current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}, from SCOP206

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# E-value Template Links and tools%idFirst FVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQHVGRDAHAWMIGQLKGLDLast
1 3.000e-96gi|495255727|ref|WP_007980482.1| LysR family transcriptional regulator [Pseudomonas sp. GM33]  clstr ali  29  90FDPLNSNRRFTMAMTDIGEIYFMPRLMDALAERAPGCSISTLRNTSDTLAEGLQNGAIDLAVGLLP---HLQAGFFQQRLFHHRYVCMCRKDHPATREPLTLERFCSYEHVRVVAANTGHGEVDTFLARAGIERNIRLEVPHFVAVGHILQRTNLVATVPERFASSCEQPFGLAVLPTPVELPNIEINLFWHARYNKDPANRWLRQLMFEL. 297
2 5.000e-96gi|500090232|ref|WP_011766245.1| LysR family transcriptional regulator [Azoarcus sp. BH72]  clstr ali  30  90FDPATSQRSFTLAVTDIGEIYFLPVLMDALAAIAPGVRISTVRNSGAKLRDEMEAGTVDLAIGLLP---NLQAGFYQRRLFHQRYVCMFRKQHPAVTLPLTLENFSALDHVVVISGGTGHSQVDAMLERAGIQRRVRLTVPHFIAVGHILQSTDMIATVPERFAARCVEPFGLVSVPHPAKLPEIAINLFWHGRYHRDPANRWLRQLVFE.. 296
3 7.000e-96gi|334196383|gb|AEG69568.1| hth-type (hthlysr) transcriptional activator [Ralstonia solanacearum Po82]  clstr ali  29  102FEPATSTRAFTIAMTDIGEIYFLPALMRRLAKDAPGVTISTVRNHADALRDEMEAGRVDLAIGFLPD---LKSGFFQRRLFRQRYVCLFRKGHPLAKGGMTMEGFLEAEHVSIVAEGTGHGMVDATMLRAGLPRRVSLRVPHFIALGHILQSTDLIAVVPEAYATRTLKPFGLDTAACPVKIPDITINVLWHARNHREPGNQWLRQLLFE.. 308
4 1.000e-95gi|517251224|ref|WP_018440042.1| LysR family transcriptional regulator [Burkholderia sp. JPY347]  clstr ali  26  90FEPASSNRSFTVAMTDIGEIYFLPALMKRLAKEAPGVTISTVRNYPDALRDAMETGQVDLAIGFMPD---LKTGFFQRRLFKQRYVCLFRKGHPLAKSGMTMKAFLEAEHVAIVAEGTGHGMVDAAIQRASVPRRVCLRVPHFVAVGHILQTTDLIAVVPQAYATRTLAPFGLDSAPCPVKIPDITINVLWHARNHREPSNQWLRQLVFE.. 296
5 2.000e-95gi|495137638|ref|WP_007862446.1| LysR family transcriptional regulator [Polaromonas sp. CF318]  clstr ali  25  90FDPASSKRRFTVGMTDIGEIYFLPLLMEKIQKVAPGVSISTVRNTSVNLKDAMEAGHVDLAIGLLPQ---LKAGFFQQRLFSQQYVCVFRKNHPLDKRKVSSSDFFASDHVVIASAGTGHGKVDEILDSGSQKRRIRLTVPHFVAIGHILQSTDMVATVPERLAEKMVKPFNLRYVNHPVKLPQIAINLFWHAKYHKDPANQWLRSLVFE.. 296
6 6.000e-95gi|499801201|ref|WP_011481935.1| LysR family transcriptional regulator [Polaromonas sp. JS666]  clstr ali  25  90FDPATSKRTFSIGMTDIGEIYFLPLLMEKIQKVAPAVSISTVRNTSTNLKDSMEAGHIDLAIGLLPQ---LKAGFFQQRLFTQQYVCMFRQGHPLDKKKILPSDFFAADHVAIVSAGTGHGIVDEILDKNSPQRKVKLTVPHFVAVGHILQSTELVATVPERLAERMATPFNLKYVAHPIKLPQIAINLFWHAKYHKDPANQWLRGLIFNM. 297
7 7.000e-95gi|738284589|ref|WP_036238760.1| LysR family transcriptional regulator [Massilia sp. JS1662]  clstr ali  26  90FDPAASRQQFTLGLTDIGEIYIFPKLMGILAERAPGVSITTVRNNAVNLKDEMEAGKVDLAVGLLP---HLKSGFYQRRLFRQGYVCMFRSGHPLDKPAMTVDEFARADHVVVVASGTGHAMVDQSIEKKGIKRKVALTVPHFVAVGHILASSNMIATVPERYARACVEPFGLKYVPHPLDLPAISINQFWHARMHRDAANQWLRNLIFD.. 296
8 1.000e-94gi|501314200|ref|WP_012345835.1| LysR family transcriptional regulator [Leptothrix cholodnii]  clstr ali  28  90FDPASVKRSVTIGMTDIGEIVFLPKLVERLSREAPGITLNTVRNTAVNLRDDMESGKVDLAIGLLPQ---LKAGFFQRRLFRQRYVCLFRRGHAVDKKKLSLADFRAAEHLVVVSAGTGHGKVDELLQRAGVERVVRLTVPHFVGVGHILQGTDLVATVPERLAQRLADPFGLAWLPHPVKLPEVAINVFWHAKVHRSPANQWLRSLVFDL. 297
9 4.000e-94gi|740366326|ref|WP_038201831.1| MULTISPECIES: LysR family transcriptional regulator [Comamonadaceae]  clstr ali  31  90FDPKTSARTFNLAMTDVGEMYFMPPLMDELSRIAPKIQIHTHRTNSGNIKEDMESGSIDLALGSMP---HLQTGFFQKRLFRQRYVCMFRRGHPIAKSPMTLAQFSKLEHVGVTARNTGHGEIDSLLARAGVTRRIRLVVPHFIAVGHILQSTDLIATLPERYADRSKEPFDLIVSPHPVKLPEISINMFWHAKYNRDPDNMWLRQLVSEL. 297
10 5.000e-94gi|746587282|ref|WP_039615381.1| LysR family transcriptional regulator [Pseudomonas sp. C5pp]  clstr ali  28  90FEPKTSNRNFTLAMTDIGEIYFMPKLMDTLADLAPNIKISTVRNSEISLSDEMQSGAVDLAIGLLP---SLQAGFFQRRLFHHRYVCMYRKDHPIAGQSLTAEKFCELEHVRVISANTGHGEVEKYLARAGIKRSVRLEVPHFVAVGYILQKTDLIATVPERFAACCVSPFGLSFSPAPLNLPEIAINLFWHAKYHRDPANRWLRQLIFDL. 297
11 5.000e-94gi|27372221|dbj|BAC53588.1| putative LysR-type transcriptional regulator [Pigmentiphaga sp. NDS-2]  clstr ali  26  90FDPASSNRTFTVGMTDIGEIYFLPRLMEATARIAPGVSINTVRNTAVNLRDEMEAGHVDLAIGLLPQ---LNAGFFQRRLFTQKYVCMFRRGHALDGRKLTLDAFRKADHVVAVSAGTGHGIVDEFMQKKGVQRKVRLTVPHFVAIGHILRSTDMIATVPERYAAECLEPFNLAAVNHPVALPRIGINLFWHAKFHREPSNQWLRGLIFD.. 296
12 8.000e-94gi|835411662|ref|WP_047498959.1| LysR family transcriptional regulator [Methylibium sp. CF059]  clstr ali  29  90FEPSTAKRSFTIGMTDIGEIYFLPALIERLRRDAPGVTLSTVRNTTVNVRDELEAGKVDIAIGLLP---HLKAGFFQRRLFMQSYVCLMRRGHPLDKKKISLAQFSAAEHLVVVSAGTGHGKVDELLQRSGVDRAVRLNVPHYVSVGHILQGSDLIATVPERLADRLLGPFGLAKVAHPAKLPDIAINVFWHAKYHRSPANRWLRAVLFEL. 297
13 1.000e-93gi|655156789|ref|WP_028603457.1| LysR family transcriptional regulator [Ottowia thiooxydans]  clstr ali  25  90FDPKTSQRSFTIGMTDIGEIYFLPLLMKQLQKTAPGISISTVRNTAINLKDAMEAGQIDLAIGLLPQ---LKAGFFQQRLFMQQYVCMYRKGHALSKKKLSPQAFFEADHVAIISAGTGHGQVDEILDAASPRRQIKLHVPHFVAVGHILQSTDLIATVPERLAERMTKPFGLSYVQHPIELPQIAINLFWHAKYHKDTANQWLRSTVFDL. 297
14 2.000e-93gi|740927546|ref|WP_038712632.1| LysR family transcriptional regulator [Burkholderia sp. lig30]  clstr ali  27  90FEPATSKRKFTLAMTDIGEIYFLPGLMEKMERSAPGVTISTEWNTSVNLREEMETGKVDLAIGFVPD---LKSGFFQRRLFKQRYVCLFRRGHPLAEEGISLKAFRAAQHVAVVAEGTGHGMVDEVIQRAGVTRNVRLRVPHFVAVGHILQNTDMIAVVPEAYANRTLEPFGLESSACPVKIPDIVINVLWHAKNHREPGNQWLRQMVFD.. 296
15 6.000e-93gi|736263104|ref|WP_034331401.1| LysR family transcriptional regulator [Herbaspirillum sp. B39]  clstr ali  24  90FDPERTSRTFTIGMTDIGEIYFLPRLMDTLAGIAPNISINTVRNTTINLKDGMESGHVDLAVGLLPQ---LKTGFFQQRLFEQKYVCLMRRGHALDKKKISVEEFSEAEHVMVVAPGTGHAKLDEAIERKGIRRNIRLSVPHFVAVGHILSTTNMIATVPERYARQCLAPFNLRFLEHPVDLPETGINVFWHAKFHKEPGNQWLRRLMFDL. 297
16 7.000e-93gi|504826625|ref|WP_015013727.1| LysR family transcriptional regulator [Acidovorax sp. KKS102]  clstr ali  25  90FDPRTSKRSFTVGMTDIGEIYFLPQLMQRIEEVAPSVTISTVRNTATNLKDAMESGQVDLAVGLLPQ---LKAGFFQRRLFEQNYVCMFRKGHRLDQKKIRLQDFFGADHVAIVSAGTGHGQVDEILDNHSPQRQVKLKVPHFVAVGHILQSTDLVATVPERLAERMAVPFELRYLAHPVKLPKIAINMFWHAKFHKDPANQWLRSLVFDL. 297
17 1.000e-92gi|520811243|ref|WP_020298853.1| LysR family transcriptional regulator [Pseudomonas sp. CF161]  clstr ali  29  90FDPATCERTFTLAMTDIGEIYFMPRLMDALARLAPRCSISTVRENPMSLSEDLQSGTVDLAVGLLP---HLQAGFFQRRLFHHRYVCMCRAGHPATLEPLTLERFCEYGHVRVVSANTGHGEVDALMAREGIQRSVRLEVPHFVAVGHILQRTDLLATVPERFAACCEVPFGLTSLPHPVALPEIAINLFWHAKYHKDPANRWLRQLMFEV. 297
18 1.000e-92gi|516370590|ref|WP_017760623.1| hypothetical protein [Pseudacidovorax intermedius]  clstr ali  29  90FDPATSSRAFTIGMTDIGEIYFLPTLMDALAEAAPGVTVSTVRNTAVQLKDEMETGHVDLALGLMPQ---LRTGFFQRRLFTQRYVCLMRQGHPLDKRRIGLREFSAAEHLVVVSAGTGHGVVEDELARQGIERRVRLTVPHFVALGHILAGTDMIATVPERLAQRMAGPFGLRWLSHPAPLPEIGIHLLWHARLHREPANQWLRQLIA... 295
