHPLAQSSKVGLEELVKYPLVTYVFGFNRSSALEKAFSTVEGDPRVVFSATSADVLKTYVRMGLGVGVMATMALEHEDTEDLVVVDAAHLFEPNTTKIGFRKGSFLRTYMYDFMERFAPHLTRPRVEEAL... 304
255 5.000e-98gi|517433612|ref|WP_018604535.1| hypothetical protein [Uliginosibacterium gangwonense]  clstr ali  43  89.DEDAGKLTIATTHTQARYALPPIVAEFLRRFPKVQLHIHQGNPKQIAEQVLNGEADIGIATEALADYPELVSLPCRQWNRSIIARPGHPILRENPLSLEVIAHFPVITYDSAFAGRGAINRAFLSRGLRPNVILTALDSDVIKTYVAMDLGVGIIASMAFDPLVDRGLQAIDASHLFESSTTRIGLPRNAWLRGYAYAFIELFAPHLSRKMISAAI... 304
256 6.000e-98gi|500197160|ref|WP_011870367.1| CysB family transcriptional regulator [Herminiimonas arsenicoxydans]  clstr ali  47  88AGQEIGTLAVATTHTQARYMLPEVVQAFRAEFPKVRIALQQSSPEHIAEWVLSGKADIGIATEGLSQFEDLVSFPCYRWHHAIVVPQGHALLSHAPVTLEALAKYPLITYDLGFTGRGHIDDAFKSADIAPDIVLTAMDSDVIQQYVSLGLGVGIVASMAVQHNGSHGLAVIDGSHLFAQNVTRLAVRRGAYLRQYTYSFIQQFAPELTRADIDRALKPA 307
257 7.000e-98gi|551358031|ref|WP_022977386.1| CysB family transcriptional regulator [Nevskia ramosa]  clstr ali  46  91...DRGDLSVATTHTQARYALPPVISGFRQAWSQVALHLHQGSPPQIAKMAVEGTADFAIATEALEHFDELVMLPCYHWNRSILVPPTHALAQRQELTLEAIAEHPVITYTFGFTGRSKLDQAFAAQGLKPDVVLTAVDADVIKTYVRLGLGIGIVASMSHDETLDADLVSLPVDHLFEPSTTHIGFRQGMFLRGYMFDFMQRFAPHLTRELVEAVAA.. 310
258 8.000e-98gi|759669381|ref|WP_043386905.1| transcriptional regulator [Comamonas aquatica]  clstr ali  47  92....QGQLSIAATHSQARYALPQVVQEFRQHYPQVRLHLHQGSPKQVAQMLLSGEADLGVATEALAGYEGLVTLPCYRWTHSVVLPPGHSLLQHEPLTLQDLAAFPIITYEQGYTGRAHIDEAFEREGLAPDVVLTAMDADVIKTYVELGMGVGIVASVALDPERDLHLHALDAGHLFEVNVTRLGLRRGAWLRGYAYDFMQRFVPTLTREVIAQTLQ.. 306
259 8.000e-98gi|517253225|ref|WP_018442043.1| CysB family transcriptional regulator [Burkholderia sp. JPY347]  clstr ali  47  88ADEDTGHLVVATTHTQARYALPQVIREFKEVFPKVHLALRQGSPRQIAQMLVEGEADIAIATEGLDRYSDIVTFPCYSWHHIVVVPKGHPLAAVKTVTLEDVAEHPIITYERDITGRAHIDEAFEKTGRLPDVVLTAIDADVIKTYVELGMGIGIVAAMAYDPKRDSELVALESQHLFEASTTRVGLRKGAILRAYAYRFIEMFAPQLAGTDITGRLREA 307
260 9.000e-98gi|500089052|ref|WP_011765065.1| CysB family transcriptional regulator [Azoarcus sp. BH72]  clstr ali  50  88AQKDKGHLAIATTHTQARYALPPVVTRFKEEFPKVHLELHQCGPKEIVSLLRSGQVDIGIATEALGEEDDLVSFPFYQWQHTLIVPEDHPLTRVQPLTLEAVAEYPIITYHEGFTGRTRIDAAFARAGITPDIVMSALDADVIKAYVELGHGVGIIAAMAFHPQRDAGLKLLDSKGLFEMNTTWISLRRGHYLRGYALRFIECCSPALTESRVRDAVFP. 306
261 1.000e-97gi|506246692|ref|WP_015766467.1| CysB family transcriptional regulator [Candidatus Accumulibacter phosphatis]  clstr ali  44  88AGGDSGSLVIATTHTQARYALPAVVKNFVDRHPKVRLSLHQGHPTQIAEWTLKGEADIAIATEALDQYPQLVMLPCYQWVHCVIAPDGHPILAEKSLSLAALARWPLITYDSAFTGRSRINKAFELAQLTPNVVLTAIDADVIKTYVSLGLGLGIIARMAFDPLRDVGLQAMAAEHLFGSNTTRIGLRRGTHVRRYEYDFIELFASHLTRKAVDMAMA.. 305
262 1.000e-97gi|495560950|ref|WP_008285529.1| CysB family transcriptional regulator [gamma proteobacterium HTCC5015]  clstr ali  44  89.DDNKGTLTLATTHTQARYVLPAVIRQFSAEFPEVKLNLIQGSPERISRMAVSGEADLAIATEAIASYSDLVMMPAYRWNRCLVVPRGHELTFAKKISLGALAQYPMVTYVKGLTGRGVMDEAFAKEGLSPEIVFTATDADVIKTYVRLGMGVGLIARQAYENRLDSDLVAVDVGHLFQDSITYVGFRSGAYMRKYMLRFLELFSPQFDRDQIEK..... 302
263 2.000e-97gi|739473391|ref|WP_037333292.1| CysB family transcriptional regulator [Salinisphaera hydrothermalis]  clstr ali  43  88ADTDRGSLRVATTHTQARYALPATIAGFRQAYPRVSLHINQGAPPQIAGWAAAGDADFAIATEALEHYDELIMLPCYHWNRCVLVPTDHPLADGSPLTLERIAEHPLVTYTFGFTGRSQLDTAFTERGLTPDVVLTAVDADVIKTYVRLGLGVGVIANMAYDPANDADLVSLDASHLFSSSTTHIGFRHNLFLTGYMRRFIRMFAEHLTEDVIDRAIDA. 306
264 2.000e-97gi|655087680|ref|WP_028535670.1| transcriptional regulator [Paludibacterium yongneupense]  clstr ali  50  91...ETGNLVIATTHTQARYVLPSVITQFRKDYPKVHLVLHQGSPGEIADMLREGRADIGIATEGLASQPDLATFACYDWQHAIIVPDGHPLTREPRLTLESIARYPLVTYHLGFTGRANIDRRFAEAGLQTDIVLSAIDADVIKAYVETGLGVGIIAEMAFDPERNSGLTLLPTHDLFVTNTTHLALRRGRYLRSFAYRFIEYFVPELDEESIERSL... 304
265 2.000e-97gi|519025882|ref|WP_020181757.1| MULTISPECIES: hypothetical protein [Methylotenera]  clstr ali  42  91...ETGTLTIATTHTQARYKLPSAVQQFIQMFPNVKLTIHQGNPSQVASQVASGEADIGIATESISLDERLLTLPCYQWNRCLVMPSYHPLASKKSISLADIGSYPLITYDFAFTGGTLVSQVFHDAGVTPNIVLTAIDADVIKTYVNLGLGIGLIANMAYDEKRDAPLISLDCSHLFPDSTTYLGVRRDAFLRGYMLSFMQLLSPDINLKAIEQTL... 304
266 3.000e-97gi|475052585|emb|CCU63152.1| Cys regulon transcriptional activator CysB [Nitrosospira lacus]  clstr ali  43  102ANEATGSLTIATTHTQARYALPAAIKHFTACYPKVKLILRQGNPTQISELVTSGEADIAIATEAIASFEELVMLPCYQWNRCVIVTPRHPLLKLEKLTLEAIAQYPIITYDFAFTGRSKINQAFDAKGLTPNVVLTAIDADVIKTYVELGLGVGILAQMAFEPKRDKHLRSIDASHLFESSTTRIGISRNSYLRGYVYDFIETFAPHLDHATIIAAMKQ. 320
267 3.000e-97gi|655492330|ref|WP_028873750.1| CysB family transcriptional regulator [Tepidiphilus margaritifer]  clstr ali  43  91...DEGVLSIATTHTQARYVLPTVIRNFRERFPKVRFSLHQGSPRQVCEMVIAGEADLAIATEGIGDFPELVELPCYQWTHALVVPKGHELATLEPLTLEAIARHPVITYDGAFTGRNHINKAFLGRALRPEVILTALDSDVIKTYVRMGLGVGILAKMAFDPAADADLVCRDLGHLIESNTTRIGILRDAYLRGFVFAFIEAFAPHLKRDVVERALR.. 305
268 3.000e-97gi|655012344|ref|WP_028461400.1| CysB family transcriptional regulator [Nitrosomonas cryotolerans]  clstr ali  42  89.HEANGTLTIATTHTQARYALPPVIQRFTARYPKVKLILRQGSPTQISALVTSGEADIAIATEGIELFHELVMLPCYQWNRCVIAPARHPLLKLKELTLEAISLYPIITYDHAFTGRSKVNQAFEAKGLTPNVVLTAIDADVIKTYVELGLGVGILAKMAFDSARDKQLRSIDASHLFEPSTTRIGISRNSYLRGYTFDFIEMFAPHLNQDAVKDAI... 304
269 5.000e-97gi|970438268|ref|WP_058719447.1| transcriptional regulator [Paucibacter sp. KCTC 42545]  clstr ali  43  88SKQDNGTLSIATTHTQARYVLPSPVSQLRRQLPQVRVSLHQGNPEQVVRWLLDDSADVGLATESLAQIDELVSLPCYEWQHVLVVPSDHPLAQVERVSLDKLAAEPIVTYHPSFTGRTRIDRAFAARHLQPNIVLEAIDSDVIKTYVRLGMGLGIVAEMAVREDPPGDLVSRPLGHLFGQNVTRIAFKRGAYLRNYVYTFAELLSDRLNRHLLERAM... 305
270 5.000e-97gi|655953842|ref|WP_028996749.1| transcriptional regulator [Azohydromonas australica]  clstr ali  47  88AAQGKGTLTIAATHSQARYALPAAVRDFSERYPEVALRLKQGSPQQVAELLIEGEADIGVATEALASYPELVALPCYSWTHAVIVPPGHPLAQEAALTLERLAAFPIVTYEPGYTGRSHIDEAFERRGLKFDVVLSAMDADVIKTYVELGMGVGIIAAIACDEERDQRLTVLDARHLFATNMTRLAVRRGSFLRGFVFDFIHCFAPPLNREQVERAMAA. 310
271 6.000e-97gi|497776780|ref|WP_010090964.1| MULTISPECIES: CysB family transcriptional regulator [Burkholderia]  clstr ali  44  88AAQDQGNLTIAATHTQARYSLPAAIAEFKKRFPKVHLSILQGSPTQVAEMVIHDQADLAIATEAIADYKELVSLPCFQWHHAVVVPADHPLLERKPLTLDDLAQYPLITYDDAFAGRRKINHAFALRGLSPDIVLEAIDADVIKTYVELGLGVGIMADIAFNPERDRNLRLIPVGHLFGSNVTRVALKQGAYLRSYVYTLVELLSPTLNRKLIEQAL... 305
272 7.000e-97gi|655952967|ref|WP_028995887.1| CysB family transcriptional regulator [Azonexus hydrophilus]  clstr ali  45  91...DSGKLVLAATHTQARYALPTVVRDFVARHPNVKLEMHQGNPLQIADWVASGEADIGIATESLDQHPQLVSFPVQQWTHCVIAPAGHPILSSQPLALQELARWPLITYDAAFTGRSRINRAFERLEIEPNIALTALDADVIKTYVSLGLGLGIIAKLAFDPQRDVGLVAIDAGHLFESNTTRLAVRRGSYLRRFDYDFIELFAPHLNKRVIEMTLQ.. 305
273 9.000e-97gi|490769812|ref|WP_004632041.1| MULTISPECIES: LysR family transcriptional regulator [Ralstonia]  clstr ali  41  88AAQDQGNFTIATTHTQARYALPKAIAEFTRRYPKVRLSIQQGTPAQIAEMVLHDQADLAIATEGMSHVKDLISIPGYQWQHVVVTPPDHPLLSRQHLTLDDLKGYPIITYDHHFAGRPKIDHAFELRQIKPDIVLEAIDADVIKTYVEVGLGVGIVAGVAFDAERDRNLRAIPAGHLFGTNVTHLGVKQGAYLRGFVYTFIELFAPTLTRKLVEQLM... 304