19 2.000e-92gi|518300590|ref|WP_019470798.1| MULTISPECIES: LysR family transcriptional regulator [Pseudomonas]  clstr ali  29  90FDPLASNRRFTMAMTDIGEIYFMPALMDALAELAPGCTISTLRNTSDSVAEGLQNGTVDLAVGLLP---HLQAGFFQRRLFHHRYVCLCRAGHPATLQPLTLEAFSSYGHVKVVAANTGHGEVDTFYARAGVARNVRLEVPHFVAVGHILQRTDLLATVPERFAISCQEPFGLCMLPPPVELPNIEINLFWHERFNKDPANRWLRQTMFDL. 297
20 3.000e-92gi|947612893|ref|WP_056276040.1| LysR family transcriptional regulator [Hydrogenophaga sp. Root209]  clstr ali  27  90FDPATSQRSFSVGMTDIGEIYFLPLLMQRIRQLAPSVTISTVRNTSLHLRDAMEAGQVDLAIGLLPQ---LKAGFFQRRLFEQRYVCLFRQGHALDLKRMKAADFFAAEHVAVVSAGTGHGQVDEILDNHSPQRRVKLKVPHFVAIGHILQSTDLIATVPERLAERMVQPFGLKQLPHPVDLPRIAINLFWHAKYHKDPANQWLRNLIFEL. 297
21 3.000e-92gi|501230176|ref|WP_012273194.1| LysR family transcriptional regulator [Pseudomonas putida]  clstr ali  27  90FDPATSNRRFTMAMTDIGEIYFMPKLMDAFAALAPGCTISTLRNSADTLAEGLQNGTIELAVGLLP---HLQAGFFQRRLFHHRYVCLCRKGHPATQQPLTVESFMSFEHVNVVAANTGHGEVDTYYARAGVVRNIRLEVPHFVAVGHILQHSDLLATVPERFAASCEAPFGLSVMPPPVALPNIEINLFWHGRYNKDPANRWLRQLMFDL. 297
22 5.000e-92gi|489545855|ref|WP_003450508.1| LysR family transcriptional regulator [Pseudomonas pseudoalcaligenes]  clstr ali  31  90FEPASAERTFTLAMTDIGEIYFTPRLMDALTRLAPGCRISTVRNTSVSLIEALQNGTVDLAVGLLP---NLQAGFFTRRLFHHRYVCMCRRDHPVTRQPLTLERFCEHGHVRVVAATTGHGEVDAHMARLGIQRDIRLEVPHFVAVGHILQRTDLLATVPERFAESCVEPFGLVALPHPARLPEIDINLFWHAKYHRDPANRWLRQLMVEL. 297
23 6.000e-92gi|500090137|ref|WP_011766150.1| LysR family transcriptional regulator [Azoarcus sp. BH72]  clstr ali  31  88FDPSSAQRSFRICMTDISQLVLLPRLWAHLRATAPGIRIDIAHLSTE-TAKMLEAGEADLALGFIPQ---LEAGFYQQALFRQRYVCMANADHPRIRETLSLAQFEAEEHAVVSSSGTGHLILDREIARQNISRRVALAVPNFLGVAFVVEHTDLLVTIPARLAEVLAGRGRFRTFPVPFELPDYAVKQHWHERYHHDPGNRWLRRLISDL. 294
24 9.000e-92gi|493141576|ref|WP_006157497.1| LysR family transcriptional regulator [Cupriavidus basilensis]  clstr ali  28  90FEPATSARGFTIAMTDIGEIYFLPDLMKRLSAVAPGVTISTVRNHTVNLQEEMESGRVDLAIGFMPD---LKAGFFQRRLFRQRYVCLFRKGHPLAREGMTLKSFSSAEHVAIVAAGTGHSMVDEVIQRAGVPRQIRLHVPHFVAVGHILQTTDLIAVVPQAYAQRTLTPFGLETAPCPVKIPDIVINVLWHARNNREPANQWLRQVVFE.. 296
25 1.000e-91gi|984319236|gb|KWV68680.1| HTH-type transcriptional regulator SyrM 1 [Pseudomonas fluorescens]  clstr ali  29  91FDPATSRKRFVVAMTDIGEIYFVPCLIDALLKLAPGISVSTLR-SNAQLSESLASGEVDLAVGLLPD---LQAGFYQRRLFHHRYVCLCRKDHPLTQQPMTRERFCEFGHVRIVAASTGHGEIDTHMQRAGLQREIRLEVPHFVAVGHILQNTDLIATVPERFANSCAQPFGLTSLPVPLPLPEIAINLFWHGKYNRDPANKWFRQLMFEL. 297
26 1.000e-91gi|654768181|ref|WP_028222877.1| LysR family transcriptional regulator [Paraburkholderia oxyphila]  clstr ali  27  90FDPASSTRTFTLAMTDIGEIYFLPALMKRLGQVAPNVLISTAHDASATLQDEMEAGRVDLAIGFIPD---LKTGIFQRRLFRQRYVCLFRKGHPLGKTGMTLAAFREAEHVSIVAEGTGHGIVDEVIARAGITRNLRLRVPHFVAVGHILQTTDLIAVVPQAFATGTLEPFGLESAPCPVKIPDILINVLWHAKNHREPGNQWLRQLIFD.. 296
27 1.000e-91gi|692378877|gb|KGH10025.1| LysR family transcriptional regulator [Comamonas testosteroni]  clstr ali  28  95FDPSSARRTFTIGMTDIGEIVFLPALIEHLGREAPGITLNTVRNTAVNLRDDMESGKVDLAIGLLPQ---LKAGFFQQRLFHQRYVCLFRRGHALDGPSFTLADYQAAEHLVIVSSGTGHGKVDELIKKAGIERLVRLTVPHFVSVGHILQRTALVATVPEQLAQTLAEPFGLTMHPHPVKLPQVPINMFWHAKVHRSAASQWLRGKVFSL. 302
28 2.000e-91gi|392714641|gb|EIZ02241.1| LysR family transcriptional regulator [Ralstonia sp. PBA]  clstr ali  31  98FDAATSTRTFRIVMTDIGERVFLPGLLQHLSTVAPHVSVRTVQLPVKEMRDALESGEMDLAVGFIPD---LTSGYYQQRLFNRSYVCIARTNHPHIGDTLSLEQYLAASHAIVSAPGTGHDVVERVLAEKGYRRRIALHVTHFLAIPLIVANTDLVVTIPTMLAESYLPAGNIKMLTPPLKMPVYAIRQYWHERFHEDPANKWLRELFCDL. 305
29 1.000e-90gi|836702525|ref|WP_047847829.1| LysR family transcriptional regulator [Paraburkholderia glathei]  clstr ali  23  90FDPVTTSRAFTIAMTDIGEIYFLPGLMKRLALEASGIKISTVRNQSDTLRDEMERGAVDLAIGFLPDLKTA---FFQRRLFRQRYVCLFRKGHPFAEAGLTMKSFLNAEHVSIIAEGTGHGMVDTAIQRAGIQRNVRLRVPHFVAVGHILQTTDLVAVVPEAYANRTLAPFDLLSAPCPVKIPDITINVLWHARNHREPSNQWLRQLVFD.. 296
30 1.000e-90gi|654762573|ref|WP_028217395.1| LysR family transcriptional regulator [Paraburkholderia oxyphila]  clstr ali  26  90FAPATSTRKFTISAADVGEVYFLPALMDKLAQVAPGVSLNTVPNTTVNLREAMEAGQIDLAIGLLPQ---LKAGFFQRSLLHQDYVCMFREGHPLHGKKLSLKQFCEADHVVVSAPGTGHSKMDEMIERKGIRRNIRLTVPHFVAVGHILSTTNLLATVPERYAMACRVPFKLAYVKHPVVLPRIGINIFWHAKVHKEPGNQWLRNLIAEL. 297
31 2.000e-90gi|913435489|ref|WP_050415089.1| LysR family transcriptional regulator [Azoarcus sp. CIB]  clstr ali  32  88FDPATSERSFRICMTDITHLVLLPRLWGELRATAPGIRIQIAPLD-DDTGRKLESGEADLAVGFIPI---LEAGFYQQALFRQHYVCLASADHPRIHGGLTLEQFEAEDHAVFRTTGTGHHVIEQEIARQGIKRRIVLDIPNFLGAAFVVEHTDLLMTVPRRLGELLRGRGDFRVLPVPFPLPDYTIKQHWHARFHHDPGNRWLRGLIANL. 294
32 2.000e-90gi|111145987|gb|ABH07019.1| putative LysR type regulator [Pseudomonas reinekei]  clstr ali  30  90FDPLSSARTFTVAMTDIGEIYLIPRLMDALARLAPGCKISTVRDNAMSLNEDLQNGTVDVAIGLIPQ---LRAGFFQRRLMRQHYVCLCRKDHPATREPLTLERFCAYGHVRVVAANTGHGEADTLMMRLGIERSIRLEVPHFAAIGHILKHTDLVATVPERYATVNLEHFGLTALPHPVDIPEFTINMLWHARYHRDPANRWLRQLMFEL. 297
33 2.000e-90gi|948000808|ref|WP_056660267.1| LysR family transcriptional regulator [Rhizobacter sp. Root1221]  clstr ali  26  90FEPANVKRAVTVGMTDIGEIVFLPRLVERLAEEAPGVTVSTVRNTAVNLRDDMEAGKVDLAIGLLPQ---LKAGFFQRRLFRQRYVCLFRKGHALDKKKLSLAEFRSAEHLVVVSSGTGHGKVDELIRRAGVERNIRLTVPHFVGVGHILQGTSLVATVPERLAMRLAEPFGLTYLPTPVKLPEVTINVFWHAKQHRSPANQWLRGVVFDL. 297
34 4.000e-90gi|947532013|ref|WP_056195933.1| LysR family transcriptional regulator [Pelomonas sp. Root1237]  clstr ali  28  90FDPAQVQRAMTIGMTDIGEIVFLPRLMERLSREAPGITLNTVRNTAVNLRDDMEAGRVDLAIGLLP---MLKAGFFQRRLFSQRYVCLFRRGHAVEKRKLTLNDFRNAEHLVIVSAGTGHGKVDELIRRAGINRTVRLSVPHFVSVGHILQDSDLVATVPERLAQQLAGPFNLSYLPHPVKLPDIAINVFWHAQAHRAPANQWLRGVICEM. 297
35 6.000e-90gi|504814672|ref|WP_015001774.1| LysR family transcriptional regulator [Paraburkholderia phenoliruptrix]  clstr ali  27  90FDPASSKRKFTVAMTDIGEIYFLPALMKRLGKAAPNVTVSTVRRTSETLQEEMEAGRVDLAMGFIPD---LKTGFFQRRLFKQRYVCIFRKGHPIARTGMTLGAFREAEHVSIVAEGTGHGMVDDVIERAGVLRNVRLRVPHFVAVGHILQTTDLIAVVPQAYAARTLSPFGLEEAPCPVKIPDIAINVLWHAKNHREPGNQWLRHLVFD.. 296
36 7.000e-90gi|654749095|ref|WP_028204302.1| LysR family transcriptional regulator [Paraburkholderia nodosa]  clstr ali  29  90FDPLRATRTMTIGMTDIGEVVFLPALLERLAREAPGVALNTVRNTGVTLSDEMADGRVDLAIGLLPQ---LKGGFYQRRLFDQRYVCLFRRGHPLENAPLTLAAWRDAEHLVVVSAGTGHGQVDEWLKRRGVKRQVRLSVPHFMSVGYILERTDLIATVPERLALQLAKPFSLSLSALPMKLPAAPIHLLWHARVQHDEGNRWLRELVVEL. 297
37 7.000e-90gi|50513838|pdb|1UTB|A Chain A, Dntr From Burkholderia Sp. Strain Dnt  clstr ali model  29  98FDPFASTRTFNLAMTDIGEMYFMPPLMEALAQRAPHIQISTLRPNAGNLKEDMESGAVDLALGLLPE---LQTGFFQRRLFRHRYVCMFRKDHPSAKSPMSLKQFSELEHVGVVALNTGHGEVDGLLERAGIKRRMRLVVPHFIAIGPILHSTDLIATVPQRFAVRCEVPFGLTTSPHPAKLPDIAINLFWHAKYNRDPGNMWLRQLFVEL. 305
38 2.000e-89gi|518402038|ref|WP_019572245.1| LysR family transcriptional regulator [Curvibacter lanceolatus]  clstr ali  29  90FDPLSSTRTFHLAMTDIGEMYFMPPLMEALAQRAPHIRISTLRPHTGDLKEDMAQGRVDLALGLLPQ---LQSGFFQRRLFRHRYVCMFRQGHPTARVPMSLKQFCELEHVGVVAAHTGHGEVDGQLERAGIERRMRLVVPHFIAVGHILQSTDLIATVPQRFALRCEQPFGLVSSPHPVRLPDIAINLFWHGRFNRDPANLWLRQLLIEL. 297
39 2.000e-89gi|662153701|ref|WP_030101521.1| MULTISPECIES: LysR family transcriptional regulator [Burkholderia]  clstr ali  27  90FEPKTSDRNFVLTMTDLGEIYFLPGFMEVLSQAAPTATISTVFDAGSRLEDEMESGRVDLAIGHLP---KLTTSFYQQRLFTQRYVCMFRAGHPIDRGSVSLEDFCSAEHVIVVSAGTGHGRIDDIMAQSGIQRNVRLHVPHFVAVADILSKTNLIATVPEKFAQRSATFFGLKYATHPVSLPNIQINLLWHKRYHRDPANRWLRSLIFE.. 296
40 3.000e-89gi|522142667|ref|WP_020653876.1| hypothetical protein [Massilia niastensis]  clstr ali  25  90FDPLTSGRRFTLGMTDIGEVYFMPKLMEALRPIAPGVTISTVRNTSVNLQDEMEAGHVDLAIGLLPQ---LKSGYFQRRLFKQRYVCMFRAGHSLDKDAITVEEFRNAEHVVVVSSATGHAIADQTLERLGIGRNITLTVPHFVAVGHILASSSMIATVPERFAMACVQPFGLKYVTHPVSLPEININVFWHTKFNKDPANRWLRGLIFDI. 297
41 3.000e-89gi|553726836|dbj|BAO02609.1| LysR-like regulator protein [uncultured bacterium]  clstr ali  29  90FDPLTSSRNFNLAMTDIGEMYFMPPLMEALARLAPSIRITTLRPNSGNLRDDMESGSIDLTLGHQP---NLQAGFFQRRLFRHRYVCVFRQQHATATTPMSLEQFCELEHVGVMAANTGHAEIDELLERAGVKRRMRLVVPHFIAVGHILQSTDLIATLPERFAERCRDPFGLSVSPHPIPLPEIAINLFWHAKYNRDPANLWLRQLLVEL. 297
42 3.000e-89gi|1019448311|emb|SAL52143.1| LysR family transcriptional regulator [Burkholderia cordobensis]  clstr ali  26  94FDPASSTRAFTVAMTDIGEISFLPVLMRKLALIAPGVTISTVRNQSDTLRADMEHGQVDLAIGFLPD---LKGGFFQRRLFRQRYVCLFRADHPLAGAGMTSKTFSDAEHVSIVAEGTGHGMVDTVIQRAGIRRNVRLRVPHFVAVGHILQTTDLIAVVPHAYAMSTLAPFGLISAPCPIKIPDITITVLWHARNHRDPGNQWLRQTMFE.. 300
43 4.000e-89gi|516093513|ref|WP_017524093.1| hypothetical protein [Pusillimonas noertemannii]  clstr ali  27  90FDPATSDRRFTLAMTDLGEIELLPPLMDRLEELAPGVTVSTVRNSADRLRDDMEAGHVDLAIGLLP---GLKTNFFQQRLFMQRYVCLFRRGHALDKRRVTRREFYEADHVVVVSAGTGHAKMDEIIESADETRRVRLLVPHFVAIGHILASTEMIATVPERYARRCAEPFGLRYVDHPVELPQIGINLFWHAKFHKEPGNQWLRQLIFEL. 297
44 5.000e-89gi|500125867|ref|WP_011801872.1| MULTISPECIES: LysR family transcriptional regulator [Burkholderiales]  clstr ali  29  90FDPLASTRTFNLAMTDIGEMYFVPPLMNALSEAAPHVRISTVRPNAGNLKEDMESGTVDLALGLLP---NLQTGFFQRRLFLHKYVCMFRKGHPLAKSPMTLKQFTELDHVGILAANTGHGEVDGLLDRAGIKRKMRLVVPHFIAVGHILQTTDLIATLPERFAERCEVPFGLVTSPHPVRLPDIAINLFWHAKFNRDPSNMWIRQLVVKL. 297
45 6.000e-89gi|739626547|ref|WP_037482965.1| LysR family transcriptional regulator [Sphaerotilus natans]  clstr ali  32  90FDPLTSTRTFQLVVTDIGEMYFMPPLMEALLHRAPHIQISTLRPNASNLRDDMESGAVDLAVGLLPQ---LQAGFFQRRLFRHRYVCMFRRDHPVARSPMTLEQFLALEHVRVVAANTGHGEIDALMAAAGIRRRMRLAVPHFIAVGHILQSTDLIATVPARFAQRCVEPFGLATSPHPVALPEIAINMFWHARFNRDPASLWLRQLMVEL. 297
46 6.000e-89gi|120587335|gb|ABM30775.1| transcriptional regulator, LysR family [Acidovorax citrulli AAC00-1]  clstr ali  30  90FDPATSRRVFKVGMTDIGEIYFLPRLLERLAQVAPGVRLATVRNSATDLKDAMEAGKIDLAVGLLPQ---LKAGFFQRRLFRQPYVCLFRQGHPLRRRRIGLEDFAKAQHVVVVSEGTGHGKVDELLERMGVARDVRLTVPHFVAIGHILQATRMIATVPEKMAQSMAGPFGLAYAPHPVKLPQVAINLFWHTKYHRDPGNQWLRG...... 293
47 7.000e-89gi|654305781|ref|WP_027819402.1| LysR family transcriptional regulator [Paraburkholderia bannensis]  clstr ali  28  90FDPLRASRTITIGMTDIGEVVFLPALVERLSREAPGVALNTVRNTSVNLGNEMADGRVDLAIGLLPQ---LKGGFYQRRLFDQRYVCLYRQGHALEQEPMTLAAWREAEHLVVVSAGTGHGQVDDWLKRRGVRRQVRLSVPHFMSVGYILQRTDLIATVPERLALQLAPLFSLSMCALPIALPAAPIHLLWHARVQQDDGNRWLRSVVIDL. 297
48 8.000e-89gi|494334600|ref|WP_007184415.1| LysR family transcriptional regulator [Hydrocarboniphaga effusa]  clstr ali  30  90FEPATSTRSFTIAATDIGEIYFLPPLLNRLAEMAPGVTLSTIRHNPANLKDDMESGRADFAIGLLPQLQG---SFFRQRLFRQRFVCVFRNQHPLAKRKISKEDFYSAKHAVVVLHGTGHGEIDKLIDGKGAERRIQLSVPHFVAMGHILQETDLIATLPERLAKRLEGPFKLTCVPHPVKLPDHSIDLFWHAKLHRDPANQWLRRLLFEL. 298
49 9.000e-89gi|77969965|gb|ABB11344.1| transcriptional regulator, LysR family [Burkholderia lata]  clstr ali  26  108FDPLRATRTLTIGMTDIGEVVFLPALLEHLSQAAPGIALNTVRDTSVNLSDEMADGRVDLAIGLLPQ---LKGGFYQRRLFDQRYVCLFRRGHPLEDAPLTVDAWRDAEHLVVVSAGTGHGQVDEWLKRRRVARQVRLTVPHFMSVGYILQRTDLIATVPEHLAQQLAAPFSLGWRALPVTVPGAPIHMLWHTRVNQDEGNKWLRDVVVDL. 315
50 1.000e-88gi|655958570|ref|WP_029001347.1| LysR family transcriptional regulator [Azohydromonas australica]  clstr ali  25  90FDPATARRGFTVGMSDIGEIWFLPRLVEALVRTAPNVSISTVRNASVNLKDEMEAAKVDLAIGLLPQ---LKAGFFQRRLLHTRYVCLMRQGHPLDKGHVTLQEFRDAEHVVVVAQGTGHGQVDEVMQRAGVQRRVRLTVPHFTAVGHIVQTTELLATVPEPLAQRIAGPFGLSWVASPVEVPGVPINLFWHARVHKDPANVWLRNLVLEL. 297
51 1.000e-88gi|736373445|ref|WP_034398513.1| LysR family transcriptional regulator [Comamonas testosteroni]  clstr ali  26  90FDSLASNRSFRIGMSDVGEIFFLPTLMDLLDKVAPRISLTTVRNTEVNLKDEMESGRVDLALGLLPQ---LKGGYFQRRLFMQRYACMFRKGHALDKKKISLAAFSAADHVGVISPGTGHSQVDEMLKRNGVQRRVRLTVPHFVAVGHILQTTDLIATVPERFAQKMAKPFDLAYLPHPAQLPETPISLFWHARYHKDPANQWLRSLIFD.. 296
52 1.000e-88gi|518281091|ref|WP_019451299.1| LysR family transcriptional regulator [Cupriavidus sp. BIS7]  clstr ali  28  90FDPATSTRAFTVAMTDIGEIYFLPSLMKRLAKIAPGVTISTVRNHGDSLQGEMESGRVDLALGFLPD---LKTGFFQRRLFQQRYVCIFRKGHPLGRKGMTLEAFAAADRVSIVAEGTGHGMVDMAIQRAGVTQRSRLCVPHFVAVGHILQTTDLIAVVPEAYAIRTLTPFDLTSVPCPVKIPDIVINVLWHATHHREPGNQWLRQLIFD.. 296
53 2.000e-88gi|947610948|ref|WP_056274114.1| LysR family transcriptional regulator [Hydrogenophaga sp. Root209]  clstr ali  26  90FDPQTSVRSFTIGMTDIGEVWFLPRLMELLAQRAAGVTISTVRNASVNLRDEMEAGKVDLAIGLLP---HLKSGFFQRRLLTTRYVCLMRKGHPLDKARMSLKEFSSAEHILVISQGTGHGKIDEVMERAGIDRKVRLTVPHFTPVGQLLRSSNMVATVPEQLARSSAEPYGLVYAKHPVELPTVSINVFWHAKTHKDAANKWLRSLIFE.. 296
54 2.000e-88gi|1017145253|gb|KZE33596.1| LysR family transcriptional regulator [Crenobacter luteus]  clstr ali  33  88FDPARSERTFTISMTDISQLVLLPRLSTYLRKTSPGVHIDVVPLS-ADTARLLESGEADLALGFMPQ---LEAGFYQQALFRQRYVCVAGADHPRIRDALTLAQFEAEEHAVVTSSGTGHLILEREIARQGIARRIALRVPNYLGVAFVVEQTDMLVTIPERLAEVLEGRGRFKAFPVPFELPDYAVKQHWHERFHHDPGNRWLRKVISDL. 294
55 3.000e-88gi|518484247|ref|WP_019654454.1| LysR family transcriptional regulator [Variovorax paradoxus]  clstr ali  28  90FDPATSKRAFTVGMTDIGEIYFLPRLMKEIARVAPNVSLSTVRNTAVNLQDEMEAGHVNLAIGLLPQ---LKAGYFQRRLFRQHYVCMFRRGHPLGRKKVSLDDFSAADHVVVVSAGTGHGNADEFLDRKKITRKVVLTVPHYVAVGHILHDSDLVATVPEKLAQALAGPFGLSYVRHPAKLPEIAINLFWHGRFHKDPAIAWLRSLIIGL. 298
56 3.000e-88gi|765302598|ref|WP_044630235.1| LysR family transcriptional regulator [Halomonas meridiana]  clstr ali  29  91FNPALSGRTFHLNMTDIGEIVFLPRLLQHLSQVAPGVSLHTARSSHHALKYEMEEGQIDLAIGLIPQ---LGAGFYQQRLFEQRYVCLMRDNHPLAKGDFGLEEFRSAHHAVIVASGTGHGVVEEQLANAGIQRPVRLTLPHFAAIPYIVGSSDLVVTVTNKLAEATCERFGLTVREHPLVFPDIPINLFWHRRFHQDPGNRWLRGLVYSM. 298
57 3.000e-88gi|1018538970|emb|SAI68550.1| LysR family transcriptional regulator [Bordetella ansorpii]  clstr ali  26  90FEPASLKRTVTIGMTDIGEIVFLPALIERLGREAPGVVLNTVRNTAVNLRDDMEAGKVDLAIGLLPQ---LKAGFFQRRLFRQRYVCLFRRGHALDRPRLTLADYKTAEHLVIVSAGTGHGKVDELIQKAGIERVVRLTVPHFVSVGHILQRSALVATVPERLAQTLTDPFGLTLRTHPVKLPDVPINVFWHARVHRTPVNQWLRGMVFEL. 297