274 1.000e-96gi|503303875|ref|WP_013538536.1| CysB family transcriptional regulator [Variovorax paradoxus]  clstr ali  47  90..QQSGLLSIAATHSQARYAMPVAVQEFRAQFPNVKLHLHQGSPKQIAQMLIDGEADVGIATEALGDYPQLVALPCYRWTHSVIVPPGHPLLD-APLSLEALTRYPLITYDTGFTGRSRIDEAFEARGLQPNIVLAAMDADVIKTYVTLGLGVGIVAGVAYEAERDTQLRAIDAGRLFGINLTKLAVRRGNYLRKYVYAFIESFAPTLTRAIVEKALGD. 305
275 1.000e-96gi|404628320|gb|EKB25104.1| hypothetical protein HMPREF1168_00145 [Aeromonas veronii AMC34]  clstr ali  43  121....SGVLRIATTHTQARYKLPAVITEFSRRYPDVAIQLHQGAPAQLAQMVQSGDVDMAIATESMYLFDELAAVPCYRWGRSVVVPHGHPLIDCQPLSMADLARYPLITYVFGFTGRSKMDKAFSRHGLSPKTVLTATDTDVIKHYVRLGMGVGVIASVAFDEGDREALVSLNIDHLIASSATHICLRKHAHLRDYMYDFIHLYAPHISRETVQ...... 330
276 1.000e-96gi|737402335|ref|WP_035383509.1| transcriptional regulator [Ferriphaselus sp. R-1]  clstr ali  47  91...DEGRLTVVTTHTQARYALPSVVAKFKQAFPKVHLVLHQGSPTEIVKMLLEGHADIGLATEALDGVENLVSFPYYQWHHAVIVPAGHPLESAQPLTLEAIADHPIITYHEGVTGRTRVDQTFERVGLSPEIVMSALDSDVIKTYVELGMGVGIIASMAFEPARDSQLRLLDCAHLFEPNTTRIAFRRGHYLRGFAYRFMEYCSPALTEAVIGAA.... 303
277 2.000e-96gi|971864309|ref|WP_058933198.1| transcriptional regulator [Roseateles depolymerans]  clstr ali  52  91...DQGQLTIATTHTQARYALPQVVARFKAAYPRVHLVLHQGSPAEIVSLLQSGEADVGIATEALGRDEAFVTFPFYEWHHAVVVPQGHPLAAQ-PLTLEALAEQPLITYHEGYTGRARIDASFAQAGLAPDIVMSALDADVIKTYVQVGLGVGIIAAIAFEPNRDAGLQRLDASHLFPVNTTRIALKRGHYLRGFAYRFLQECVDSLTEERVKAAM... 303
278 2.000e-96gi|835431703|ref|WP_047503972.1| transcriptional regulator [Methylibium sp. CF468]  clstr ali  47  88SAQTSGRLSIAATHSQARYALPAVVRDFRQLYPQVTLNLHQGSPKQVAEMLLSGEADIGIATEALAGYEQLVALPCYRWTHSVVVPIGHDLLKQEPLTLQRLARYPIITYDVGYTGRTHIDEAFAAEGLKPSVVLTAMDADVIKTYAELGMGVGIVASIAFDPERDRQLRAIDARDLFAVNLTRLAVRRGTWLRGYVYSFIEAFAPTLTRETVERSLN.. 306
279 2.000e-96gi|817529561|gb|KKO72960.1| transcriptional regulator [Kerstersia gyiorum]  clstr ali  43  88ARRDEGGLTIACTHTQARYMLPKVIPAFRQRFPKVHLSLAEGSPRQLAEMVLHGQADLAIATESLALTPGLVTLPCYTWEHVVVVRPDHPLADLRSLSLEQLAEYPIVTYDRAFSGRTAIDDAFAGQRIHPDIVLEAIDADVIKTYVDVGMGIGIIAGVAYDPRRDSGLVGLPVGRLFGTHTTRIGVKAGVFLRDYVYTFLEMAAPQLTREVVQQAIME. 311
280 2.000e-96gi|950254813|ref|WP_057291331.1| transcriptional regulator [Noviherbaspirillum sp. Root189]  clstr ali  45  88AGEKSGTLSVATTHTQARYVLPQVVQSFRSTFPNVRIALQQSAPEHIAEWVISGKADVGIATEGLSQFEELVSFPCYQWSHVIVVPEEHPLTRLHSVSLEDLAAYPLITYDVGFTGRSHIDDAFRQAGISTDIVLTAMDSDVIQQYVSLGLGVGIVASMAVEQNRGGRLHAIEVPHLFAPNVTRLAVRRGAYLRSYTYEFILQFAPELKRSDIETALNMS 307
281 2.000e-96gi|504516402|ref|WP_014703504.1| CysB family transcriptional regulator [Methylophaga frappieri]  clstr ali  39  89.NEFQGTLSIGTTHTQARYALPPAIHQFARDFPNVHLNMVQGTPPEVAEMAATGKVDMAIATEGLSQFDNLAILPCYQWNRTIVMPPSHPLAKIKKPKLADIAEYPILTYVMGFTGRAQQDQAFIEKGLKPNVIFTATDADVIKTYVELGLGIGIIASMAFDAKKDKPLVAIDASNLFQPSTTHLGIRKGSHLRQFSYAFIRYFAPHLEQNIIEQAIH.. 305
282 2.000e-96gi|835443420|ref|WP_047507943.1| transcriptional regulator [Methylibium sp. CF468]  clstr ali  42  88SKQDAGTLSIATTHTQARYFLPEPVAQLRKRFPKVNISLHQGAPAQVAQMVIEEVADIGIATESLAEHDELVTLPCYEWQHAVVMPAGHPLAQLERITLEDLAQQPLVSYHPSFSGRTRVDQAFAARRLKPNIVLEAIDADVIKTYVRLGMGIGVLAEIAVRDDPPNGLVSRPVGHLFGSNVTRVAFKRGAYLRNFVYAFAEMLSDRLNRGLIARAM... 305
283 2.000e-96gi|503772912|ref|WP_014006988.1| CysB family transcriptional regulator [Collimonas fungivorans]  clstr ali  44  88SGETSGTLTVAATHTQARYALPRVVQGFRASFPDVRIALQQSSPEHIADWVISGKADVGIATEGLTQFKELISFPCYEWSHVLVVPENHPLLESEPISLADLAAYPLITYDIGFTGRGHIDDAFRTAGITPDIVLTAMDSDVIQQYVSLGLGVGLVASMATEHSRQNGLRSIEVSHLLASNVTRLAVRRGAYLRSYTYDFILQFAPQLKREDIVEALQA. 307
284 3.000e-96gi|1004707328|gb|KYC29480.1| transcriptional regulator [Sterolibacterium denitrificans]  clstr ali  51  91...EQGNLIVATTHTQARYALPAVIKQFRACYPKVHLTLHQSSPREIAEMLVAGEADIGIATEGLGDVPGLVTLPCYAWHHGVIVPQGHPLTQLPALTLEALAAHPIVTYHAGFTGRSHIDSAFAAAGLEXDVVLSAIDADVIKTYVEIGLGVGIVASMAFDPAKDAGLRLLDADALFASNTTLLAVHRGVFLRDYVRRFITMLAPGVSEEGLKEALAD. 306
285 3.000e-96gi|499247418|ref|WP_010944958.1| transcriptional regulator CysB [[Haemophilus] ducreyi]  clstr ali  37  88TCPNYGMLRIATTNTQARYMLPSIIEKFKAKYPAVSLHLCQGSPSQIYDALMAGEVDLAIITEAQYLFEEAILLPCYLWNRSVIVKPDHPLAQSHHLTVKELSQYDLITYTFGFTGQSDLDHAFNKAGIVPKIMLTATDAGVIKTYVRLGLGAGIMASMAYT-ASDHDLVAIDASHLFQPSMTQIAFNRGTFLRNYMYDFINYFSPHLTKMQVEKA.... 306
286 3.000e-96gi|500120111|ref|WP_011796116.1| CysB family transcriptional regulator [Acidovorax citrulli]  clstr ali  47  93.....GRLSIAATHSQARYALPQVVRDFRALFPQVTLHLHQGSPRQVAEMLLSGEADIGVATEALAGYGELVTLPCYRWSHSIVVPPGHPLLDLEPPTLRQLARFPIITYELGYTGRAHIDEAFAREGLQPDVVLTAMDADVIKTYVELDMGVGIVASIALDPERDRHLRMIDARHLFEVNLTRLGLRRGSWLRGYAYRFIEAFVPTLTREAVDEALRAA 308
287 3.000e-96gi|917068938|ref|WP_051675650.1| transcriptional regulator [Polaromonas glacialis]  clstr ali  43  88ASQQSGLLSIAATHSQARYALPMAVQAFRAQFPDIKLHLHQGSPEQVAEMLLSGEADVGIATEALAQYDELIALPCYRWTHSVIVPPGHALLD-EPLTLQRLAGYTLITYDTGFTGRTRIDEAFKAQHLTPDITLNAMDADVIKTYVELGMGVGIVASIAFEAERDLALRAIDAGELFGINLTKLAVRRGTYLRGYVYAFVESFAPMLTRSIVEQALSSA 306
288 3.000e-96gi|946916764|ref|WP_055839397.1| transcriptional regulator [Xylophilus sp. Leaf220]  clstr ali  47  90..QQQGQLSIAATHSQARYALPTAVHEFRTRFPDVRLNLHQGSPRQVAEMLLSGEADVGIATEALDSYDLLLALPCYRWTHSVVVPRGHPL-EAGPLTLARLAEFPLITYDNGFTGRTHIDGAFAQQGLVPDIVLSAMDADVIKTYVALGMGVGIVASIAYEDERDTGLSARDAGLLFGINLTKLAVRRGAYLRGYVYSFIESFAPTLARSVVERALQD. 305
289 3.000e-96gi|1003318608|gb|KXW58866.1| HTH-type transcriptional regulator CysB [Ferrovum sp. Z-31]  clstr ali  40  102SRQRAGQLTVATTHTQARYVLPPVIVQFAQRYPEVKLVLHQGNPLHVAQEVVAGRADLAIATEGLDLFPDLRILPCYQWNRILVAKPDHPLLALEHLTLEALAQYPMITYDHAFTGRARINQAFERQGLSPNVVLTALDADVIKTYVRVGMGVGVIAAMAYDQNLDRDLRARDMAHLFEPSLTRIALRAGTYLRGFVYDFIQLFAPALDRTRVENALAA. 320
290 3.000e-96gi|502020624|ref|WP_012696093.1| CysB family transcriptional regulator [Laribacter hongkongensis]  clstr ali  44  95.......LTIATTHTQARYALPVAVKAFRQRYPEVTLRIKQGSPVQICEMVVAGEADFAIATEGITLFDELVALDCYQWNRSVVVPLDHPLTRLRPITLADIAAWPIITYDFAFAGRNKINSAFEEAGLEPNFVLTAIDTDVIKTYVALGLGIGIIATMAYEPDRDTQLDLIHAEHLFRPSTTRIGVRRDVYLRGYAYHFIEQFAPHLTRPVVEQALA.. 306
291 4.000e-96gi|518802849|ref|WP_019958803.1| hypothetical protein [Vitreoscilla stercoraria]  clstr ali  40  88SEQDAGSLTIATTHTQARYVLPQIISEFVTRFPKVQLSIKQGPPNAICDMVMEGDADFAIATEEIDDYPELSKLPCYQWNRSVVVPDGHPLLDLRPLRIADIAQYPLVTYEFAFTGQSQIARGFIRAGPPPHVALSAVDTDVIKTYVRLGLGVGLIASMAFVPEEDSGLHLIDAEHLFEPSTTQIALRQDSYLRGFAYDFIQLFEPTLTRERISQILYA. 308
292 4.000e-96gi|950263766|ref|WP_057299994.1| transcriptional regulator [Pelomonas sp. Root1217]  clstr ali  42  88SRQDSGTFSIATTHTQARYVLPAPVAQLRKNLPQLRISLHQGSPDQVAKMLLDETADLGLATESLAQYPELVTLPCYEWQHVMVVPRDHPLASVERVSLEQLAGEPLVSYHPSFTGRTRVDKAFAARHLTPNVVLEAIDSDVIKTYVRLGMGVGIVAEMAMREEPASDLVARPLGTLLGSNVTRIAFKRGAYLRNYVYAFAELLSERLSRKLIEKAMN.. 306
293 4.000e-96gi|338806872|gb|AEJ03114.1| transcriptional regulator, LysR family [Nitrosomonas sp. Is79A3]  clstr ali  45  88TNEAGGTLTIATTHTQARYALPPVIKRFTERYPKVKLILRQGSPMQISALVTSGEADIAIATEAFEQFPELILLPCYQWNRCVVVPPKHPLLKLKKLSLEAINQYPIITYDFAFTGRSKINQAFASRGLEPNVVLTAIDSDVIKTYVELGLGVGILANMAFDSKRDKNLRSIDASHLFEPSTTRIGISRNSYIRGYVFDFIEMFAPHLDHANIQAKLESS 307
294 4.000e-96JGI.Meta 7050847452 SRS064449_LANL_scaffold_27769__gene_28895 cys regulon transcriptional activator [Human Supragingival plaque microbiome f  ali  43  147TDHDSGSLTIATTHTQARYALPEIVARFVRSYPKVQLTIKQGSPSAIAQMVSGGEADIGIITEAIDDHPELCKLPCYEWNHAVIVPQDHPLLDRHPLSLKDLASFPLVTYEFAFNNGSSIARAFARARLEPDVALSAADTDVLKTYVKLGLGVGVMAKMAYNPQADQDLQLIDAAHLFEPSPTWIALRSDTYLRGYTYDFINLFAPKLN........... 357
295 5.000e-96gi|930603316|ref|WP_054255636.1| transcriptional regulator [Acidovorax caeni]  clstr ali  47  91...DRGGLVVAATHSQARYALPAVVRDFRQHFPRVSLHLRQGSPRQVAEMLLSGEADIGVATEALAGYEQLVTLPCYRWSHSIIVPPGHPLLALEPVTLQALASYPIITYEAGYTGRSHIDESFAQAALAPDVVLTAMDADVIKTYVELGMGVGIVASIAFDAERDRHLRAIDARHLFEVNLTRLGLRRGGWLRGYAFRFIETFVPTLTREEVLRALAQ. 308
296 5.000e-96gi|497236413|ref|WP_009550675.1| transcriptional regulator [Burkholderiales bacterium JOSHI_001]  clstr ali  44  88SQQDAGTLSIATTHSQARYFLPEPVAQLRRRYPKVQVSLHQGMPGQVARMLLDDVAEIGIATEALSDHDELVTLPCYDWQHVLVVPQRHPLAGVERPTLEQLAAEPLVTYHPTFTGRSRIDSAFARARLTPTVALEAIDSDVIKTYVRLGMGVGIVAEMSVREDPPGDLVARPLGHLFGRNTTRVAFRRGAYLRQFVFAFAEMLSERLTRALIQRAM... 305
297 5.000e-96gi|971868204|ref|WP_058937092.1| transcriptional regulator [Roseateles depolymerans]  clstr ali  49  91...DSGHLRIAATHSQARYALPPAVRDFRNSHPEVSLQFQQGTPQQVARLLMDGEADIGIATEALAEHPELLTLPCYRWTHTVLVPHDHPLARERPLTLEQLGRHPIITYESGYTGRSHIDQAFAAAGVDLNVVLVAMDADVIKTYVELGLGVGIVAAIAYDEERDRQLRAIDARHLFADNLTRLAVRRDAYLRDYVYAFIETFAPPLTRELVEQA.... 307
298 5.000e-96gi|947610230|ref|WP_056273396.1| transcriptional regulator [Pelomonas sp. Root405]  clstr ali  50  92....SGRLRIAATHSQARYALPPAVRDFRAHHPDVSLHLQQGSPQQIARLLLDGEADVGIATEALTQYPELVALPCYRWTHSVVVPPDHPLLD-GPLTLARLAQFPIVTYEPGYTGRSHIDEAFAAAQLAPHIVLSAMDADVIKTYVELGLGVGIVAAIAFDEERDRHLRAIDARHLFADNMTRLAMRRSAYLRDYVYEFIQTFASPLKREVVDAA.... 302
299 5.000e-96gi|640444253|ref|WP_024902674.1| transcriptional regulator [Paraburkholderia andropogonis]  clstr ali  40  88AAQDQGNLTIAATHTQARYALPAAVADFRKRFPKVHLSILQGNPTQVAEMVLRDQADLAVATEAIADYPGLTTVPCFQWMHVAIVTHDHPLASRGELSLEDLVQYPLITYGSAFAGRTKIDQAFERRGLTPDIVLEAIDSDVIKTYVELGLGVGIMSDMAYQADRDKSLKAMSVGHLFGSNVTRIALKQGAYLRSYIYTLVELLSPQTDRKLLDQALR.. 305
300 8.000e-96gi|503723758|ref|WP_013957834.1| LysR family transcriptional regulator [Cupriavidus necator]  clstr ali  43  88AAQDQGNFTIATTHTQARYALPRVISEFTKRYPKVRLSIQQGNPAQIADMLLHDQADIGIATEGISADKNLVSLPGYQWTHMVITTPEHPLLDKKHLALEDLMGYPLITYDANFAGRTKIDKAFALRHLEPDIVLEAIDADVIKTYVEIGLGVGIVAGVAYDAERDRNLRGIPAGHLFGSNVTHLAVKQGAYLRSFVYTFIELFSPTLNRKLVEQAM... 304
301 9.000e-96gi|269208840|gb|EEZ75295.1| transcriptional regulator CysB-like protein [Neisseria lactamica ATCC 23970]  clstr ali  39  100TGHDSGSLTVATTHTQARYALPLIVADFVKRYPKVNLTIKQGSPSAIVRMTASGEADLAIVTERIDDGPELAGLPCYEWTHAVIVPGDHPLLERNPLRIEDLARFPLVTYEFAFNAGSSIARAFAKARLEPDVALAAADTDVLKTYVRLGLGVGLMAKMAYNPDTDGDLQLVDAAHLFEPSPTWIALRSDTYLRGYAYDFIQAFAPHLTREKVDRILY.. 319
302 1.000e-95gi|516744392|ref|WP_018078620.1| hypothetical protein [Thiobacillus denitrificans]  clstr ali  43  88SNPGSGELSIATTHTQARYVLPPVIRAFRRIYPELSLHLHQGSPAQIAEMAASGGVDFAIATESLHLFDELIMLPCYRWNRAVVVPGGHALEKVAPLTLEAVAEYPILTYVFGFTGRSRINDAFQQRGLAPRVALTATDADVIKTYIRLGLGVGILAEMAQDEGLDSDLSFLDASFLFEPSITRIGFRKGLFLRACHYDFIRIFSGHLSREVVDQATKAS 307
303 1.000e-95gi|503199679|ref|WP_013434340.1| cys regulon transcriptional activator [Paraburkholderia rhizoxinica]  clstr ali  41  88AAQDQGNLVIAATHTQARYSLPRAVAEFKKRFPKVHLSILQGNPTQVAEMVLHDQADLAIATEAISTYKDLVSLPAFQWHHLAVTPPEHALLDKKEITLDDLAQFPLITYDNAFAGRSKINQAFALRGLTPDIILEAIDADVIKTYVELGLGVGIMADVAFNAQRDRPLRAIPVGHLFGTNTTRVALKQGTYLRGYIYTFIELLSPTLNRKLIEQAMR.. 306
304 1.000e-95gi|327549026|gb|EGF33635.1| Alkanesulfonate utilization operon LysR-family regulator CbI [Oxalobacteraceae bacterium IMCC9480]  clstr ali  45  88AGKKSGTLTVATTHTQARYVLPRVVQAFRAAFPEVRIALQQSSPEHIAEWVLSGKADVGIATEGLSQFDELVSFPCYAWNHAIVVPDGHPLLALASVSLQELGGYPLITYDVGFTGRGHIDDAFRQAGIATDIVLTAMDSDVIQQYVALGMGVGIVASMAIEASQRNGLKAIAASHLFAPNVTRLAVRRGAYLRTYTRDFILQFAPELTRADIDEAM... 304
305 1.000e-95gi|160364558|gb|ABX36171.1| transcriptional regulator, LysR family [Delftia acidovorans SPH-1]  clstr ali  46  101SAQDSGTLSIATTHTQARYVLPPAVARLRDLYPKVTISLHQATPAEVARMVIDEIADIGMATESLADYPDLVTLPCYEWQHVLVMPTGHPLAQKERITLDDIAHESLITYHPSFTGRGKIDQAFATRRLRPRIVLEAIDSDVIKTYVRLGLGIGIVAEMAMRDDPVNDLVVRPMGHLFGQSVARVAIKRGAYLRNFVYRFAELLSDRLTRDLIMRAM... 317
306 1.000e-95gi|489143751|ref|WP_003053515.1| CysB family transcriptional regulator [Comamonas testosteroni]  clstr ali  44  91...ERGGLSIAATHSQARYALPQVVRDFRRLYPQVSLHLHQGSPRQVAEMLLSGEADIGVATEALGSYENLVTLPCYRWSHSVVVPPGHALLDAGPLTLEDLARHPIITYEQGYTGRAHIDKAFAAAALVPEVVLTAMDADVIKTYAELGMGVGIIASIAFDAERDRHLRAIDARHLFEVNLTRLALRRDAWLRGYAYAFIESFVPTLKPEVVRAALQSA 308
307 1.000e-95gi|497543678|ref|WP_009857876.1| CysB family transcriptional regulator [Rubrivivax benzoatilyticus]  clstr ali  48  88AGQGKGTLVIAATHSQARYALPTAVRDFRAAHPDVQLRLHQGSPQQVAELLLEGEADLGVATALIATCPDLVALPCYRWTHSVVVPAGHVLAQEAPLTLERLAEFPLITYEPGYTGRSQIDEAFSQKGLVLDLVLSAMDADVIKTYVELGMGVGIIAAMAWDEQRDPGLRAIDARHLFATNMTHVGLRRGAYLRDYVYDFIRTFAAPLDRALVDRALAA. 310
308 2.000e-95gi|496218362|ref|WP_008932399.1| CysB family transcriptional regulator [Ectothiorhodospira sp. PHS-1]  clstr ali  41  89.DEERGTLRIATTHTQARYFLPPLITQFRRRYPRVHLLIHQGTPVQISQMAASGEVDFAIATEAIALNRELLMIPAYRWHHCVVVDKGHPLTGVKSLALEDVAGYPIVTYVHGFSGRGRLEQDFANAGLAPEIVLSAADSDVIKTYVRLGLGIGIIAHMAYEPGQDTDLAYLDAKSLFRENVTRVGFRKGVYLRRFMCHFMDLLAPHAGEERVQEALNA. 306
309 2.000e-95gi|260221629|emb|CBA30384.1| HTH-type transcriptional regulator cbl [Curvibacter putative symbiont of Hydra magnipapillata]  clstr ali  46  88SSQLEGQLSVAATHSQARYALPHVVKDFRDKFPKVTLHLHQGSPKQVAAMLLSGEADIGVATEALADYAQLVTLPCYRWTHSIVVPPGHPLLEQEPVTLRQLAHYPIITYELGYTGRAHIDNAFAAESLRPDVVLTAMDADVIKTYVELGMGVGIVASVALDAERDRNLRILDAGHLFQVNVTRLGLRKGVWLRGYAYSFIETFVPTLNKAVVARTLVEA 308
310 2.000e-95gi|496240476|ref|WP_008953861.1| CysB family transcriptional regulator [Pseudogulbenkiania ferrooxidans]  clstr ali  46  88SQRDQGQLTIATTHTQARYALPKVVTAFKQAFPKVHLVLLQASPDELVRLLLDGQADIGIATEAISAVPELVSFPYYRWHHTVIAPPGHPLHGVKPLTLEALADYPLVTYHEGFTGRAQIDRAFAEAGLVPDVVMAALDADVIKTYVELEMGVGIVASMAVDAQRDQGVAEVDSVPLFGHQTSRIAVRRGHYLRSYAYRFIELCSAELDETTVCQALVPA 307
311 2.000e-95gi|490279076|ref|WP_004175017.1| LysR family transcriptional regulator [Nitrosospira lacus]  clstr ali  44  88SGHKRGNLTVATTHTQARYVLPDVIKCFMLDVPEVHLFLHQGSPKEIAELLLSGDADIGIATETLAQIPDLISFPCYEWEHGVIVPNDHPLLALDNVTLEDLSKFPVITYHPSFTGRSHVDHAFRKANLEPDIVITAMDADVIKTYVGLGLGIGVVSSLAFSTERDVSLALIPAGHLFGSNFARIAVRRGHYLRGFAYDFIERLAPDLTESALRSKIYA. 306
312 2.000e-95gi|519012711|ref|WP_020168586.1| MULTISPECIES: CysB family transcriptional regulator [Methylotenera]  clstr ali  43  91...ETGTLTIATTHTQARYTLPAAVKQFIHAYPHVKLNIHQGDPSQVTAQVASGEADIGIATEKISLDDRLLCLPCYEWNRCIVVPKGHRLIDALPLTLSKVASFPLITYDFAYTGSITVAKVFHDAGVMPNIVLSAIDADVIKTYVGLGLGVGLIANMAYDEERDKDLVRLDCSHLFPASTTYLGVRKDAFLRNYIYGFIELLIPKFDRKAVDEAL... 304