58 4.000e-88gi|763040060|ref|WP_043924122.1| LysR family transcriptional regulator [Bradyrhizobiaceae bacterium SG-6C]  clstr ali  27  88FDLLTTDRRFTLAMTDAAEMSFLPRVLRLLKEQAPQANLKTVIMSSVELEGALEKGTVDLAIGLFPDLKR--ASFYQQRLFQHPFVCIVRADHPLIGRKMTLEQFLDASHAVVEAEGRNYEIFERVLERRGLKRRVALIIPHFLSIPMVIADSDLIATVPHVLAEVFARSTKIRLVPPPIKVSDYEVRQYWHERFHKDPANRWLRTAIAE.. 295
59 6.000e-88gi|503426882|ref|WP_013661543.1| LysR family transcriptional regulator [Marinomonas mediterranea]  clstr ali  27  91FDPLTSDRSFCINMTDLGEMYLLPQLMAHLAQYAPNVTVSTVRDHGHTLKEELETGSIDLAIGLLPQ---LEAGFYQRRLFDQDYVCLMRKDHPFAKGELSLEEFAKSEHIIIEAHDTGHGRVEKILTKSGIARVSKLKLPHFISAPYIVANTDLIATVTEKLALQTAETLSLEIKKHPIEIPPAQINMFWHRRFHQDSGNVWFRNLIFEM. 298
60 7.000e-88gi|548422951|ref|WP_022521200.1| MULTISPECIES: HTH-type transcriptional activator NahR [Halomonas]  clstr ali  31  91FNPAKSERTFHINMTDIGEIVFLPRLLQHLSHHAPGVSLNTVRSHHNDLKNEMEEGEIDLAVGLIPQ---LGAGFYQQRLFVQRYVCLMREHHPLAAEEFSLEAFRTAHHAVVVARGTGHGIIEEQLAHAGVVRPVRLTLPHFAAVPYIVSSSDLVVTVTDKLAEATRTRFGLAIREHPLTFPEIPINLFWHRRFHQDPGNRWLRGLMFSL. 298
61 9.000e-88gi|947755215|ref|WP_056417194.1| MULTISPECIES: LysR family transcriptional regulator [Acidovorax]  clstr ali  27  90FTPATLKRTITIGMTDIGEIVFLPALLERLGREAPGVTLNTVRNNATNLRDDMEAGKVDLAIGLLP---HLKAGFFQRRLFRQRYVCLFRRGHALDRPKLRLADYKAAEHLVIVSAGTGHGKIDELIHKAGIDRRVRLSVPHFVSVGHILQSTALVATVPERLALKLAGPFGLVLRTHPVPLPDAPISMFWHAKVHREPVNQWLRSMVFDL. 297
62 1.000e-87gi|495130266|ref|WP_007855077.1| LysR family transcriptional regulator [Acidovorax sp. CF316]  clstr ali  27  90FDPASSQRSFTVGMTDIGEIYFLPQLMQRIGELAPGVAISTVRNTAVNLKDAMEAGQVDLAIGLLPQ---LKAGFFQRRLFEQDYVVLLRQGHRLAQRRLRAVDFFAAEHVAVVSAGTGHGQVDEILDKHSPERRVKLKVPHFVAIGHILQSTDLIATVPERLAGRMVEPFGLVARPHPVKLPRIAINLFWHAKYHKDPANQWLRTLVFDL. 298
63 1.000e-87gi|742885199|ref|WP_039013643.1| LysR family transcriptional regulator [Cupriavidus sp. IDO]  clstr ali  27  90FDPLTSDRLFQLAMTDIGEVNFIPKLMSVLRERAPRVSVATVRNTALNLQEEMSHGKVDLAIGHLPE---LTSEFFQRRLFRQRYVCMFRPGHPLDKRTVRVKDFEQAEHVVVTAAGTGHARVDEILARLGVERNIRLKVPHFVAVADIVQSTDLVATVTEKFAQRSAGFFGLKYIAHPVDLPEIQINLFWHSRYHRDPASQWLRNLVFEL. 297
64 1.000e-87JCVI_PEP_1096701278915 /source_dna_id=JCVI_ORF_1096701278914 /offset=0 /translation_table=11 /length=328 /full_length=328  ali  27  100FDPLRATRTLTIGMTDIGEVVFLPALLEHLSQAAPGIALNTVRDTSVNLGDAMADGRVDLAIGLLPQ---LKGGFYQRRLFDQRYVCLFRRGHPLEDAPLTVDTWRNAEHLVVVSAGTGHGQVDEWLKRRRVARQVRLTVPHFMSVGYILQRTDLIATVPEHLAQQLAAPFSLGWRALPVTLPGAPIHMLWHTRVNQDEGNKWLRDVVVDL. 307
65 2.000e-87gi|740374598|ref|WP_038209867.1| LysR family transcriptional regulator [Xenophilus azovorans]  clstr ali  28  90FDPARSTRAFSLGMSDIGEIYFLPALMGALARRAPGVTLTTARGAAQPLKAEMEAGAVNLALGLLPQ---LQAGFFQRRLFTQRYVCLMRQGHPLARGRFGLREFRAAQHLAVVSPGTGHGIVEEVLARSGIERQVRLTVPHFVAVGHILHGTDLVATVPHRLAQRVTEPFGLVALPHPANLPEIAIHMLWHARVHRDPANQWLRGLVAE.. 296
66 2.000e-87gi|673536238|dbj|BAP28572.1| LysR family transcriptional regulator [uncultured bacterium]  clstr ali  31  79FDPATATHTWRVAATDYSESTVLLPVLNALRSAAPGTRLSVVEMVPPRIAKQAERGEIDLA---FHTSDESPLGMHRRVLFTERYVLAGRAGHPRLKRRPTPAQFCELEHVIVSPDGGGFGVTDEALGQLGLTRRVVLSVPHFLFMLSVLASTDLVAMVPERLVRNMSA---LQIVKPPVDVPGYELGMLWHERCHRDPAHRWLREQIAD.. 283
67 3.000e-87gi|551355424|ref|WP_022974785.1| LysR family transcriptional regulator [Nevskia ramosa]  clstr ali  28  90FEPATSERAFTIGMTDIGEIYFLPVLMEALSAAAPKLVISTVRNTAVNLRVAMESGQVDLALGLLPQ---LKGGFYQRRLFKQPYVCLMRHGHKLDKRAITAKEFSAAEHVVVVSEGTGHGKVDELLERNGITRRIRLTVPHFIAVGHILSRSDMIATVPLRFAETIAEPFGLVHVKHPATLPEIAISLFWHAKQHQDPANRWLRELLLKL. 297
68 3.000e-87JCVI_PEP_1096697404505 /source_dna_id=JCVI_ORF_1096697404504 /offset=0 /translation_table=11 /length=310 /full_length=310  ali  26  98FEPANSERKFIVGMNDIGEIYFLPTLMKILADIAPGISLSTIRTTGANLAEAMEAGRIDLAIGWLP---HLKSGFFQRRLFVQEHVCLFRHGHPLKSSPLTQEEFEAAEHVVVSSVGTGHASVDAHIEKLGIRRRAVLTVPHFVAVGHILASTDMIATVPERFARHCVAPFNLHYVDLPLKLPDIGINLFWHARFHKEAGNQWLRGLVFD.. 305
69 3.000e-87gi|555433267|ref|WP_023264799.1| LysR family transcriptional regulator [Cupriavidus sp. HPC(L)]  clstr ali  33  91FDPAQATDTWRIAAFDYAEATIVLPLLRDLRTEAPGTRLAIVQAVPSLLARQAEHGEIDLA---FHTTDGAPQGLHRRPLFTERYVLAGRAGHPGLKRKPTLAQFCRLEHVIVSPDGGGFGPTDEALAARGLSRRVALSVPHFLFVLSVLGSTDLVAMLPSRLVR---DAAGIKVVETPIEIPGYEMSMLWHERVHRDPAHRWLRDTIVA.. 295
70 3.000e-87gi|555407118|ref|WP_023263258.1| LysR family transcriptional regulator [Cupriavidus sp. HPC(L)]  clstr ali  28  90FDPLRSDRRFQLAMTDIGEVHFIPRLMSALRERAPGVSIATVRNTAINLAEAMSLGQVDLALGHLPE---LPSEFYQRRLFRQRYVCMFRAGHALDKRTVRLQDFERADHVVVTAAGTGHARVDEILAKLGVRRNIRLRVPHFVALADIVATTDLVATVTEKFAERSAAYFGLKSISHPVDLPDIQINLFWHGRYHRDPGNQWLRDLIFEL. 297
71 4.000e-87gi|520791437|ref|WP_020291298.1| LysR family transcriptional regulator [Pseudomonas sp. CFII64]  clstr ali  31  90FDPATTQKRFVIAMTDIGEIYFMPKLIQTLLKLAPGVSVRTLR-SHVGLSEALANGSVDLAVGLLPD---LQAGFYQRRLFHHRYVGLCRKGHPITRHAMTRERYCEFGHVRVIAASTGHGEIDGVMQRAGLHRDIKLEVPHFVAVGQILQNTDLIATVPERFATSCTEPFGLTILPLPMPLPEIAINLFWHARCVRDPANRWFRQLMFDL. 296
72 5.000e-87gi|37220702|gb|AAQ89672.1| NahR [Pseudomonas putida]  clstr ali  28  90FDPLTSERTFTLAMTDIGEIYFMPRLIDALARKAPHCTISTVRGSSVSLGQSLQDGTVDLAVRVLP---NLQAGFLQRRLLHNRYVCLCRKNHPATREPLTLERFCAYSHIRVIAASTGHGEVDSLMARAGIRRDIRLEVPHFVAVGHILQHTELLATVPERFADCCVEPFGLNVLPIPIDLPEIPINMFWHAKYHKDLANIWLRQLMFEL. 297
73 5.000e-87gi|504018288|ref|WP_014252282.1| LysR family transcriptional regulator [Burkholderia sp. YI23]  clstr ali  27  90FDPMRVTRTITIGMTDIGEVVFLPALVERLSREAPGIALNTVRDTSVNLSNEMAEGRVDLAIGLLPQ---LKGGFYQRRLFDQGYVCLFRRGHALDDAPLTLAAWREAEHLVVVSAGTGHGQVEDWLKQRGVQRRVRLTVPHFMSVGYILQRTDLIATVPERLALQLAAPFSLSLRALPATLPAAPIHLFWHARVQQDEGNRWLRGMVIDL. 297
74 6.000e-87gi|935520606|ref|WP_054432511.1| LysR family transcriptional regulator [Achromobacter sp.]  clstr ali  28  90FEPANVKRTVTIGMTDIGEIVFLPALLERLSREAPGVTLNTVRNTAVNLRDDMESGKVDLAIGLLP---HLKAGFFQRRLFTQRYVCLFRRGHALDRPRVTLAGYRAAEHLVIVSAGTGHSTVDELIRKAGIDRVVRLTVPHFVSVGHILQRTTLVATVPERLAETLVEPFALTLRPHPVTLPDAAINMFWHAKVHREPANQWLRGVIFDL. 297
75 6.000e-87gi|499555813|ref|WP_011236596.1| LysR family transcriptional regulator [Aromatoleum aromaticum]  clstr ali  31  88FDPTRARRTFRIAMTDISQLVLLPRLWERLRTVAPGIHIDIANLS-ANTAGMLESGEVDVALGFMPQ---LEAGFYQQALFRQHYVCMASATHPRIRRGLTLAQFEAEEHAVVSTSGTGHLIIDREIARQDIKRRVVLRIPSFVGIAYVVERTALLVTIPQRLGELLADEERLRVYPVPFPLPEYAVKQHWHGRYNNDPGNRWLRALIQEL. 294
76 7.000e-87gi|503853199|ref|WP_014087193.1| LysR family transcriptional regulator [Pseudogulbenkiania sp. NH8B]  clstr ali  32  88FDPASSERTFCISMTDISQLVLLPKLWAQLRKTSPGVHIDIVPLSTE-TPRMLETGEADLALGFMPQ---LEAGFYQQSLFRQRYVCVASTDHPRIHDELPLTQFETEEHAVVTSSGTGHLILDREIARQGITRHIALRVPNYLGIAFVVEQTDMLVTIPERLAQVLEGRGRFKVFPVPFELPDYAVKQHWHERYHHDPGNRWLRRVISDL. 294