313 2.000e-95gi|655048990|ref|WP_028497574.1| CysB family transcriptional regulator [Microvirgula aerodenitrificans]  clstr ali  38  88AREEEGELTIATTHTQARYALPTAVQAFLKRYPKVSLRIKQGNPIQICEMVVAGEADFAVATESIDQFSELTALDCYQWNRSVVAPLGHPILSLDPLTLADIAAWPIVTYDYAFAGRNNINRAFELSGIEPNIVLTAIDTDVIKTYVGLGLGVGIIATMAFEPERDTQLGFVHAEHLFLPSTTRIGIRRDAYLRGFAYHFIELFAPHLTRQVVDRSMR.. 306
314 2.000e-95gi|821528854|ref|WP_046850776.1| transcriptional regulator [Nitrosomonas communis]  clstr ali  48  88SQHDQGQLTIATTHTQAQYALPPMVRQFKQAFPKVHLVLHQSSPSEIVSMLLDGQADIGIATEALENTADLISFPYYTWHHAIIVPAGHPLQSVAPLTLEAIVEFPIITYHHGFTGRSRIDKTFAQAGLEPDFAMSALDADVIKTYVALGLGIGIIASGAFVPERDSMLVKLDASHLFEQNTTYISIRQNRYLRDFAYYFIELCIPTL............ 295
315 2.000e-95gi|748791563|ref|WP_040039574.1| transcriptional regulator [Herbaspirillum sp. TSA66]  clstr ali  46  88SGEKSGTLSIATTHTQARYVLPRVVQAFRESFPQVRVALQQSSPEHIAEWVISGKADIGIATEGLSQFEDLISFPCYSWNHMIVVPQAHPLAALERVTLKDLSAFPLITYDVGFTGRSHIDDAFAQANIGTDIVLTAMDSDVIQQYASLGLGVGIVASMAVEHNCASGLIALEAAHLFAPNVTRLAVRRGAYLRTYMLDFILQFAPQLSRADVETALR.. 305
316 2.000e-95gi|760018648|ref|WP_043701821.1| transcriptional regulator [Tepidimonas taiwanensis]  clstr ali  45  88AAQDSGTLSIATTHTQARYVLPAPVARLRQTYPKVGVRLHQGSPDQVARWVLDDVADIGIATESLAHYEDLVTLPCYEWQHALVLPAGHPLLEREQIGLDDLAAQPLITYHPTFTGRTRIDQAFAQRGLTPQIVLEAIDSDVIKTYVRLGMGVGIVAEMAVQEERSPDLIARPAGHLFGQNVARVAFKRGAYLRQFVLRFAEFLSDRLSRELILRAM... 305
317 3.000e-95gi|518929118|ref|WP_020084993.1| hypothetical protein [Hyphomicrobium zavarzinii]  clstr ali  49  91...DSGTLNIATTHTQARYMLPPVIARFKAAFPDVRLVLHQASPKEIAAILLEGQTDLGIATDTLEDNPGLLAFPYHRWSHGLVVPKNHPLLGVEPLTLEAVADYPIITYDEGLTGRARIDQAFEKAGVEPDIAMSALDADVIKAYVELGLGVGIIASMAFDPERDQALSLIECTHLFDENVSSLAVRRGRFLRSYVYRFIELCAPEISEQKVRRA.... 303
318 3.000e-95JCVI_PEP_1096694953869 /source_dna_id=JCVI_ORF_1096694953868 /offset=0 /translation_table=11 /length=335 /full_length=335  ali  44  109ASQDQGSFVIATTHTQARYALPKVLTEFTKRFPKVRVSIQQGSPGQIAELLIHDRADIAIATEGIANTPGVLALPGYQWHHVVMVPLSHPLLNQSTITLEEIAKYPLITYDRAFAGRSKIDAAFAQRNLSPDIILEAIDADVIKTYVETGMGVGIVAGLAYDTDRDRNLRVIPVGHLFGNNVTHLGVKQGAYLRSFVYTFIELFSPTLTKKIVEQAMN.. 326
319 3.000e-95gi|751595133|ref|WP_041063328.1| transcriptional regulator CysB [Candidatus Tachikawaea gelatinosa]  clstr ali  36  90..PDKGILSIATTHTQARYALPDVIKNFVKRYPQVSLHINQGSPAQIIEAVSKGNADFFIATESIYNHNDLIMLPCYSWNKIIIVKQDNPLSGKNNISLEALAKFPLVICTFGLNNHSELDLIFNRAGLTPKIVFTATDADIIKTYVRLGLGVGIIADMAFDPVYDKDLVRIESINIFDSSTIKIGFRRNKFLRGYMYDFIQRFASHLTRKVVDTAI... 305
320 3.000e-95gi|651965929|ref|WP_026686623.1| CysB family transcriptional regulator [Azovibrio restrictus]  clstr ali  43  88SGGDTGTLIVAATHTQARYALPPAVKDFVTMHPKVQLTLHQGTPAQIADWVEKGDADIGIATESLESHPGLVTLPVRQWSHCVIAPAGHPVLHSQPLSLAELARWPLITYDSAFTGRSGINRAFQRQGLEPQVVLTALDADVIKTYVTLGLGLGIIAALAFDKERDAGLEALEAGHLFESNTTRLALRRGVFLRRFEYDFITLFAPHLDRRAVERVLQ.. 305
321 4.000e-95gi|655158630|ref|WP_028605235.1| transcriptional regulator [Ottowia thiooxydans]  clstr ali  44  88SAQDSGTLSIATTHTQARYVLPVPVARLRETYPKVNISLHQGSPDQVARMVIEETAEIGMATESLANYPELVTLPCYEWQHVLVLPHSHPLAKKERIALEDIAAEPLITYHPSFTGRTRIDTAFAQRHLEPRIALEAIDSDVIKTYVRLGLGIGIVAEMAMKGDADQDLVSRPLGQLLGQNVARIALKRGAYLRDFVYQFASLLSDRLDRNLIMKAM... 304
322 4.000e-95gi|497971059|ref|WP_010285215.1| CysB family transcriptional regulator [Pectobacterium carotovorum]  clstr ali  65  88TNNDTGQLVIATTHTQARYSLPPVIKAFRSLYPQVRLVLNQGTPDEIVAMLHSGEADIGIASEQLINDPSLAAFSYYRWHHSVIVPEHHPLTQEPVITLEMLNAEPLITYRQGITGRSRLDRAFQAVGMSPDITLSAQDSDVIKTYVELGLGVGIVADMSFDPVRDKGLVRLNAEHLFEANTVWLGLKKGQLQRNYAWKFIQLCNTELSLDDIK...... 301
323 4.000e-95gi|490281532|ref|WP_004177436.1| LysR family transcriptional regulator [Nitrosospira lacus]  clstr ali  50  88SNKDQGRLTIATTHTQARYALPSVVTRFKKAFPNVHLILHQSSPGEIVSMLLDGVADIGIATEALESVVELASFPYYSWHHAVIVPPGHPLESAHPLTLEAIAEFPVITYHEGFTGRSGIDETFAKAGIVLDIAMSALDADVIKTYVELGLGVGLVASMAFNPVRDTQLHLLDSSHLFQKNTTNISVRRGHYLRGYAYRFIELCLPSLTEAAIR...... 301
324 4.000e-95gi|505249752|ref|WP_015436854.1| CysB family transcriptional regulator [Azoarcus sp. KH32C]  clstr ali  49  88SNRDEGRLTVVTTHTQARYALPKVVTAFKKAFPKVYLKLHQGSPEEIVSMLLDGQADIGIATEAVAAVAELASFPYYTWHHSIIVPAGHPLENVRPLTLEAVAEYPLITYHEGFTGRSNIDKSFAAAGLSPEVVMSAMDADVIKTYVELGLGVGIVASMAFQPEREGELRLLDSRHLFPVNTTSIAVRRGHYLRGFAYRFIEMCSPTLTEAAIRSSVAPA 307
325 5.000e-95gi|497237410|ref|WP_009551672.1| CysB family transcriptional regulator [Burkholderiales bacterium JOSHI_001]  clstr ali  47  90..QDRGSLTVAATHSQARYALPHAVRDFSALHPDVSLRMHQGTPRQVAEMLLSGEADIGVATEALASYPDLVALPCYQWTHSVIVPPTHPLAQERPLTVERLSHFPIITYETGYTGRSHIDEGFARERLQANIVLEAMDADVIKTYVELGMGVGIVAAIAYDEQRDTRLRAIDARHLFAANMTRLAIKRGAYLRSYIYDFIQTFASPLTRPVVDAALA.. 309
326 5.000e-95gi|502736643|ref|WP_012971627.1| CysB family transcriptional regulator [Allochromatium vinosum]  clstr ali  44  89.QETAGCLTIATTHTQARYVLPPAIRDFIARYPDVRLSLRQGNPTQVCDLVIAGEADLVIATEAVAEAPELLSLPCYAWNRCVIAPLGHPILESDPLSLEAIARWPIVTYDGAFTGRGLMNRAFHTHGLEPRIVLTALDADVIKTYVRMGLGIGLIAQMAHDPQTDAGLGVVDASHLFDASVTHLGIRRKSWLRGYVYAFIEGFAPHLTRRVIERALSE. 306
327 6.000e-95gi|655951303|ref|WP_028994242.1| transcriptional regulator [Azonexus hydrophilus]  clstr ali  48  88SQRDVGQLTVAATHTQARYALPRVIAEFKKAFPRVHLKLHQGSPQEIVDLLLEGEADIGIATEAVAGHPELAAFDFYHWHHALVVPAGHALLTAARPSLEAIAEYPVITYHEGFTGRAGIDRVFAEAGLVPDVVMSALDADVIKTYVELELGIGIVASMAFHPKRDEGLVMIDCQHLFPLNTTHIAIRRGHYLRGFAYRFIELCAPALNEARVRAV.... 303
328 6.000e-95gi|518929127|ref|WP_020085002.1| hypothetical protein [Hyphomicrobium zavarzinii]  clstr ali  48  88ANKDRGQLDVATTHTQARYALPHVVAKFRNAFPNVHLVLHQGSPTEIARMLADGTADIGIATESLQDAPELVSFPYYTWHHGVIVKAGHALEQEDKLTLDALAEWPLITYSEGFTGRPKIDKSFADAGIVPDIVLSALDADVIKAYVELGLGVGIVASQAFDPVRDPQLRLLDATHLFQENVSRIAVRRGAYLRGYAYRFIEYCAPTLTEPVVRASIEAT 307
329 7.000e-95gi|440052128|gb|AGB82031.1| transcriptional regulator [Serratia marcescens FGI94]  clstr ali  64  95...DDGQLHIATTHTQARYSLPRVIKEFRALYPRVRVVLNQGTPEEIAAMLASGEADIGIASERLINDDALAAFPYYRWHHAILVPENHPLTQAGPLTLEQLSTQPLITYRQGITGRSRLDAAFKAAGLTPDIALSAQDSDVIKTYVELGLGVGVLADMSYEKERDRGLVSLNAEHLFEPNTVWLGLKRSQLQRNYAWRFIQLCNPTLTLTEIKEKVFSA 311
330 7.000e-95gi|497412643|ref|WP_009726841.1| cys regulon transcriptional activator CysB [Methylophaga lonarensis]  clstr ali  41  89.HENKGTLSIGTTHTQARYALPAAIQEFSKHYPDVHLNMVQGTPTEVAEMASTGHVDIAIATEGLSQFENLAILPCYQWNRSALVTPGHPLLEQ-PLTLEALSEYPLLTYVMGFTGRAQQDMAFTERGLRPNVVFTATDADVIKTYAALGLGVGIIASMAFDAEKDAPLIALDASHLFQSSTTHMGIRKGSYLRGFSYAFIQYFAPHLSRDVISEAIR.. 304
331 8.000e-95gi|639198560|ref|WP_024537000.1| transcriptional regulator [Comamonas badia]  clstr ali  46  88SAEDSGTLSIATTHTQARYVLPTAVARLREQYPKVTISLHQAKPDEVARMVLDEAAEIGMATESLSDYPELVTLPCYEWQHVLVLPATHPLASRERIDIEDLAHEPLITYHPSFTGRSRIDQAFAARRLQPRIVLEAMDSDIIKTYVRLGMGIGLVAEMATREGLPPELVARPCGHLFGRSVTRIALKRGAWLRHFVYRLAELVSDRLSRELIERAM... 304
332 9.000e-95gi|502736638|ref|WP_012971622.1| CysB family transcriptional regulator [Allochromatium vinosum]  clstr ali  50  88AQQDTGHLAIATTHTQARYALPPVVTRFKSHFPRVHLELHQCGPGEIVERLRSGEADIGIATEALADEPDLVSFPFYEWRHALIVPEGHPLTVAGPLTLETIAEYPLITYHPGYTGRARIDAAFARAGLVPEIVMSALDADVIKAYVELGLGVGLIAAMAWHPARDAGLRLIELPDLFETNTARLGLRRGRYLRDYALSFIRACAPELTADRIREAVFP. 306