77 8.000e-87gi|503551936|ref|WP_013786012.1| MULTISPECIES: LysR family transcriptional regulator [Gammaproteobacteria]  clstr ali  28  91FDPNDSSRMFKVVMTDLGEMYILPRLLDYLAKHAPTVSISTVREADGSLRDDLESGNMDLALGLIPQ---LEAGFYQRRLFEQRYVCLMRKGHPLSKGEFSLERFAEAEHIVIEAKDTGHVGVEKCLKKSGIARVIRLQLPNFMSAPYIVAQTDLIATVPETLAMTTKDSLGLEVREHPVEIPPAQINLFWHKRYHQDSGNMWLRNVLYDI. 298
78 1.000e-86gi|797177022|ref|WP_045848220.1| MULTISPECIES: LysR family transcriptional regulator [Aquitalea]  clstr ali  32  88FDPATAERTFCISMTDISQLVLLPRLWAHLRRTSPGVHINIVPLS-ADTPRMLESGTADLALGFMPQ---LEAGFYQQSLFRQRYVCVASADHPRVRDGLTLAQFEAEEHAVVTSSGTGHLILAQEIARLGIRHRIALRVPNYLGIAFVIEQTDMLVTIPERLAQVLEGRGRFRAFPVPFALPDYAVKQHWHERFHHDPGNRWLRSVLSEL. 294
79 1.000e-86gi|157837433|gb|ABV82786.1| unknown [Chromohalobacter sp. HS2]  clstr ali  28  91FDPATSQRRFQITMSDIGEIYFLPRLMSRLAEVAPHVSLRTTRSDLHDIKHDMEEGHIDLAVGLIPQ---LGAGFYQQRLFVQNYVCLMRENHPLARGTFSQEDFAKAQHIVVEARGTGHGKIEELLVRSGATPPIRLRLPHFVAVPYIINDTDLVVTVTDKLAEATASRFGLCAIPHPLALPDVPINLFWHRRFHQDAGNQWLRRLIHEM. 298
80 2.000e-86gi|950148825|ref|WP_057200971.1| LysR family transcriptional regulator [Acidovorax sp. Root217]  clstr ali  31  85FDPSRAQRTFRICMTDITHLALLPSLINRLGDIAPGINVQITHIS-GQTPKMLESGEADLAVGFMPQ---LEAGFYQQKLFDQDFACVVRSQHPRIRSRLSPAMFKRERHVVVTGAGTGQSLVEEELERLGIERNVALQLPNYLGIGALVANTDLVVTVPQRVAETLVRIADVKALAPPFALPVFAIKQHWHDRYQQDPANRWLRSVISDL. 291
81 2.000e-86gi|506357994|ref|WP_015877713.1| LysR family transcriptional regulator [Burkholderia glumae]  clstr ali  28  90FDPAHDERVVTIGMTDIGEVVFLPALLERLAAVAPRMVLNTVHDTHADLGKEMAEGRIDLAIGLLPQ---LQAGFHQRRLFDQAYVCVFRAGHPLAKSPLTMTNWREAGHVVVVSAGTGHGQVDAWLKRRGVARNVRLTVPHFMSVGHILQRSDLIATVPERLAMQLAEPFSLAIRPLPAAMPRAPIHLFWHTRVHQDDGNRWLREVIAKL. 297
82 2.000e-86gi|948181516|ref|WP_056839517.1| LysR family transcriptional regulator [Pseudomonas sp. Leaf127]  clstr ali  28  90FDPTSSLRRFTLAMTDIGEIWFMPRLIEALLQRAPGVSVTTVR-SDAQLSEGLAGGTVDLAVGLQPD---LQNGFYQRRLFIHRYVCLCRRDHPLTRQPMTSDDFCRQAHVHVAATSTGHGEVEQHLRRAGLQRDIRLQVPHFVAVGHILQRSDLVATVPERFASTCLVPFDLVALPLPVPLPEIAINLFWHARYHKDPANQWFRDLMFEL. 296
83 2.000e-86gi|1004041320|ref|WP_061496599.1| LysR family transcriptional regulator [Ramlibacter tataouinensis]  clstr ali  29  88FDPATAQRSFCISMTDISEIVVLPRLVNQLRRVAPGVQIATEHSSPE-TARRLESGEVDLAIGFLP---HLEAGFYQQTLFKQDFVCLAAARHPRVRSTLTKQAFLAEGHISVTTSGTGHAIVDKVLARHRMARRIALRVPSFLGVARLVASTELLVIVPRRLGEALAGQEAIRIIEPPVALPPFAVKQHWHERFHADAGNAWLRATLAQL. 294
84 3.000e-86gi|499934466|ref|WP_011615200.1| LysR family transcriptional regulator [Cupriavidus necator]  clstr ali  28  90FDPLRSVRAFRIAMTDIGEVHFIPPLMGALGDRAPGVTVTTVRNTAVDLAAEMSQGKIDLAVGHLPE---LGTTFFQRRLFRQRYVCLFRPGHAMDKKTVSMRDFEAAEHIVVTAAGTGHARVDEILAQHGVQRKIRLRVPHFVALADIIATTDLVATVTLTFAERCARYFGLRYVKHPFALPEIQINLFWHARYHRDPANQWLRDQFVGL. 297
85 3.000e-86gi|764960171|ref|WP_044530203.1| LysR family transcriptional regulator [Herbaspirillum sp. B65]  clstr ali  31  88FDPTTAERTFTISMTDISQLVLLPRLWAHLRRTSPGIHIDIVPLS-EQTPRLLESGQADLALGFVPQ---LEAGFYQQSLFRQRYVCVASADHPRIRRRLTLKQFEREEHAVVTSSGTGHLILAKEIASQGIRHNIALRVPNYLGIAFVIEQTDMLVTIPERLAEVLEGRGRFKVFPVPFALPDYAVKQHWHERYHHDPANRWLRSVVSDL. 294
86 3.000e-86gi|502273909|ref|WP_012748765.1| LysR family transcriptional regulator [Variovorax paradoxus]  clstr ali  27  90FDPATSARAFTIGMTDIGEIYFLPKLMQELARVAPGLSISTVRNTAVNLQDEMESGHVTLAIGLLPQ---LKSGYFQRRLFKQHYVCMFRRGHALDKRQISLAEFSRADHVVVVSEGTGHGKADELLGRKKIVRKVVLTVPHYVAVGHILHGSDLVATVPERLAQALAEPFDLSYVRHPARLPEIAISLFWHGRYHRDPAVAWLRALIVRL. 297
87 3.000e-86gi|654512511|ref|WP_027981809.1| LysR family transcriptional regulator [gamma proteobacterium L18]  clstr ali  28  90FDPATSQKRLVVAMSDIGEIYFMPRLIQTLLERAPGISLSTRR-SDVDLPRAMAAGEVDVAVGLLPD---LQAGFYQRRLFHHRYVCLCRQGHPLTRGALTRERFCAHGHVRILATSTGHGEIDAHMQRAGLQRDIRLEVPHFVAVGAILQHTDLIATVPQRFADSCVAPFGLTALPLPVTLPDIAINLFWHAKFNRDPANQWFRQLMVEL. 296
88 4.000e-86gi|518257224|ref|WP_019427432.1| hypothetical protein [Limnohabitans sp. Rim28]  clstr ali  29  90FEPANSARRFTLAMTDVGEMYFLPVLMDALAQTAPGVTLNVVAVTSDSLGEDMATGRTDLALGLLPQ---LQAGFFQQALFRQPYVCLMREGHPMARAPLTLADFAAADHVRVIAAGTGHGRVDEALERQGLQRRIRLTVPHYVALGDVLGHSDLIATVPERFAQRVTRPFALATRALPLAVDGSAIHQFWHARLHKDPGHQWLREQVAQ.. 301
89 5.000e-86gi|654773920|ref|WP_028228408.1| LysR family transcriptional regulator [Paraburkholderia ferrariae]  clstr ali  32  91FDPASARHTWTLAATDYGESTLVQPMLPTLRARAPHTRLAVVGLVPPRIEKQAEHGQIDLA---FHTTEGSPPNLRRRTLFTERYVLAGRAGHPRLKRRPTAAQFCALEHVIVSPDGGGHGVTDTVLAAAGLSRRVVLSVPHFLFVLSVAASTDLVAMVPERLARQNAA---LRVVEAPVEVPGYEMSMLWHERSHRDPAHRWLRELIVA.. 295
90 6.000e-86gi|490428941|ref|WP_004301085.1| LysR family transcriptional regulator [Thauera aminoaromatica]  clstr ali  27  93FDPLTSSRRFVIGMTDVGEIYFVPSLMRIISKLAPGVTISTVRNSRVNLKVEMEDGLVDLAIGLLPD---LKNDFYQRRLFRQGYACLFRVGHPFDGVPFGVDEFAAAEHVVVVSSGTGHGKTDELIERSAVRRNVRLRVPHFVALPYILEETDLVATVPERIAMRLASSFPLRFVPHPLDLPDIQINLFWHAKYHRDAGSQWLRTLICE.. 299
91 7.000e-86gi|654742022|ref|WP_028198238.1| LysR family transcriptional regulator [Paraburkholderia fungorum]  clstr ali  32  96FNPAEANHTWRVAATDYAESTILLPMLAGLRAAAPGTRLAIVEAVPPRIAKQAEQGDIDLA---FHTSEGAPPGLRRRVLFKERYVLVGRADHPRLKRRPTLAQFCKLEHVIVSPDGGGFGVTDDALAEVGLARRVVLSVPHFLFMKSVLADTDLVAMLPARLVR---GNSALKIVEAPVEVPGYEMAMLWHERSHRDPAHQWLRECIAE.. 300
92 8.000e-86gi|1019461812|emb|SAK89216.1| LysR family transcriptional regulator [Burkholderia sp. LMG 29321]  clstr ali  28  90FDPLRAARTVTIGMTDIGEVVFLPALLERLSREAPGLTLNTVRDTSVNLGDEMADGRVDLAIGLLPQ---LKGGFYQRRLFDQRYVCLMRRGHALEHAPLTLAAWREAEHLVVVAAGTGHRNVDDWLRKNSVRRKVRLTVPHFMSVGHILQRTDLIATVPERLALQLVEPFSLSVCPLPVKVPAAPIHLLWHERVQHDEANRWLRDVVIGL. 297
93 8.000e-86gi|780147071|ref|WP_045491420.1| LysR family transcriptional regulator [Pseudomonas sp. StFLB209]  clstr ali  29  90FDPASSRRRFTLAMTDIGEIYFMPQLIDTLLQRAPGLSVTTVR-SDAQLSEALASGAIDLAVGLQP---NLQSGFYQRRLFVHRYVVLCRHDHPLAGQAMTAQAFARQSHVHVAAASTGHGEVEQYLRRAGLQRDIRLEVPHFVAVGHILQRSDLVATVPERFASTCLQPFGLVALPLPVPLPEITINLFWHARFHKEPANQWFRDLMFEL. 296
94 1.000e-85gi|737534118|ref|WP_035507860.1| LysR family transcriptional regulator [Burkholderia jiangsuensis]  clstr ali  34  88FDPETAKQVFRIAMTDISQIVLLPTLLKRLRAIAPGVRIRVLHID-DTTPQLLESGEAELAVGFMPQ---LEAGFYQQKLFMQHFVGMVAAHHPRIQDAPTLDAFLAEGHIVVTPSGTGHSVVDRTLRQLGVERHAVLELPNYLGLANIIARTDLLATVPLRLAEPIADEAGIRLFELPFDVPTYQVKQHWHERFHHDVAHRWLRTVLTEL. 297
95 1.000e-85gi|501206693|ref|WP_012249711.1| LysR family transcriptional regulator [Bordetella petrii]  clstr ali  28  90FDPASSRRAFVIGVSDVGETYFLPRLMRRLGQLAPGVTIRTARTTSLDVKDEMERGRIDLAMGFLP---ALKSGFFQRRLFRQPYVCLFRRGHPLAGGAVSLRQFRAAEHVAILAEGTGHGVVDEIMQRAAVARRIRLTVPHFMAVGPVLQSTDMIAVVPLRFADCVCEPFGLVAAACPVKIPESVINVFWHARNHREAANQWLRQNIVEV. 297
96 2.000e-85gi|497237252|ref|WP_009551514.1| LysR family transcriptional regulator [Burkholderiales bacterium JOSHI_001]  clstr ali  29  90FDPASVKRAVTIGMTDIGEIVFLPQLVERLRHTAPGXXXXXXXXXXXXLRDDMESGQVDLAIGPLPQ---LKAGFFQRRLFRQRYVCLFRKGHALDRKRLTLADFKAAEHLVIVSAGTGHGKVDDLIRRSGVERKVRLTVPHFVSVGHILRRSDMVATVTERLAESLAEPFDLAFRPHPVELPEVAINVFWHAKVHRSPAHQWLRGVVFDL. 297
97 2.000e-85gi|549629166|ref|WP_022538752.1| LysR family transcriptional regulator [Ralstonia pickettii]  clstr ali  28  90FDPARSERDFHIAMTDIGEVHFIPKLMGALRELAPGVSVATVRNTAVNLAEEMSQGKIDLAVGHQPE---LASEFFQRRLFRQRYVCMFRPGHALDKRTVRLRDFEDAEHVVVTAAGTGHARVDEILAKGAVQRRIRLRVPHFVALADIVASTDLVATVTQKFAERSAKYFGLKYVKHPVDLPDIQINLFWHARYHRDPANQWLRTQVFDL. 297
98 2.000e-85gi|947514544|ref|WP_056178564.1| LysR family transcriptional regulator [Lysobacter sp. Root604]  clstr ali  32  91FDPARARQTWRVASADYGESAVLLPALAGLRALAPACRLAVLQMQPARVARQAEQGEIDLAL---HTTQGAPEGLRRRALFSERYVLVGRADHPRLKRRPTLAQFCALEHVIVSPDGGGHGVTDEALAPLGLSRRVVLSVPHFLFVTSVVASTDLVALLPERLVR---DAPALRVVEPPLELPGFELSMLWHERSHRDPAHRWLRDQIAA.. 295
99 3.000e-85gi|479289071|gb|ENO77171.1| putative LysR-type transcriptional regulator NahR [Thauera sp. 63]  clstr ali  32  90FDPATAQRSFRIAMTDISQFVLLPRLWAHVRSLAPGVRIEVFNLT-ADTAHMLEAGDVDLALGFMPQ---LDAGFYQQSLFRQHYVCLASAEHPRLRDGLSLAQFEAEDHAVVTTSGTGHLYIDREVLRQKVMRKVALRIPNFIGVSFVIEQTDLLVIVPSRFGEMLAERGRVRCYPVPFALPRYAVKQHWHGRFHHEPGNRWLRSVIREL. 296
100 5.000e-85gi|226934609|gb|ACO92380.1| LysR-type transcriptional regulator [Pseudomonas putida]  clstr ali  30  91FDPASSTRNFNLAMTDIGEIYFLPKLMVKLAELAPGVSLSTESESALNLKDAMESGAVDLAIGLLPQ---LGAGYFQRRLFEQHYVSLMRKGHPLAKGAYGVDEFIAAKHAVVIAAGTGHGQVEELLARSGVPRFVQLTQPHFVAVPYIVSAMDLVVTVTNKLAEATMERFELVMRPHPIDLPRVQINMFWHRRFHQDAGNRWLRGLIFEM. 298
101 5.000e-85gi|755035715|ref|WP_042388317.1| LysR family transcriptional regulator [Escherichia vulneris]  clstr ali  30  91FDPTKANLTWRVAATDYTETAIVLPLLNGLRTAAPGTRLAIYELSPGQSVRQAEQGERDI---IFHTRDSAPPELHQRSLFTERYVLAGRQDHPRLKRRPTLAQFCQLEHVMVSPDGGGFGATDAVLATHGLSRRVVLSVPHFLFMLKVLASTDLVAVVPERLVKSVG---GLTVVEPPVEVPGFEILMLWHERVHRDPGHQWLRNYIAD.. 295
102 6.000e-85gi|639469139|ref|WP_024642971.1| LysR family transcriptional regulator [Pseudomonas syringae]  clstr ali  28  90FDPATAHKRITVAMTDIGEIYFMPRLIGRLLAAAPGVSVSTVR-SHAGLSEGMANGDVDLAVGLLPD---LQAGFYQRRLFHHRYVCLCRKDHPITRSAMTQELFCKFGHVRIVAANTGHGEIDTFMQRAGLVRDIRLEVPHFVAVGHILQNTDLIATVPERFATSCAGPFGLTTVALPLPLPEIAINLFWHMRFNRDPANVWFRNLMFEL. 296
103 6.000e-85gi|947920477|ref|WP_056580638.1| LysR family transcriptional regulator [Variovorax sp. Root473]  clstr ali  27  90FDPATSTRSFTLAMTDIGEIYFTPRLMETLSAVAPGVTISTLRNTATHLRDELEAGQVDIAIGLLPQ---LKSGVFQRRLFLQRYVCLFADTHPLARKRVSLKDFSAADHVQVQAAGTGHGKADDVMAAQGIQRRIRLKVPHFVAIGHILQSSAMIATVPERLARSIAEPFGLVWRPHPVALPQIAINLFWHAKVHRDPGNQWLRGLLFD.. 298
104 6.000e-85gi|921229675|ref|WP_053174568.1| LysR family transcriptional regulator [Limnohabitans planktonicus]  clstr ali  28  90FDPALSTRSFTLAMTDVGEMYFLPVLVDALTRSAPGVTLQVVSVTQASLKEDMATGRIDLAMGLLPQ---LQAGFFQQALFRQKYICLMRRGHPLAAGPLTLSSFTQAEHVRILAAGTGHGRVDVALENQKLRRHFRLTVPHYVALGDVLSHSDLIATVPERFADRTLGPFGLSKRELPIPVAESAIHQFWHSRLHRDPGHQWLRQL..... 294
105 7.000e-85gi|501189794|ref|WP_012232812.1| LysR family transcriptional regulator [Sorangium cellulosum]  clstr ali  32  105FEPATARRSFTVATVDYVELILLPRLVQKLVSEAPFIDLVARPYDSE-MWSAMETGKVDLAIGLLP---ALPAGFYRQRLIEERYMCVVRRSHPAVRGKLTLKTYTSLPHALISPRGEGGGRVDEVLAERGLSRRVALQIPHFLVAAHIVAQTDLVLTVPARIARVFAEMEELHVMKPPVELGGFSVDQVWHERHAKDPAHTWLRGVFAEI. 311
106 8.000e-85gi|490765836|ref|WP_004628071.1| LysR family transcriptional regulator [Ralstonia pickettii]  clstr ali  29  91FDPAHATNTWRVAATDYGESTIALPVLNTLRTSAPGTRLAMLGLVPTRIEKQAEQGEIDLA---FHTTDGAPPGLRRRALFTERYVLIGRAGHPRLKRRPTLAQFCTLDHVIVSPDGGGFGVTDEALAAAGATRRVVLSVPHFLFVMTAVASTDMVAMLPERLVR---GASALQAVEPPVEVPGYEMSMLWHERVHRDPGHQWLRDVIA... 294
107 8.000e-85gi|639943935|ref|WP_024767702.1| LysR family transcriptional regulator [Pseudomonas nitroreducens]  clstr ali  25  90FDPRSSKKEFIIRMSDIGEIYILPRLMRVLAEEAPGVSITIMRGNNESLKSDMESGRIDLAIGLI---EGLEAGFFRRQLYEQGYVCVFRKDHPLAQKELTLMDFSEAEHIIVTAAGSGHAKVDEIIEKQGIKRKVKLRIPQYASLEYLLKSSDLIATVPEALIQPNLFPLALDYSEHPVPLPRLSIDLFWHARLHRDPATQWLRNVIA... 295
108 1.000e-84gi|921258660|ref|WP_053201696.1| LysR family transcriptional regulator [Herbaspirillum hiltneri]  clstr ali  30  91FDPASADNTWRIAATDATETAVLLPALPGLRAAAPGTRLAVVELAPARIARQAEQGEIDLA---FHTTDDAPPGMRQRVLFREHYVLVGRSGHPKLRRKPTAAQFCTLEHVIVSPDGGGFGVTDEALAAAGLTRRVVLSVPHFLFMMSVLANTDLVAMLPSRLLRGSAA---LQVVEPPVDVAGYDMAMLWHERSHRDPAHQWLREHLAD.. 295
109 1.000e-84gi|1001915685|gb|KXS36863.1| LysR family transcriptional regulator [Halomonadaceae bacterium T82-2]  clstr ali  31  91FAPQASQRTFTIAMTDIGEIIFLPRLIERLSQEAPGVSLSTVRSHSDDLKREMEDGNVDLAIGLIPQ---LGAGFYQQRLFMQRYVCLLRRGHPLARGHFGIDEFMAARHAVVVAKDTGHGLVEEQLARAGIERPVRLKLPHFAAVPYIISETDLVVTVTDKLARATRDRLGLAMQEHPLLSQEVPINLFWHRRFHKDPGTRWLRRLIFGM. 298
110 1.000e-84gi|521063171|ref|WP_020395122.1| hypothetical protein [Thiothrix disciformis]  clstr ali  26  88FDPKTATRSFTISMTDITHMVLLPKLWAHLKQVAPHIKLEVYPIGRE-TADKLASGEVDLAIGFIPQ---LEAGFYQQTLFRQNYICLVSKHHPRIKQSLSLQHYQTEGHVSIVTSGTGHMLLDVEVKKRQLRRRIDLKLPSFLGIGYLIEHTELIASVPEKLGELLAQSNKIHCFPLPFALPDYAVKQHWHERFHADKGSQWLRETIMNL. 294
111 1.000e-84gi|654796613|ref|WP_028250558.1| LysR family transcriptional regulator [Variovorax sp. URHB0020]  clstr ali  32  85FEPATESRTFRICMTDITHLVLLPALINRLRDVAPGTKVEITHIS-GQTPKMLATGEADLALGYIPE---LEAGFYQQKLFDQDFSCVVRRDHPRVRVRMTQAMFSRESHVVVTASGTGHSLVEEQLERLRVQRNVSLRLPNFLGIGALVGNTDLVVTVPRRVADTLVRIADVKALRPPFELPVFSIKQHWHERYHLDPANRWLRGVISDL. 291
112 1.000e-84gi|1015846153|ref|WP_062842361.1| LysR family transcriptional regulator [Pseudomonas aeruginosa]  clstr ali  27  90FDPLHSKKEFIVRMSDIGEIYILPRLLRVLAEQAPGVSVTIVRGNNETLKSDMESGRIDLAIGLL----ELEAGFFRRQLYKQGYVCVFRRDHPFAKEGLTLEDFLEADHVVVTAVGSGHAKVDELIEKKGIRRKIKLRVPQYASLEHLLKGSDLIATVPEALVQPGIFSPALGCSEHPVQLPRLSIDLFWHARLHRDPANQWLRNVIA... 294
113 2.000e-84gi|951104770|ref|WP_057594712.1| LysR family transcriptional regulator [Variovorax paradoxus]  clstr ali  30  88FDPATAERSFRICMTDISEVVLLPGLLGHLRQVAPGVRIETEIISTE-SGRRLEDGAVDLAVGFMPQ---LEAGFYQQTLFMQNFVCLAARNHPRVGARLTRKRFEAEAHAVVASSGTGHAIVDKTIARLGLRRHVVTRLSSFLSVARIVAHTELLVVVPRILGQVLATQEPVQLLEPPFELPSYAVKQHWHERFHADAGNAWLRRTLAQL. 294
114 2.000e-84gi|493249743|ref|WP_006217617.1| LysR family transcriptional regulator [Achromobacter piechaudii]  clstr ali  27  90FDPARSERAFVIGVNDVGETYFLPRLMRALDGAAPGVTIRTVRTTSIDVRDEMERGRMDLAMGFLP---GLQSGFFQRKLFSQPYVCIFRRDHPLARSGVSARQFRAAEHVAIVSEGTGHGVVDEVIAQAGIERRLRLTVPHFIAVGPVLQATNMIAVVPQRFADCACGPFGLATAPCPVKIPESVINVFWHARNHREPANQWLRQVVVE.. 296