333 1.000e-94gi|928997583|ref|WP_054021772.1| transcriptional regulator [Ideonella sakaiensis]  clstr ali  48  88THRDEGRLTVATTHTQARYALPQVVRRFKAAFPKVHLVLLQGSPTEIGERLRAGEADIGIATEQVDAGPGFVDFPFYDWHHAVVVPEDHPLADGRPLSLEALADHPLITYHEGFTGRGRIDATFAAAGLVPDVVMSALDADVIKTYVEVGLGVGIVASMAVDPARDLGLRRIDAAHLFERNTTHISVHRGRYLRGYAYRFLEECSPALTPAVVRAALEA. 309
334 1.000e-94gi|737207070|ref|WP_035191893.1| CysB family transcriptional regulator [Acidithiobacillus ferrivorans]  clstr ali  42  91...DYGRLVVATTHTQARYVMPKAVKIFAERYPGVHLRLRQGSPTQIAEMLATGDVDIAIATEALNSHIGLVALSCYQWNRAVVAPRGHPILEKRPLTLKSIAAYPIVTYDTAFAGRSAIDKAFAAQGIKPNVLLSAIDSDVIKAYVELGLGIGIVAQMAYDPARDSTLGVADASHLFEPSTTYLALRQGSYLRRYIYAFIEIFAPHLDRLTVDMALAA. 306
335 1.000e-94gi|502188700|ref|WP_012728247.1| CysB family transcriptional regulator [Tolumonas auensis]  clstr ali  51  88ANSDRGRLHVATTHTQARYALPGIIKEFRTQYPQVQLVLHQGSPSEIVSMLLSGETDIGLTSELMADYEEIAAFPYYSWHHAILVPRGHPLTELPEVTLEDLSAWPLVTYQTGLTGRTKIDAAFAMAGIVPDIVLSAQDSDVIKTYVELGLGVGILADMAIDAVKDSNLVRLNAEHLFPANTAWFGMKKGKFQPNFAWHFLQICNPSLAISDIQAQVFAT 307
336 1.000e-94gi|655955243|ref|WP_028998126.1| transcriptional regulator [Azohydromonas australica]  clstr ali  44  90..QDAGRLSIATTHTQARYVLPEPVALLRKRHPKVSVSLHQGTPEQVAAMLLDDSADIGLATESLSEYGDLVTLPCYEWQHVIVVPATHPLAGVERPTLEQLAREPLVSYQPAFTGRKRIDQAFAQRRLQPEVVLEAIDSDVIKTYVRLGLGVGILAEMAVRDDPPGDLVARPAGHLFGMNVSRVAFKRGAYLRNFVYSFAELLSDRLTRTLINRAMA.. 306
337 2.000e-94gi|495157559|ref|WP_007882362.1| CysB family transcriptional regulator [Herbaspirillum sp. CF444]  clstr ali  47  88AGEQSGTLTIATTHTQARYVLPRVVQAFRAAFPQVRIALQQSAPEHIAEWVMSGKADVGIATEGLSQFKDLVSFPCYTWNHVIVVPQGHPLLSRHPITLEELAAHSLITYDVGFTGRGHIDDAFRTAGIEKDIVLTAMDSDVIQQYVALGLGVGIVASMAIEQGKHHGLEAIEASHLFAQNITRLAVRRGAYLRAYTYDFILQFAPELKRADIVAALNE. 307
338 2.000e-94gi|655049233|ref|WP_028497817.1| transcriptional regulator [Microvirgula aerodenitrificans]  clstr ali  45  88SQRDQGQLTVATTHTQARYALPRVITAFKAAFPRVHLVLHQASPDELVRLLLDGQADIGIATEAIADVPELASFPFYSWHHSVIAPVDHPLQQAQTLSKEAISEYPIVTYHHGFTGRAQIDRGFAEAGLTPDIVMTALDADVIKTYVELGLGLGIVASMAVDPSRDHGITELKGPPLFGSQTTRLAIRRGHYLRSYAYRFIELCSSSLDEQTVRQALQLS 307
339 2.000e-94gi|941922641|gb|ALK92132.1| HTH-type transcriptional regulator CysB [Limnohabitans sp. 103DPR2]  clstr ali  43  88SAQHNGTLSIATTHTQARYVLPVPVARLREQYPQVNISLHQGSPDQVARMLLDDTAEIGMATESLADYDDLVTLPCYEWQHMLVLAPDHPLAKKKHLHLEDIAKEPLITYHPSFTGRTRIDAAFESKKLHPRIALEAIDSDVIKTYVRLGLGVGIVAEMAVKDDPVGDLVARPLGDLLGKNVARVAFKRGAYLRNFVYQFAELLSDRLTAALVAKAM... 304
340 2.000e-94gi|931391578|gb|KPJ81085.1| CysB family transcriptional regulator [Gammaproteobacteria bacterium SG8_30]  clstr ali  43  89.DETRGSLSIGTTHTQARYVLPSIVKRFRQHYPDVKLHLHQGTSEQIADLAAEDRVDFAIATGSRDLFPSLALMPCYRWHRDLLVPRTHPLAGIDKPTLKDVAKHPVVTYVFSFSGRSSLPSLFERAGLKLNVALTARDADVIKTYVRLGLGVGIVACMAIAEGEDTDLVAIDGSHLFPEHVTWLGARRGRLLRGYMYDFMQLFAPHLTRKLVDRALRA. 306
341 2.000e-94gi|398094975|gb|EJL85326.1| transcriptional regulator [Pantoea sp. GM01]  clstr ali  73  130TNETSGVLTIATTHTQARYSLPRVIKAFRQLYPNVRLELNQGSPQEIVAMLLAGEADIGIASEQLVNNSSLAAFPWFSWHHSLLVPHDHELLQHQPVTLASLSRYPLITYRQGITGRSRVDRAFQAAGLRPDIVLSAQDSDVVKTYVELGLGVGILADQACDIYEGEDLVKIDTHHLFDANTVWLGLKRGQLQRNYVWQFLELCNANLSLEEIKRQ.... 345
342 2.000e-94gi|498315611|ref|WP_010629767.1| CysB family transcriptional regulator [Halomonas sp. KM-1]  clstr ali  48  88THEDQGSLAIATTHTQARYALPPIIARFKQIFPKVHLELHQCGPDEIVSLLKAGKVDIGIATEALHEEGQLACFPFYHWYHGVIVPEGHPLDNGESLTLERIAEHPIVTYHEGFTGRARIDRAFSAAEVMPDIVLTALDADVIKTYVELGLGVGLIASMAYHEERDRGLTLLDASNLLPRNTTYLALRRGHFLRAYAYRFLQLCREDLDESTVQQVLA.. 306
343 3.000e-94gi|985874738|gb|KXB31745.1| transcriptional regulator [Dechloromonas denitrificans]  clstr ali  44  88ASRETGHFVVATTHTQARYALPKIIQWFKADYPKVHLTLLQGSPREIAELVETGQADVGIATEALEGVPELVSFPFYSWHHAIIVPQGHPLLSVEKVTLEILAEYPIITYHEGFTGRAHVDKAFSEAAIVPDIVLSAIDADVIKTYVSLGLGVGVVASVAYDKEQDRNLELIPVPDLFPSNTTRIAVRRGTYLRSYAHAFIEKVCPDVGEESIKSAL... 304
344 3.000e-94gi|983021615|gb|KWT65993.1| Alkanesulfonate utilization operon LysR-family regulator CbI [Hyphomicrobium sulfonivorans]  clstr ali  46  88SKTDSGDLTIATTHTQARYALPPVVVQFKKAFPNVRLILHQASPKEILSMLMDGSADIGVATEALEDKPEIAAFPYYSWEHAVIVPRGHPLTQAESLTLAMIAEWPIITYDAGFTGRSHIDAAFDAAGLEPDIVMTALDADVIKTYVELELGVGIIASMAHDKARDS-VELLSADGLFARNTSRIAVRRGRYLRGFAYKFIELCSPELTEPVVRAKLNP. 305
345 3.000e-94gi|1002742030|gb|AMN45944.1| CysB family transcriptional regulator [Steroidobacter denitrificans]  clstr ali  40  89.DDGRGTLSIGTTHTQARYVLPSVIRTFRQRYPQVELHLHQGTSEQIAEMASLDRIDFAINTGSQEMFTNLVLLPCYRWHRRLVVPHGHPLENEAKVTIETLAKYPIVTYVFSYSGPSSLQQIFARAGKTPNVALTARDADVIKTYVRLGLGVGVIASMAIDPREDADLVSIDASHLFPAHLTWIGFHQGALLRSYMYEFLQAIGPHLTRRLVDRAGNAS 307
346 3.000e-94gi|740375531|ref|WP_038210759.1| transcriptional regulator [Xenophilus azovorans]  clstr ali  49  88AAQHSGRLSIAATHTQARYALPEAVQDFRRQFPGVRLHLHQGSPRQVAQMLIEGEADVGIATEALADYPQLAALPCYRWTHAVIAPPDHPVL-RAPLSLEALARHPLITYDAGFTGRTRIDEAFARAGLAADIALAAMDADVIKTYVELGMGVGIVAGVAFEAERDTRLRAVDAGALFGINHTRLAVRRGSFLRNYVYAFIEAFAPTLTREAVDAAIA.. 304
347 3.000e-94gi|502353711|ref|WP_012770387.1| CysB family transcriptional regulator [Dickeya chrysanthemi]  clstr ali  63  88SDNDVGQLVIATTHTQARYSLPEIIKAFRSLYPQVQLVLNQGTPDEIVAMLESGEADIGIATEQLMNVNSLAAFPWYRWHHAVLVPEGHTLALASPITLDTLSEVPLITYRQGITGRSRIDRAFAAAGLTPHISISAQDSDVIKTYVELGLGVGIVADMSFDAVRDPGLVRLDAGHLFDDNTVWLGLKRGQLQRNYIWKFIQLCNPELSQDDIKSRVFA. 306
348 3.000e-94gi|495140510|ref|WP_007865317.1| transcriptional regulator [Polaromonas sp. CF318]  clstr ali  44  88SAQDSGTLSIATTHTQARYVLPQPVAKLREAFPKVNVSLHQGSPDQVARMVLDEVAEIGIATESLTQYDDLVTLPCYEWQHMLVIPVDHPLAKKENISLEDLAEEPLITYHPSFTGRTKIDLAFAAKRLQPRIALEAIDSDVIKTYVRLGLGVGIVAEMAIEDGTNSDLIAIPAGPLFGINVARVAFKRSAYLRNFVYKFAELLSDKLDRALITKAMA.. 306
349 4.000e-94gi|640449192|ref|WP_024904604.1| transcriptional regulator [Paraburkholderia andropogonis]  clstr ali  42  88AAQEAGRLVLATTHTQARYALPKVIERFREAYPKVHLALRQGSPTQVAEMVLSGEADLGIATEALNRYPDITTFSSYSWHHVITVRRGHPLAEAKQVGLADIAGYPIITYDKDFSGRPHIDAAFEKAGLAPDIVLTAMDADVIKTYVEVGLGVGILAAMAVDPVRDDHLVVFDTPDMFEPNTTRIGIRNGTYLRTYTYRLIEMLAPHLREDEIRSRLSE. 306
350 4.000e-94gi|817106267|ref|WP_046479595.1| transcriptional regulator [Candidatus Filomicrobium marinum]  clstr ali  44  88SQTDRGELTVVTTHMQARYALPPIVAKFKQTFPDVHLVLHQASPAETASMLLDGSADVGVATDALIDNPDLISFPFYSWHHAVIAPKGHPLEKVTPLTLEAIAEYPIITYNPGFTGRAGIDAAFASAGLSPDIVMAALDADVIKAYVELGLGVGIIASMAFDPTRDTKLTLLDSTPLFQKNTSRIALRRGRYLRGFVYRFIEFCSPELTEGLVR...... 301
351 4.000e-94gi|518389214|ref|WP_019559421.1| MULTISPECIES: CysB family transcriptional regulator [Caldimonas]  clstr ali  42  88SKQDAGTLSIATTHTQARYVLPTPVAQLRKRFPKVSVSLHQGTPEQVAQMLLEETAEVGLATESLANFEDLVTLPCYEWTHVVVLPSQHRLAASQRLSLDDLASEPLISYHPSFTGRTKIDQAFAQRRLKPNIVLEAIDSDVIKTYVRLGLGVGIVAEMAVRDDPTGDLVWRPAGHLFGHNLARIAFKRGAYLRNFVYAFAELISERLNRNLIMRAM... 309
352 5.000e-94gi|552554509|ref|WP_023009813.1| hypothetical protein [Marinobacter sp. EVN1]  clstr ali  50  90..QDSGELTIATTHTQARYALPEVVSQFKQQFPKVRLRLHQGSPDEIVSMLLSGEADIGVATEALGDIPQLVSFPYHRWHHGVVVPKLHPLTEIERLTLEDIQHYPIITYHEGFTGRASIEKAFATENLRPEIIMTALDADVIKSYVELRLGIGIIASVAFNPARDSGLQLLNTDHLFEEKQTRIGIRRGNLLRNYAFQFIQLCAPELTEDVVAGQLA.. 305