115 2.000e-84gi|946881558|ref|WP_055804438.1| LysR family transcriptional regulator [Variovorax sp. Root318D1]  clstr ali  31  91FDPGEATTTWRVAAADYAESAILLPALAGLRAAAPNTRLAVVEAVPSRMARQLEQGELDL---FFHTSVGAPPGLHRRVLFNERYVLAGRAGHPRLKRRPTLAQFCALEHVVVSLGGGGFGPTDDALAEKGLARRVALSVPHFLFMMSVLAGTDMVAMLPERLAR---GAPGLRVVEAPLEVPGFEMAMLWHERRHRDPAHRWLRERIAA.. 295
116 2.000e-84gi|503771276|ref|WP_014005352.1| LysR family transcriptional regulator [Collimonas fungivorans]  clstr ali  29  91FDPAQASQTWRVAATDYGESTIVLPALSGLRSTAPGTRLAVLELVPPRIARQAEQGDIDLA---FHTSEGSPPGLRRQTLFSERYVLVGRAGHPRLKKRPTLSQFCKLDHVIVSPDGGGHGVTDEALLEAGVARRVVLSVPHFLFVRSVLTNTDLVAMLPSRLVR---DAGDLQVVEPPVEVAGYEMAMLWHERCHRDPAHQWLREYIV... 294
117 2.000e-84gi|738155721|ref|WP_036113071.1| LysR family transcriptional regulator [Lysobacter capsici]  clstr ali  32  91FDPAQADRTWRVAASDYSESTVLLPALIGLRAAAPGTRLAVVEASPSRIAKQAEQGDIDLA---FHTSHDAPSGLRRRTLFAERYVLVGRAGHPRLKRRPTLAQFCKLDHVIVSPDGGGHGVTDDALAPLGLRRRVVLSVPHFLFVRSVLATTDLVAMLPARLVR---DTPALRVVEPPVEVPGYEMAMLWHERVHRDPAHQWLREHIA... 294
118 3.000e-84gi|512733853|ref|WP_016491709.1| LysR family transcriptional regulator [Pseudomonas resinovorans]  clstr ali  30  91FDPAEARQTWRIAATDYGETSILLPAMAGLRAQAPGTRLAVVEMVPARIARQAEQGEIDLA---FHTVEGSPPNLRRRTLFAERYVLAGRVGHPALQRRPTLKRFCALEHVIVSPDGGGHGITDEILGERGLERRVVLSVPHFLFLRSVLESSDLVAMLPERLVRGCA---GLRVVESPVALPGYEMAMLWHERSHRDPAHQWLRERIVQ.. 295
119 3.000e-84gi|916635198|ref|WP_051242289.1| LysR family transcriptional regulator [Azohydromonas australica]  clstr ali  30  88FDPARAQRVFRLCMTDLGEIAFLPRLLNHLQSRAPSVSIEAEKIGGDTPRR-LEEGTVDLAVGYIPQID---ASFYQQALFEQDFVCLVSRSHPRIRGKLTAAAYANERHVVVVTPGTGHGLVDRCLEAHGVTRHIGLRVPSFLAVAQIVGETELIATVPRHYADVTLAREPIRQLPPPFDLPTYAVKQHWHARYHRDPASLWLRQTIADL. 295
120 3.000e-84gi|951173482|ref|WP_057652364.1| transcriptional regulator [Bordetella sp. N]  clstr ali  28  90FDPATAEQTFTIAATDYALRAIAVPFLSALKRQAPRVQIALVPVDDAQISVQLERGEIDLAL---LTPDSTPPGLHARNLFEEKYVCVMREGHPAARRRLTPTQFCALDHALVSYSGGAFGVTDNALEKLGKSRRVTLSVKSFLILPEILRASDLVAILPSRLV---AGMEGLTVFEPPLDIPGFTKTAAWHERTHRDAAQRWLRELLFE.. 296
121 4.000e-84gi|748240241|ref|WP_039801550.1| LysR family transcriptional regulator [Azotobacter chroococcum]  clstr ali  30  91FDPAEARHAWRVAASDYSESAILLPALNGLRSVAPGTRLAVLQVVPSRIARQAERGEIDLAL---HTSEEAPSGLHRRALFTEHYVLVSRTGHPRLKRRPTLAQFCELEHLMVSPDGGGFGITDKALAEVGLTRRVVLSVPHFLFVMSVLASTDLVAMLPSRLVRNTSA---LQVVEPPVDVPGFEMAMFWHERSHRDPAHQWLREYIAD.. 295
122 5.000e-84gi|895891503|ref|WP_048994211.1| transcriptional regulator [Klebsiella pneumoniae]  clstr ali  26  91FDPMSAELSYTILATDYALKAVIVPLMAALKKRAPGIRVAVRPVDSERMQSLLERGDADLAL---VTPSTTPVDLHGRALYQEEYVCVMRSDHPLAAGSLTLDQFCEQEHILVSFEGHFYGVTDEALAKLGRTRHVGLSVNSFLVLPEVLRITDMIAVVPRRLA---CKDDYLVIVDMPLEVPGFTKSMAWHERTHRDPAHQWVRALCVEVS 297
123 6.000e-84gi|980981847|ref|WP_059400306.1| LysR family transcriptional regulator [Alicycliphilus sp. B1]  clstr ali  26  90FDPAKLNRPVTIGMTDIGEIVFLPALVERLTREAPGATLNTVRNTAVNLRDDMESGKVDLAIGLLPQ---LKAGFFQRRLFRQHYVCLFRQGHALDRKRLSLADIKAAQHLVIVSAGTGHGTVDELIRRAGVDRTTRLTIPHFVSVGHILQRTDLIATVPDKLADRLAEPFGLTSRPHPVALPEISINAFWHAKVHRSPVNQWLRGVVFDL. 297
124 6.000e-84gi|654285289|ref|WP_027800362.1| LysR family transcriptional regulator [Paraburkholderia dilworthii]  clstr ali  25  88FDSGTARRTFTLAMSDVGEMVFLPKILKRIARDAPLVDVRTVSTDPKDLMAALQRSEVDLAIGYFPDLQGT--DVFQQRLFRHGFVCLVRADHPVVSEGLTKKQFQSLPHAVVQAEGRSQEIVEQFLKAKGVQRREMLHSPHFLSIPMVIASTDLVVTVPAAVAEVFARFADVRALEPPYSMPSFDLKQHWHRSQQNDPGNRWLRAQVLEL. 296
125 7.000e-84gi|661259052|ref|WP_029954053.1| hypothetical protein [Achromobacter sp. DH1f]  clstr ali  29  90FDPAQSGRTFEVLLSDLGEVVFLPRLMQHLKAVAPGVSLRIRQLPRESYREALEAEDADLAIGFLP---ALTAGFYQQRLFGDHYVCLMRAGHPRIGQRLDIEQFAAESHVMIEPAGSRYRLIEQYLEKQGLRRHIALRVPHFTVVPEIIETSDLLAVLPGTVARIMAPQRRIKILPLPLEPPGFEVKQFWHERSHQDEGTRWLRGVIADL. 308
126 7.000e-84gi|506487369|ref|WP_015963914.1| transcriptional regulator [Enterobacteriaceae bacterium strain FGI 57]  clstr ali  27  91FDPLSAEMTCSIMATDYALKAVIVPLMSALKKRAPGIRVAVRPVDDERLFSLLERGDVDLAL---VTPATTPGDLHGRALYEEEYVCMMRADHPAASGTLSLDQFCAQDHILVSSEGGFWGVTDEALATLGRTRHVGMSVNSFLVLPEILRMTDMIAVVPRRLAL---QHEHLTIMPPPLDVPGFTKSMAWHERNHRDPAHQWIRALCVEVS 297
127 8.000e-84gi|516388007|ref|WP_017777683.1| LysR family transcriptional regulator [Paraburkholderia kururiensis]  clstr ali  29  96FDPARATHTWRVSAFDYGESTIVLPALSGLRAAAPGTRLAVVTVPPSELAKQAEQGAIDLA---FHTTEDAPPTLRRRALFTERYVLVGRAGHPRLKRRPTLAQFCQLEHVIVSPKGGGFGVTDDVLAKAGMTRRVVLSVPHFLFVRSVLESTDLVAMLPERLVR---GMDTLRVVEPPVDVPGYEMSMLWHERVHRDPAHRWLREFV.... 298
128 9.000e-84gi|516085915|ref|WP_017516495.1| LysR family transcriptional regulator [Pseudomonas nitroreducens]  clstr ali  30  91FDPAQADNTWRIAATDYGESTILLPALSAIRGSAPGTRLALLELSPLRIARQAEQGDIDLA---FHTTEGSPPGMRRRTLFSERYVLAGRAGHPKLRRKPSLAQFCQLEHVMVSPDGGGFGVTDEVLAAVGLSRRVALSVPHFLFVISALASSDLVAMVPARLVRN---NPALRVVEAPVEVPGYEMSMLWDERSHRDPAHRWLREQIAA.. 295
129 1.000e-83gi|983028029|gb|KWT72152.1| LysR-family transcriptional regulator [Variovorax sp. WDL1]  clstr ali  28  88FVPAQAERTFRICMTDISEIVLVPILMNHLRLAAPGVCVEVEKISPESP-RHLEGGDVDLAVGFMPQ---LEAGFYQQVLFSQRFVCVASQQHPRIGHRFTKAAFGREQHVLVSASGTGHVIVDKTLARAGVERRIALRVPSFLGVASIVADTELIATVPSHFATVMQRRERIRILPMPHALPAYEVKQHWHARFHSDPGNVWLRRTVAEL. 294
130 1.000e-83gi|757640633|ref|WP_042880251.1| LysR family transcriptional regulator [Cupriavidus necator]  clstr ali  26  88FDPAQVQRTFTIAMSDVGEMVFLPRLLHRLATLAPGLNITTVSTHPKALMSALQRSEVDLAVGYFPDLDGV--DVFQQRLFRHSFVCLVRRGHPAVQGKMTKKSFTELPHAVVQAEGRSQEIVEQYLKEQGVQRRELLHSPHFLSIPMVIAATDLVVTVPAAVGEVFAQIADVAVLEPPYRMPTFDLKQHWHRSQHDDPGNRWLRGIVLEL. 296
131 1.000e-83gi|20067197|gb|AAM09546.1|AF491310_1 LysR-type transcriptional regulator NahR [Pseudomonas fluorescens]  clstr ali  26  90FDPLTSERTFTLAMTDIGEIYFMPRLMDAITLQAPNCAISTVRDSSMSLMQALQNGTVDLAVGLLP---NLQAGFFQRRLLHNHYVCLCRKDHSVTREPLTLERFCYYGHVRVIXAGTGHGEVDTYLAKAGIRRDIRLEVPHLVAVGHILQRTELLATVPIRFPDSCVEPFGVSVLPHPVALPEIAINMFWHAKYHQDLANIWLRQLMFDL. 297
132 1.000e-83gi|519045662|ref|WP_020201537.1| LysR family transcriptional regulator [Cupriavidus sp. WS]  clstr ali  29  91FDPATASQTWRVAASDYGESTVLLPALNGLRAAAPGVRLAVLELMPPRIAKQAEQGEIDLA---FHVGDEASPGLRHRTLFTERYVLAGRAGHPRLKRRPTLAQFCALDHVIVSPDGGGFGVTDDALARAGLTRRVVLSVPHFLFMMSVLATTDLVAMLPARLVHGVGA---LQVVEPPLAVPGYEMAMLWHERSHRDPAHRWLREYIA... 294
133 1.000e-83gi|390927097|gb|EIP84510.1| transcriptional regulator, LysR family [Burkholderia thailandensis MSMB43]  clstr ali  28  108FDPAAAVHTWRVAASDYSESTVVLPALAGLRAAAPGTRLAVVETVPSRIAKQAEQGDIDLA---FHITECAPGNLRHRALFTERYVLVGRAGHPRLKRRPTLAQFCRLDHVIVSPDGGGFGITDHALAKVGLARRVVLSVPHFLFMMSAVANSDLVAMMPSRLVR---DSRALQVVEPPIDVPGFQMAMLWHERSHRDPAHQWLREHVAA.. 312