353 7.000e-94gi|761528584|gb|AJP48903.1| transcriptional regulator [Rhodocyclaceae bacterium PG1-Ca6]  clstr ali  50  88AHRDQGQLTLVTTHTQARYALPAVVAKFKAAFPKVHLALHQAGPQEIVTLLHAGDADIGIATEALEGEPDLVTFPWYEWHHSVIVPDRHPLASEPVLTLAKLAEHPLITYHEGFTGRGTIDRTFADAGLVPDIILSALDADVIKTYVELELGAGIIASMAFDPRKDTGLTLLDGVQLFPANTTRIGVRRGHYLRSYAYRFIELCSEQLTETTVRAA.... 303
354 7.000e-94gi|836609467|ref|WP_047761419.1| CysB family transcriptional regulator [Neisseria sp. KH1503]  clstr ali  37  88TDQNTGSLTIATTHTQARYVLPPIVAKFVERYPKVQLSIRQGNPHSISQMVASGEADFAIATESLEEHTDLRKLPCSEWTHAVIVPKEHALLDQRPLTLEDLSTYPLITYEFAFNNGSSIARAFQKAYIEPKVALSSADTDVLKTYVNLGLGIGLMAKIAFDPEHDHTLRMIPVDHLFEPSSTYIALRPDTYLRGYTYDFINIFSSPLTRQKIDQILYA. 308
355 7.000e-94gi|493969307|ref|WP_006912541.1| CysB family transcriptional regulator [Salinisphaera shabanensis]  clstr ali  43  88ADADRGSLCVATTHTQARYALPPVVDAFRREYPEVSLHLNQGAPPQIAGWAAAGDADFAIATEALEHFDELVMLPCYHWNRCVLVPRDHPLADTPRLELAKLAEQPIVTYTFGFTGRSHLDAAFEAEGRTPNVVLTAVDADVIKTYVRLGLGVGVIANMAYDPVADADLVRLDASHLFAASTTHIGFRHNLFLRGYMRRFIEIFAPHLTSATIDEALAE. 306
356 8.000e-94gi|518794031|ref|WP_019951320.1| hypothetical protein [Kushneria aurantia]  clstr ali  48  88ANQDQGRLAIATTHTQARYALPGIITRFKQRFPNVHLELHQCSPAEIVSLLKVGSVDIGIATESVAEDSPFVCFPFHHWHHAVVVPEGHPLTQVSPLTLADIADYPIVTYHHGFTGRTRVDQAFSAAGLTPDVVLTALDADVIKTYVELGLGIGVIASLAYTPGRDSGLELLASDTLFPRNTTYLALRRGHFLRSFAYEFLQLCSSQLSAETVQQALNA. 307
357 9.000e-94gi|652342658|ref|WP_026739858.1| transcriptional regulator Cbl [Lonsdalea quercina]  clstr ali  60  88SDNDAGVLVIATTHTQARYSLPSVIQSFQAQYPQVQLVLHQGSPEEIVAMLASGEADIGIASEQLMNTTSLAAFPYYRWHHSILVPAGHPLADGSPITLDKLNTVPLITYRQGITGRSRIDRAFIAAGLSPHIAISAQDSDVIKTYVELGLGVGILADRSYDPVRDAGLVRIEAEHLFEANTVWLGLKRGQLQRNYTWQFIQLCNPELTLEEIKQRVF.. 305
358 9.000e-94gi|820778986|ref|WP_046740899.1| transcriptional regulator [Lampropedia cohaerens]  clstr ali  45  88SAQDNGTLSIATTHTQARYVLPEPVARFRGEYPKVNISLHQATPHEVADMVLTEVADIGMATESLAEYPELVTLPCYEWQHVLIFPPSHPLAGKARISLEDITSEPLITYHPSFTGRGRVDRAFARRELKPNIILEAIDSDVIRTYVKLGLGIGIVAEMAVQGELRGNLEVRPMGDLFGMNVARVAFKRGAYMRQFVYRFAELISPRLSREQVKLALA.. 305
359 9.000e-94gi|644127943|ref|WP_025282450.1| CysB family transcriptional regulator [Ectothiorhodospira haloalkaliphila]  clstr ali  40  89.DEARGTLSIATTHTQARYFLPPLIKRFRERYPQVHLLIHQGNPEQIAQMAASGQVDFAIATEAIALHRELIMVPAYRWLHGVVVTPGHPLTKMESLTLKAVAEHPIVTYVHGFTGRGQLEQDFQKQGLTPEVVLSAADSDVIKTYVRLGLGAGIIAHMAFEEDTDTDLVYLPANGLFSEHITRVGFRRGMYLRSYMGYFMSLIAPHLDQPRLEQAVSA. 306
360 9.000e-94gi|330946115|gb|EGH47359.1| transcriptional regulator CysB [Pseudomonas syringae pv. pisi str. 1704B]  clstr ali  38  3.....................PPVISNFIKQYPDVALHMHQGSPMQIAEMAADGTVDFAIATEALEQFSDLVIMPCYRWNRCIVVPQGHPLTKAPKLTLELLAEYPIVTYVFGFTGRSKLDEAFSHRGLVPKVVFTAADADVIKTYVRLNLGVGIVARMAIDEAVDSDLVVLDASDLFESSVTKIAFRRGTFLRGFLCDFIEKFAPHLTREVMAKAIQC. 200
361 9.000e-94gi|654375240|ref|WP_027854396.1| transcriptional regulator [Marinobacterium litorale]  clstr ali  48  88SRQDTGELAIATTHTQARYSLPAIISQFRQLYPHVHLKLYQSGPDEIVQLLRSGEVDVGIATEALDRQPELAAFPFYRWRHAVIVPRGHPLTRLDRPTLKQIADYPIITYHEGFTGRSKVEKVFRQQGIEPDIVMSALDADVIKSYVELELGIGIIAAMAFDPSRDHALLLLDTAHLFEENITSIALKRGRVLREYGYRFIQLCSPELDKGRL....... 300
362 1.000e-93gi|589832206|gb|EXJ14580.1| Cys regulon transcriptional activator CysB [Thiorhodococcus sp. AK35]  clstr ali  42  100SQESSGRLCIATTHTQACYVLPTVIRAFIERYPQVALCLQQGNPSQVCDLVVSGQADLVIATESVRDYPKLLSLPCYEWNHCIIAPLGHPILAASPLGLEAVARWPIVTYDSAFTGRNQINRAFKSHGLEPRVVLTALDADVIKTYVRMELGIGIVARMAYDASLDVGLGMVDAGHLFDSSVTHLGLRRNAWLRGYTYDFIERFAPHLTRGLIERALKA. 318
363 1.000e-93gi|954175694|ref|WP_058087804.1| transcriptional regulator [Aquabacterium parvum]  clstr ali  45  90..QDAGTLSIATTHTQARYVLPEPVAQLRRKYPKVAVSLHQGTPEQVARMVLDEVADIGLATESLSDFPDLVTLPCYEWQHVVVMPPSHPLASVPRLTLEQLAAEPLISYHPSFTGRKRIDQAFLQRGLTPNVVLEAIDADVIKTYTRLGLGIGLVAEMAVKDAPGSDLVWRPVGHLFGPNMARLAFKRGAYLRQFVLAFAELISDRLSRALILQAMQ.. 310
364 1.000e-93gi|736408604|ref|WP_034431333.1| transcriptional regulator [Candidatus Contendobacter odensis]  clstr ali  50  88SNRDQGKLCVATTHTQARYALPPIVGQFKAAFPKVHLALHQASPSEIVARLLSGEADIGIATEALADVAELAAFAFYEWHHAVIVPESHPLTAEAPLTLEAIADYPIITYHEGFTGRARIDATFARAGLIPDIVISALDADVIKTYVELGLGIGIIAAMAYSPAKDSGLRLLDNAPLFERNIAWIAVRKGHYLRNFVYRFIELCNSELTETTVR...... 301
365 1.000e-93gi|639176591|ref|WP_024516212.1| transcriptional regulator [Bradyrhizobium sp. Tv2a-2]  clstr ali  49  88SQQDVGRLTLATTHTQARYSLPSIVSKFKQEFPGVELVLHQGGPAEIVALMMSGQADIAVATEALDGIPELVTFPYYRWHHAVIVPTGHPLLSCDPLTIESIAEFPIVTYSEGFTGRARVDQAFAKAGLTPNLAISAIDADVIKTYVELGLGVGIVAAMAVKPDGEGALRVLPSEHLFEANTTRVAVRRGTFLRGYACRFIQLCASALSEADIRKAVQA. 306
366 2.000e-93gi|555503898|ref|WP_023271905.1| hypothetical protein [Acinetobacter nectaris]  clstr ali  46  91...DEGTLTIATTHTQARYVLPPIVNLFKKQFPKVHLVLQQASPAEIVEMLLQGQADIGIATESLTAEENLAGLPYYTWQHSVITPPDHPLTQVNKVTLEELAKYPIVTYHEGFTGRSKIDQAFKDAGIDADIVMSALDTDVIKTYVELGMGIGIINSIAYDNKRDVHLSQVKTS-LFDINTTWIAVRKGHLLRGYGYEFISLCSPDANIIELKKAAYP. 305
367 2.000e-93gi|651357619|ref|WP_026469984.1| CysB family transcriptional regulator [Alkanindiges illinoisensis]  clstr ali  46  91...DQGELIIATTHTQARYILPPIVAKFKKAFPKVHLILQQASPVEIAEMLMHGEADIGIATESLTQEESLASVPYYHWYHSIITPQGHPLSQQQTVTLDELAKWPLITYHGGFTGRSKIDSAFSNAGLSPDIVMSALDADVIKTYVELGMGVGIVNSIAYDADRDRRLNQLQI-DLFGENTTWIAVRKGHLLRGYGYEFISLCSPDADIKALKKAAQP. 305
368 2.000e-93gi|494244717|ref|WP_007145107.1| CysB family transcriptional regulator [Methylophaga aminisulfidivorans]  clstr ali  48  89.DNDSGELTIATTHTQARYILPPVITLFKQRYPKVHLKLHQGSPEEIAKLLLNGEADIGIATETLGDIAELASFPYYQWTHTVIVPKGHVLAEQEPLSLKSINAYPIVTYHDGFTGRAIIDKAFRHVGEIPNIDMSALDADVIKSYVELGMGIGIIASVAYDKQRDAGLIALSADHLFEPSWSKIGLRRGHYLRQYAYDFIELCSENITAEVINA..... 303
369 2.000e-93gi|521064592|ref|WP_020396543.1| hypothetical protein [Thiothrix disciformis]  clstr ali  49  88SNAEAGSLDIATTHTQACYKLPPIITAFKKLYPRVHLAIHQAKPNEIAAMLQEGKVDIGIATESLMQQQHLATFPFYVWSHALIVPKGHPLEKIPDLSLEAIAEYPLITYFHGMTGRLKIDEAFSRVGVTPDIIMSALDSDVIKTYVSLGLGIGIIASVAINPERDTAISLLDCSHLFEPNTTYIAVRRGHYLRGYAYRFMELCSARLNEQTIREAL... 304
370 2.000e-93gi|500232870|ref|WP_011902463.1| transcriptional regulator CysB-like protein [Polynucleobacter necessarius]  clstr ali  44  88ASQDQGNFVIATTHTQARYALPKVLTEFTKRFPKVRVSIQQGSPGQIAELLSHDHADIAIATEGIANTPGVLALPGYQWQHVLMVPLSHPLLNQANVTLEEIAKYPIITYDKAFAGRSKIDAAFAQRNVTPDIILEAIDADVIKTYVEAGMGIGIVAGQAYDPDRDRNLKVISVGHLFGNNVTHLGVKQGAYLRSFVYTFIELFSPTLTKKIVEQAM... 304
371 2.000e-93gi|740251611|ref|WP_038092486.1| CysB family transcriptional regulator [Acidihalobacter prosperus]  clstr ali  41  88ASPAAGTLSIATTHTQARYMLPPIVAEFRARYPGVALNLHQGTPEQIAEMAVNGKVDFAIATEGLNHFEDLVLLPCYKWNRAALVPRGHPLELVKRLSLEDLAKFPLVTYVFGFADHSEMSATFAKKRLRPNLVLTAVDADVIKTYVRTGLGVGLLARMAYEPERDGDLVCLDVRHLFPHEVTSIGLRRGLVLRDYMYDFIHRFAPHLDRIAVDMMVLA. 306
372 3.000e-93gi|502500115|ref|WP_012807033.1| CysB family transcriptional regulator [Candidatus Accumulibacter phosphatis]  clstr ali  48  88ASRETGHFVVATTHTQARYALPQIIKWFKTDYPRVHLALHQGSPVDIAEKLVSGEADVGIATERLDQVPELETFPFYRWHHALIVPHGHPLLQVDKLTLEVIGEYPIITYHEGFTGRTHIDKAFADAGVVPDIVLSAIDADVIKTYVELELGVGIVASMAYDACKDRNLTLIAVPHLFPESTTRLAVRRGTYLRSYALAFIEKVCPDIGEENLKAAIQ.. 305
373 3.000e-93gi|495566059|ref|WP_008290638.1| LysR family transcriptional regulator CysB [Methylophaga thiooxydans]  clstr ali  37  88SEEISGKLTIATTHTQARYVLPRTIIHFTNMHESVGFQLKQGNPHQAFEMVSKGMVDFAIASEAMDDFSNLITFPCYSWNRLVLVKRDHPLASGAPISIEQLSKYPLVTYENGFTGRYQLNNAFQKAGLEPNIMLTASDADIIKAYVKMDLGVGVIASVAYDPDDDCDLVSINVRELFDDCVAKIAIRKGVSLRSYMYDFIELFSPHLSRDIVERTLA.. 305
374 3.000e-93gi|500153538|ref|WP_011829541.1| MULTISPECIES: CysB family transcriptional regulator [Methylibium]  clstr ali  44  88SQQDAGTLSIATTHTQARYVLPGPVAALRKRHPKVAISLHQGTPEQVAQMLIDETAEVGLATESLSDFESLVTLPCYDWQHVVVLPLNHPLAAHERLTLEQLAQEPLISYHPSFTGRTRVDQAFATRGLKPNVVLEAIDSDVIKTYVRLGLGVGIVAEMAVRDDPAGDLVTRPAGQLFGNNVARLAFKRGAYLRNFVYGFAELLSDRLTRDLITRALQ.. 309
375 4.000e-93gi|518257607|ref|WP_019427815.1| CysB family transcriptional regulator [Limnohabitans sp. Rim28]  clstr ali  45  90..QDSGTLSIATTHTQARYVLPMPVAKLREKYPKVNISLHQGAPDQVAKMLLDDTAEIGIATESLSAYEDLVTLPCYEWQHVLVLPLDHPLTAKTHLSLEDLASEPLITYHPSFTGRSRIDQAFAAKKITPRIALEAIDSDVIKTYVRLGLGIGIVAEMAVKDDPVKDLAVRPLGALLGMNVARVAFKRGAYLRQFVYQFAEMLSDRLTAPLVARAM... 304
376 4.000e-93gi|545113460|ref|WP_021476316.1| CysB family transcriptional regulator [Pseudogulbenkiania ferrooxidans]  clstr ali  44  91...DEGQLTIATTHTQARYALPQVVTEFKRAFPRVHLVLHQASPEELVRLLMAGDADIGIATEAVTEVPELVSFPYYSWHHCVIAPPEHPL-HREPLTLEALAEHPIVTYHHGFTGRAKIDNTFAEAGLAPDIVMAALDADVIKTYVELELGVGIVASMAVDPRRDAGVKVVEGPPLFGQQTSRIAIRRGHYLRSYAYRFIELCAPALNEQSVRQALSPA 306
377 5.000e-93gi|652655618|ref|WP_027016330.1| transcriptional regulator [Comamonas composti]  clstr ali  46  91...ERGRLTVAATHSQARYVLPQVVHDFRLHYPQVSLHLHQGSPRQVAEMLCSGEADIGVATEALASYEQLVTLACYRWSHSIIVPPGHALAEPGPVTLQALARHPIITYDLGYTGRAHIDKAFARAGLSPDVVLTAMDADVIKTYVELGMGVGVIASIAFDAERDRHLQALDARHLFEINLTRLALRRGAWLRDYVYSFIESFVPTLTPQVVRDAMAE. 307
378 6.000e-93gi|558564320|ref|WP_023494523.1| transcriptional regulator [Methyloglobulus morosus]  clstr ali  42  88TQKDKGTLTIAATHTQARYFLPVAVKQFMHDYPGVTLTIHQGNPTQVAEQVADGEADLGIATEAINTYEKLSCLPCYQWNRCIVAPEGHPLLDDLPLTLEKIVQYPLITYDFTVTGGSLVKHIFNQAGLEPNVVLTAIDADVIKTYVNLGLGIGLLATMAYDPERDSNLRLLDASHLFPASTTYLGLRRDAYLRDYVYDFIHILVPSLNRKVVMQAL... 304
379 6.000e-93gi|238718321|gb|EEQ10144.1| HTH-type transcriptional regulator cbl [Yersinia mollaretii ATCC 43969]  clstr ali  61  113...DSGQLHIATTHTQARYSLPRVIKEFRLLYPQVKLVISQGNPQEIAAMLHSGEADIGIATELLMSDESIAAFPYYRWHHAIVVPENHPLTQEPNITLETLSTLPLITYRQGITGRSRLDNAFKNAGLTPDIALSAQDSDVIKTYVELGMGVGILADMSYEAHRDKGLVRLNAEHLFDANTVWLGLKRGQLQRNFIWFFIQLCNPTLSLHDIEKVLAEA 330
380 7.000e-93gi|493840641|ref|WP_006787783.1| CysB family transcriptional regulator [Thiorhodospira sibirica]  clstr ali  43  89.HENIGQLRISTTHTQARYVLPAVIDLFRQRYPEVRLQLHQGTPRQIVDIAQSGAVDFIIATEAPTFPGQFVMLPAYRWAHCVIMPKDHPLATQTPLSLAELATYPIVTYLEGFTGRGRLDDDFKRHGLSPDIVLTAADADVIKTYVRHGLGLGIIAHMAFDPQEDHDLVKCPVEPAFSGSITRIGFRQDAWLRSYMYAFLELFAPHLTRARVD...... 301
381 8.000e-93gi|497321830|ref|WP_009636043.1| CysB family transcriptional regulator [Serratia sp. M24T3]  clstr ali  61  88SKEDAGVLTIATTHTQARYSLPRVIKAFRAVYPAVRLELHQGSPQEVLAMLLSGQADVAIASEKLISDPSVASFPYYRWHHAILVPDGHPLLEQQPLTLEHLNQYSLVTYRQGITGRSRVDSAFEQQGLNPDIVLSAQDSDVIKTYVELGLGVGILADKAFDPDRDRGLQLINAEHLFESNTVWLGLKRAQLQRNYVWRFIELCNQSLSINEIKE..... 302
382 1.000e-92gi|1004048182|ref|WP_061503380.1| transcriptional regulator [Ramlibacter tataouinensis]  clstr ali  44  88SAQDSGTLSIATTHTQARYVLPVPVARLREAYPKVNVTLHQGSPDQVARMVIDEVAEIGIATESLSDYRELVTLPCYEWQHVLVLPQAHPLARKERVSLEDLAAEPIITYHPSFTGRTRIDHAFTQKKLQPRIALEAIDSDVIKTYVRLGLGIGIVAEMSVRDEGNADLAVRPLGALFGQNVARVAFKRGAYLRNFVFRFAELLSDRLDRNLIAKAM... 307
383 1.000e-92gi|655954102|ref|WP_028997008.1| transcriptional regulator [Azohydromonas australica]  clstr ali  49  91...DVGTLSIAATHSQARYALPAVVRDFQSRHPGVSLKLHQGSPQQIAQMLASGEADIGIATQSLAEQDGLVALSCYRWTHSVVVPPEHELLQ-GPLTLQRLAAYPLITYDVGYTGRGTIDDAFRRAGLNMQLVLSAMDADVIKTYVGLGMGVGIVASIAFDEERDQPLRAIDARHLFAINTTSIGLRRGALLRAYAYDFIQSFAPHLKPEIVMQAQA.. 304
384 1.000e-92gi|970439685|ref|WP_058720864.1| transcriptional regulator [Paucibacter sp. KCTC 42545]  clstr ali  52  88SDAEVGQLTIATTHTQARYALPQVVARFKAAFPRVHLVLHQANPAEIVTLLQSGEADIGIATEALDQDPAFVTFPYYDWHHAVVVPQGHALAQQGTLTLEALAEHPLITYHQGYTGRARLDATFAAAGLAPDFVMSALDADVIKTYVQVGLGVGIVASMAFEPKRDGGLQLLNATHLFKANTTRIALKRGHYLRGFAYRFLQECVADLSEDTVKAAL... 307
385 1.000e-92gi|971866074|ref|WP_058934963.1| transcriptional regulator [Roseateles depolymerans]  clstr ali  44  88SKQDAGTLSIATTHTQARYVLPGPVTQLRRQFPQVNIGLHQGSPDQVARMLIDETADVGLATESLSQFEELVTLPAYEWQHVLVMRAEHPLAQMERIDLEQIAHEPLVSYHPSFTGRTRIDRAFAQRHLTPNIVLEAIDSDVIKTYVRLGLGIGIVAEMAVREDPPGGLVSRPLGHLLGQNIARIAFKRGAYLRNYVYSFAELLSDRLNRSLLQRAM... 305
386 1.000e-92gi|913634518|gb|KNZ33165.1| transcriptional regulator [Methylibium sp. NZG]  clstr ali  41  90..QDAGTLSIATTHSQARYFLPGPVAELRRRHPNVAISLHQGSPSQVARMVIEEVADIGLATESLADMEGLVSLPCYEWHHAVVMPAGHRLAALDRISLEALAAEPLVSYHPSFSGRTRVDQAFAARRLKPNIVLEAIDADVIKTYVRLGLGVGIVAELAVDDPPDGDLVSRPVGHLFGQNVTRIAFKRGAYLRNYVYSFAEMLSTRLSRALIARVLA.. 306
387 2.000e-92gi|551359523|ref|WP_022978870.1| CysB family transcriptional regulator [Ideonella sp. B508-1]  clstr ali  44  88SKQDAGRLSIAATHTQARYILPDAVAQLSKRLPKVKISLHQGTPEQVAHMLLDDTADIGIATESLADIEELVTLPCYEWQHVIVMPHDHALAAVERPSLEQLAELPLISYQPAFTGRKRIDQAFAQRRLTPNIVLEAIDSDVIKTYVRSGLGVGVVAEMAMASEPPNGLISKPAAHLFGTNTTRVAFRRGAYLRSYVLTFAELLSDRLSRHLIERAMNSS 308
388 2.000e-92gi|493628193|ref|WP_006580216.1| CysB family transcriptional regulator [Cupriavidus sp. HPC(L)]  clstr ali  44  88AGRHTGRLTVATTHTQARYALPKVVTEFRRAYPHVTLALQEASPNHIVELLLSGQADIGIATEALASEPSLTAFDAYSWRHVLVVAPDHPLTRLPEPTLEDLAGFPIITYDAGFTGRRKIDSAFAQAGLQPEIVLTALDADVIKTYAELDLGVGIIASMAYDARKDSGLVRISADHLFAPNTTSVAVRRGAYLRGYAHAFIQLFAPQLSEQAVSNALAE. 306
389 2.000e-92gi|497544029|ref|WP_009858227.1| CysB family transcriptional regulator [Rubrivivax benzoatilyticus]  clstr ali  46  92....SGTLTVAATHSQARYALPPVVRDFLAANPQVTLHLNQGSPRQIARWLIDGEADIGVATEALADYEELVALPCYRWSHVVVVPQGHALADEERLTLERLAQFPLVTYEPGYTGRRHIDEAFEREGLAREIVLAAMDADVVKTYVELGLGVGIVASIAYDPARDQGLHAIDVRHLFEVNTTRLAVRRGTYLRDYAYDFIQTFASPLSRGLVDRALA.. 309
390 2.000e-92JCVI_PEP_1096695227739 /source_dna_id=JCVI_ORF_1096695227738 /offset=0 /translation_table=11 /length=328 /full_length=328  ali  37  91SDEKKGSFSIATSHTQARYVLPPIIKNFRRLYPEVSLVIHQGSPEQIHELVSSGRADFAISTESPEIFQDLIMIPCYEWNRSVIVPKPHELSRRREIGLSDIADYPIVTYVYGPSGQSRLAKAFEKIDKTPNVVFSATDTDVIKTYVRMGFGVGIIASMASDSAQDKDLQIFDASHLFDFSIAYIGFRRGTFLRGFMLKFMELFAPHLDQHTVKGILN.. 308
391 2.000e-92gi|737495344|ref|WP_035474919.1| transcriptional regulator [Gammaproteobacteria bacterium MFB021]  clstr ali  46  88ANQDQGRLAIATTHTQARYALPPIVAQFKERFPKVNLELHQCSPSEIVSLLKSGRVDIGIATEGVDEGSSFVRFPFHHWHHSIVVPAGHALSQAQELRLEDIAGYPIVTYHEGFTGRARIDQAFQAAGLVPNVVLTALDADVIKTYVELGLGIGVIASLAYSDERDRDLTLLSGQALFPRNTTYLALRRGHFLHAFAYAFLKLCSDDLDEDTVQRAL... 305
392 2.000e-92gi|951173889|ref|WP_057652770.1| transcriptional regulator [Bordetella sp. N]  clstr ali  43  88ARRDEGGLVIACTHTQARYLLPRVIPAFRKQFPKVHLSLAEGSPSQLAEMVLHEQADLAIATESLALTPGLATMPCYTWEHTVVVRPDHPLAELKRLTLEQLAAFPIVTYDRAFTGRSTIDEVFASQSIHPDIVLEAIDADVIKTYVDVGLGIGIIAGVAYDPRRDSGLIGLPVGHLFGTHTTRVGVKSGVFLRDYVYTFIEMLTPALTRNVVSKAVQ.. 310
393 2.000e-92gi|543576603|ref|WP_021025080.1| CysB family transcriptional regulator [Comamonas sp. B-9]  clstr ali  46  92....SGQLSIAATHSQARYALPLVVRDFREQFPDVALHLHQGSPRQVAEMLLSGAADIGVATEALTGYASLATLPGYRWTHSVVVPPGHPLLAQRPLTLQSLVRFPIITYEQGYTGRSHIDESFAAAEVTPNVVLTAMDADVIKTYVELGMGIGIVASIAFDEERDRNLRAIDAGHLFKVNTTRIALRKGVWLRAYALQFIESFVPTLKREVVLQAVSAT 311
394 2.000e-92gi|1011360581|ref|WP_062273668.1| transcriptional regulator CysB [Marichromatium gracile]  clstr ali  44  88SSESAGSLTIATTHTQARYVLPPVIHAFMARYPDVRLSLRQVSPTRGCELVVAGEADLVIATEAVAETPELVSLPCYEWNRCVIAPLGHPILDTSPLSLEAIARWPLVTYDSAFTGRGLINRAFRARALEPRIVLTALDADVIKTYVRTGLGIGLIARMAHDPETDQGLGVADASHLFDSSLTRIGLRHKAWLRGYVHAFIECFAPHLTRRVIERALSET 307
395 2.000e-92gi|780232527|ref|WP_045530682.1| transcriptional regulator [Comamonadaceae bacterium A1]  clstr ali  45  88AAQDSGALSIAATHTQARYVLPAAVAKLRHAYPKVSISLHQGAPEQVARMLLDDVADIGIATEALSDHPELITLPCYDWQHTLVLPAGHPLLERERIALEDLVQVPLITYHPSYTGRTRIDTAFAQRQLKPHIVLEAIDSDVIKTYVKLGLGVGIVAEMAMQEERSPELVARPLGHLFGQNVSRVAFKRGAYLRQFVLRFAEFLSDRLSRELINKAM... 305
396 3.000e-92 [KEGG:K13635] LysR family transcriptional regulator, cys regulon transcriptional activator;|[COG0583] Transcriptional regulator  ali  97  99TNDTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPLDHPLTQITPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLPADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGAQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKRQVMEN 318
397 3.000e-92JGI.Meta 7009429527 C4131410__gene_141501 HTH-type transcriptional regulator cysB [Human Tongue dorsum microbiome from visit number 2 of sub  ali  38  1.........LATTHTQARYALPLIVADFVKRYPKVNLTIKQGSPAAIAQMVTSGESDLAIVTERIDDHPELGKLPCYDWTHAVIVPNDHPLLERNPLRIEDLARFPLITYEFAFNTGSSIARAFAKARLEPDVALAAADTDVLKTYVRLGLGVGLMAKMAYNPDTDDDLQLVDAAHLFEPSPTWIALRNDTYLRGYAYDFIQSFAPHLTREKVDKILY.. 211
398 4.000e-92gi|917300060|ref|WP_051906772.1| CysB family transcriptional regulator [Methylomarinum vadi]  clstr ali  43  93......SLTLATTHTQARYVLPKVVEQFLRVYPAIDLHLHQGTPSQIADMLERGEVDIAIATEALADREALLSMPCYQWSRSIITRQGHPLTQLSSVALADVARYPIITYVQGFTGREQLDETFRRERLQPDFVLTAVDADVIKTYVRLGLGIGIIADMAFHPDQDRDLQALNAKNLFGVSTSRIAIKRDKYIKDYVFRFIEMFAPHLSADVVKQALLCS 306
399 4.000e-92gi|516371398|ref|WP_017761431.1| CysB family transcriptional regulator [Pseudacidovorax intermedius]  clstr ali  47  88ATQNEGLLSIAATHSQARYALPEAVQDFRRQFPSVRLHIHQGSPRQIAQMLLEGEADVGIATEALADYPQLAALPSYRWTHAVIAPPGHPVLA-EPLTLQSLAKHPLITYDNGFTGRQRIDDAFTQAGVQADIALAAMDADVIKTYVQLGMGVGIVAGVAFEAERDTGLRAVDAGALFGINHTRLAVRRGSYLRRYVYAFIESFSPTLTREVVEAAVRA. 305
400 6.000e-92gi|1012142078|gb|KYP12747.1| transcriptional regulator [Limnobacter sp. CACIAM 66H1]  clstr ali  41  88SSRDVGQLTVVTTHTQARYSLPTVVNEFKKVFPKVHLRMHQGSPKEITQMLLDGQADIGIATEVLGNVDDLVSFPYYQWKHQVVVQQGHPLLKLPKPTLQDVAEYPIVTYQEGFTGRIKIDETFRKLGLTLDVAISALDADVIKTYVELGLGVGIIASMAYNPVKDTGLAVLDVESDLPMNTTSIAIRKGHYLRSFAYKFIELCNGDLTEARLLAALNDS 307
401 6.000e-92gi|937532287|ref|WP_054600141.1| LysR family transcriptional regulator [Neisseria sp. 74A18]  clstr ali  40  88TDQDSGSLTIATTHTQARYALPKVVSEFVKKYPKVKLSIKQGNPSAISQMVVSGEADFAIATESLEEGDELRKLSCSEWTHAVLVPDHHPLLECNPLSLSDLARFPLVTYEFAINNNSNISRAFYKARLDPSVALSSADTDVLKTYVRLGLGVGLMAKMAYDKQLDRDLHLIDASHLFEPSQTYIALRPDTYLRGYTYDFINLFAPGLNRERIDKILYQ. 308
402 7.000e-92gi|517748543|ref|WP_018918751.1| CysB family transcriptional regulator [Halomonas zhanjiangensis]  clstr ali  49  88THEDQGSLAIATTHTQARYALPPIIAQFKKAFPKVHLELHQCGPEEIVSLLKAGKVDIGIATEALHEESQLACFPFYHWYHGVIVPEHHPLNDGLPLTLERIAEHPIVTYHDGFTGRARIDTAFTSVGVYSDIVLTALDADVIKTYVELGMGVGLIASMAYHEARDQGLKLLDASALFPRNTTYLALRRGHFLRGYVYQFLKLCRDNLNEDTVQRVLA.. 306
403 8.000e-92gi|495334540|ref|WP_008059277.1| CysB family transcriptional regulator [Methyloversatilis universalis]  clstr ali  51  88ARRDEGQLRIATTHTQARYALPRVVTEFKRLFPKVHLVLLQASPGEIVDLLHDGEADIGIATETLADAPDLVTFPFHTWHHSVIVPAGHPLEAVRPLTLEALVEHPVVTYHEGFTGRARIDATFARAGLLPDIVMSALDADVIKTYVELGLGAGIIASVAFDPARDSALRLLDSEHLFAANTTMIALRRKHYLRSYAYRFIELCEPSLNEVTVKAALKPS 307
404 8.000e-92gi|503413286|ref|WP_013647947.1| CysB family transcriptional regulator [Nitrosomonas sp. AL212]  clstr ali  49  88SNHDQGHLTIATTHTQAQYTLPPVVAEFKKIFPKVQLILHESRPDEILSMLIDGEADIGIATEALEGAVDLVSFPYYTWQHAIIVPVGHPLQSVYPLTLEAIAEFPIITYHHGMTGRFRIDQVFAKMGLIPDIAMSALDADVIKTYVKLGLGIGIIASVAFSPERDTTLIKLDSEYLFEKNTTFISVRRNHFLRGYAYRFIELCMPTLNESIIR...... 301
405 9.000e-92gi|654860502|ref|WP_028312824.1| transcriptional regulator [Derxia gummosa]  clstr ali  45  88AAQDHGTLVIATTATQARYTLPKVIAQFKEIFPGVRLKLLQGDPGHVAQYVMHGRADLGIATEVLSEQSELVTLPLFQWRHVVLVPREHALASVEHLHFEQVAAQPLITYEHTFSGRPKIDAAFARRGVEPQIVLEAIDSDVIKTYVELGLGIGIIAEMAYDPVRDSNLVALPAGHLFGENVLRMAIRQGSYLRDYAVKFLHLLSPQLTRARIESAMR.. 305
406 9.000e-92gi|563761438|ref|WP_023788036.1| CysB family transcriptional regulator [Hyphomicrobium nitrativorans]  clstr ali  47  88SQRACGTLVIATTHTQARYSLPGVIAEFKKSFPEVRLTLKQLSPKDIASVLLEGLADVGIATDTLEHNPQILTFPFYSWEHVIIVPKSHPLARRKNVTLEDIAPYPLITYDEGLTGRARIDDAFQKASLVADVAMTALDADVIKAYVELGMGVGIIASMAFDKERDANLTRIVTPRLFEINTSSIAVRRGRFLRGYVYRFIEMCAPGVTEAHVRTA.... 303
407 9.000e-92gi|523413825|ref|WP_020749147.1| LysR family transcriptional regulator [Ralstonia solanacearum]  clstr ali  45  88SGRQSGRLTVATTHTQARYALPRVVQAFRKAYPHVTLALQEASPSHIVELLLTGQADIGVATEAVASEPGLTSFEAYRWRHVLVVSPDHPLTKNPLPALEDVAQYPLITYDAGFTGRRNIDAAFAGAGLQPEIVLTAMDADVIKTYVALDVGVGIIASMAYDGRKDDNLVCIGADHLFEPNTTRVAVRRGAYLRGYAHDFIGMFAPHLSRETVAEAVAST 307
408 1.000e-91gi|947995950|ref|WP_056655416.1| transcriptional regulator [Rhizobacter sp. Root1221]  clstr ali  41  88SKQDAGTLSIATTHSQARYFLPGPVAQLRRKFPKVNISLHQGSPAQVAQMVIDEVADIGIATEAINDFDGLVTLPCYEWQHAIVMPAGHPLSQAETLTLEDLALQPLVSYHPSFSGRTRVDQAFAAGNLKPTIVLEAIDADVIKTYVRLGLGIGILAETAVRDDPPGDLVWRPVGHLFGQNVTRVAFKRGAYLRNFVFAFAEMLADRLTRTTILQAM... 305
409 1.000e-91JGI.Meta 7068483135 SRS050029_WUGC_scaffold_4024__gene_4775 HTH-type transcriptional regulator cysB [Human Buccal mucosa microbiome from vis  ali  43  88TCPNHGVLRIATTNTQARYMLPAVVERFSKQYPDVSLHIHQGSPTQIHDALISGEVDLAITTEAPYLFDDLIQLPCYLWNRSVIVKPDHPLAKVKNLTVEELGKYPLVTYTFGFTGVSDLDYAFNRAGILPNIVFTATDADVIKTYVRLGLGVGIMASMAHTPA-DKDLVAIDAGHLFRASMTQI................................... 271
410 1.000e-91gi|653285063|ref|WP_027478207.1| transcriptional regulator [Curvibacter gracilis]  clstr ali  46  90..PRSGQLSVAATHSQARYALPRAVKQFSQHFPEIRLHLHQGTPQQVAAMLLAGEADVGIATEALAQFEGLVALPCYRWSHSLVVPPGHELLQHGPVTLSRLAEFPLITYDTGYTGRSHIDEAFAHHQVQPEIALTAMDADVIKTYAELGMGVGIVASMAFDPLRDKGLRALDASHLFGFNLTRLAVRSGTYLRSYEESFIEAFAPSLTAGVVRAALDE. 307