134 1.000e-83gi|969981795|ref|WP_058642132.1| LysR family transcriptional regulator [Pseudacidovorax intermedius]  clstr ali  30  90FDPETSRRTFNLALTDIGEIYFMPLLMNALAQRAPHVQISTVRPHAGNLKEDMEAGTVDLAAGPLPD---LQTGFFQTRLLRHRYVCMFRRNHPVARAPMTLAQFSALDHVGVHSANTGHADIDALMDRAGVRRRMRLRVPHFVAVGPILQSTDLIATVPERFSERIADAFGLVSTPHPVRLPDIAINLFWHAKFNRDPANLWLRQLMVEL. 297
135 2.000e-83gi|983021718|gb|KWT66091.1| LysR-family transcriptional regulator [Variovorax sp. WDL1]  clstr ali  27  90FDPATSTRGFTLAMTDIGEIYFTPLLMELLARTAPGVTISTVRNTAVNLRDAMEAGHVDIAIGLLPQ---LKTSIFQRRLFRQRYVCLFGAAHPLAARPLSLKDFSAADHLLVQAVCTGHGQVDNLMAAQGIVRRIRLTVPHFVAIGHILRATPMIATVPERLARSIAEPFGLVSRAHPAKLPEIAINCFWHARFHRDPGNQWLRGLLFE.. 297
136 2.000e-83gi|488369734|ref|WP_002439119.1| transcriptional regulator [Shimwellia blattae]  clstr ali  27  91FEPSESRITYTIAATDYALKAVVVPLMAALKQQAPGIRVAVVAVDHGRLGRQLEQGEVDMAL---VTPQTTPEDLHSQPLYQEQYVCMMRASHPHAGGPLSMETFCSLEHILVSGRGSFRGPTDEALAALGRSRRVGLVVNSFLVLSEMLRATDMIAVVPRRLA---CRQEQMAVMAPPLDIPGFTKSMAWHERVHRDPAHQWIRALCAQVS 297
137 2.000e-83gi|557914565|ref|WP_023471408.1| hypothetical protein [Betaproteobacteria bacterium MOLA814]  clstr ali  27  90FEPQTSTRNFQLAMTDIGEMYFIPPLMVLLSKVAPNVQISTVRPNSGNLRKDMESGTVDLALGLLP---NLQTGFFQRRLFRHKYVCVFRKGHPVAKSPITLRQFSELEHVGVVAANTGHSEVDGLLKLAGIQRKMRLIVPHFIAVGHILQTTNLISTLPERFAQRCEVPFELVTSPHPARLPDIAINLFWHAKFNRDPANMWIRQLFVEL. 297
138 3.000e-83gi|750505210|ref|WP_040787080.1| LysR family transcriptional regulator [Massilia niastensis]  clstr ali  27  93FDPATSSRRFTLAMTDVGEIYFMPPLGERCRQLAPQVQLSSRRAGTLNLKEEMEGGHVDLAIGPFEDVSEA---LYHRQLFRQPYVSMFRKGHPLGRGELSLERFVRAEHLLVDSSDSPYDRINQVLARAGIGPSVRFRVPHFTAVPYIVSSSDLVVTVPQKLAERASAPFGLEWVTPPLDLPPLQTNIFWHRRFNQDPGNQWLRGLLADV. 300
139 3.000e-83gi|1019390933|emb|SAL41427.1| LysR family transcriptional regulator [Paraburkholderia sordidicola]  clstr ali  29  96FDPAEAGNTWRVAAADYAESTVVLPALAGLRAAAPGTRLAIVQMVPSRIARQAERGEIDIAL---HTSDGAPEDMHRRVLFSERYVLAGRAGHPRLKRRPTLAQFCALDHVIVSTDGGGFGITDEALAEAGLTRRVVLSVPHFLFMMQVLQSTDLVAMMPSRLVRNVGT---LRVVEPPVDVPGYEMAMFWHERSHRDAAHRWLREFIAQ.. 300
140 4.000e-83gi|515799805|ref|WP_017230560.1| LysR family transcriptional regulator [Cupriavidus basilensis]  clstr ali  29  91FDPAEASHTWRVAATDYSESAILLPALAGLRSAAPGARLAVLEAVPPRIAKQAEQGEIDLA---FHLSEEAPPGLHCRALFSERYVLAGRAGHPRLKRRPTLAQFCELDHVIVSPDGGGFGVTDQALSQAGLARRVVLSVPHFLFVRSVLESTDLVAMLPSRLV---SGTTTLQVVEPPVEVPGFEMAMLWHERSHRDPAHQWLRDFIAD.. 295
141 5.000e-83gi|738284621|ref|WP_036238792.1| LysR family transcriptional regulator [Massilia sp. JS1662]  clstr ali  26  88FDPAGSTRAFHICVTDISEIVLLPRLLNHLREHAPGVRIEVTKISPDSPAE-LSDGTVDLAIGFMP---HLEAGFYQQKLFDQHFVGLVSNRHPRVREALSVAALQAEQHVRVSSSGTGHAIVDKTLGELGMPRNVALQVPSFLGVARIVAQTELVAIVPYRYGAAMAASEDVRMLPLPVDLPSFQVKQHWHERYHEDASNRWLRQVVA... 292
142 5.000e-83gi|517251281|ref|WP_018440099.1| LysR family transcriptional regulator [Burkholderia sp. JPY347]  clstr ali  29  91FDPAAADHTWRVAATDYTESTIVLPALNALRSAAPRTRLAVLEMIPSRIAKQAEQGDIDLA---FHTTEGAPSALRRRALFTERYVLVGRAGHPRLKRRPTLAQFRALEHVIVSPDGGGFGITDEALAEVGLSRRVVLSVPHFLFVMSVVASTDLVAMLPERLVRNVNA---LEVVESPIEVPGFEISMLWHERAHRDRAHQWLRECIVQ.. 295
143 5.000e-83gi|730280213|ref|WP_033969177.1| LysR family transcriptional regulator [Pseudomonas aeruginosa]  clstr ali  33  96FDPTQSRHTWRVAATDYAESAILLPILASLRRQAPGSRLAVLELAPAQVSRQLERGEIDLA---FHTLEEAPPGLRCRRLFSERYVLAGRAGHPGLRRRPTLKQFCRLEQAIVSPDGGGFGPTDQALAELGAERRVALSVPHFLFLRAVLESTDLVALLPSRLVR---ERDGLRVVEAPLEVPGYDLAMLWHERSHRDPAHRWLRELIAA.. 300
144 7.000e-83gi|497202498|ref|WP_009516760.1| MULTISPECIES: LysR family transcriptional regulator [Hydrogenophaga]  clstr ali  28  88FDPAQAQREFRVCMSDISEVVLLPALVNHLGRVGPHIRVE-AEKASAQSRGRLESGDVDLAVGFMPD---LEAGFFQQALFAQDFVVMVSREHPRIQKSLTKHRFEAEGHIVVTTSGTGHSIVDKVLGRHQVQRRIVLRVPSFLGVARIVAQTDLLVVVPRLLGDVLASQDRVRLFEPPWSLPKYKVKQHWHERFHADPGHVWLRQTMAQL. 294
145 7.000e-83gi|489957737|ref|WP_003861044.1| MULTISPECIES: transcriptional regulator [Enterobacter cloacae complex]  clstr ali  28  91FDPNTARLTFTLAATDYALRAVVVPFIAALKTQAPGIRVRVVPVTPGSLVSQLEQGAIDVAL---ITPHTTPDELHSRALYEERYVCMMRADHPNAGEPMTLDRFCALEHVLVSYEGDGFGVTDSALEKIGRTRHVGLSVSHFLVLPDVLALSDMIAVVPSRIAEN---QTGMFICETPVPVPGFTKSMAWHGRTHRNPAQAWLRGLLLQTS 297
146 9.000e-83gi|518765493|ref|WP_019922782.1| LysR family transcriptional regulator [Duganella zoogloeoides]  clstr ali  29  91FDPASATNTWRVAATDYGESTIVLPALASLRQQAPGTRLAVLELAPDRITRQAEQGEIDLA---FHTSAGAPPGLRRRTLFAERYVLAGRVDHPRLQRKPTLRQFCTLEHVLVSNNGGGFGVTDEALAQAGLTRRVALSVPHFLFMIAALAATDLVAMVPERLV---CGNRALKTVAPPIEVPGYEMAMLWHERAHRDPAHQWLRAHI.... 293
147 9.000e-83gi|1011001943|ref|WP_061960058.1| LysR family transcriptional regulator [Cupriavidus pauculus]  clstr ali  28  90FDPLRSNRLFRIAMTDIGEVHFIPRLMGALSDRAPKVTVATIRNTAVDLPTEMSQGHIDLAVGYLPE---LGQEFFQRRLFSQRYVCMFRPGHAMDKRAVRMRDFENAEHVVVTAAGTGHARVDEILGKHGVERKIKLRVPHFAALADIVASTDVVATVTETYARRSATYFGLKYIKHPFDLPEIQINLFWHGRYHRDPANQWLRNQFVEL. 297
148 1.000e-82gi|963309798|ref|WP_058376019.1| LysR family transcriptional regulator [Pandoraea norimbergensis]  clstr ali  30  96FDPARADHTWRIAATDYTESTVILPMLPGLRAVAPHTRLALIEMTPALMAKQAEQGDIDLA---FHTTDGSPDGLRRRKLFTERYVLVGRRDHPKLRRRPTLKQFCALEHVMVSQSGGFQAGTDEVLAALGHARRVVLSVPHFLVARAAIATSDLVAMAPERLVR---DDPALQIVAAPVEVPGFEISMLWHERVHRDPAHQWLRERIA... 298
149 1.000e-82gi|501394638|ref|WP_012426204.1| LysR family transcriptional regulator [Paraburkholderia phytofirmans]  clstr ali  25  90FDPATSTHTFSIALSDVGEIVFLPRLLQLFAERAPFANLRSVTVSPSQVERGLESGDVDLAIGYFPDL--AGNNFFQQRLFSHRFICLMRTGHPLSKAPLTLAQYVASGHAVVRSEGRSQEILEQYLEKKRIKRRAVLETPHFMSLPFILARTDLLATVPHAIGAYVSEHASITLVEPPLPLPHFDLRQHWHRKFHNDPRGGWLRSVVAEL. 299
150 1.000e-82gi|928911735|ref|WP_053936929.1| LysR family transcriptional regulator [Amantichitinum ursilacus]  clstr ali  31  91FDPAPAQHTWRVAATDYGGSTIVLPALAALRQHAPGTRLAVLEMVPSRIARQAEQGDIDLA---FHTRDGAPPGLHARVLFDERYVLVGRADHPQLQRAPTRKQFCALEHVIVSPDGAGFGITDEALAQVGLSRKVVLSVPHFLFVKAVVAQTDLVAMLPERLVRN---APELTVVAPPIEVPGYAMTMLWHERVHRDPAHQWLREQIAA.. 295
151 1.000e-82gi|495159147|ref|WP_007883949.1| LysR family transcriptional regulator [Herbaspirillum sp. CF444]  clstr ali  25  88FNPATTGRKFTIALSDIGEMTFLPKVLDRFRRDAPGASVASVSMTPLELNVALENGEVDLAVGYFPDLKN--RNLFQQRLFSHDFICLLRADHPIRSRKISMEQFLKLGHAVIRAEGRSQELFEQLLIKKKIQRRIVLSTPHFMSIPFLIASSDLVVTVPRAVGASFAQFSNIRLVEPPLDIPTFDLRQHWHRKYHKDGANVWLRSILAEM. 296
152 1.000e-82gi|947805633|ref|WP_056467087.1| LysR family transcriptional regulator [Rhizobacter sp. Root404]  clstr ali  29  88FDPATAQREFRIGMTDISEIVALPILTNYLQRHAPGVTVEAERTSPDSPRR-LEAGEVDLAVGFMP---HLEAGFYQQTLFEQNFVCLAAEHHPRVRSRPNKRAFLAESHIVVTTSGTGHAIVDKVMAEHGYERRVALKVPSFLGVARIVAQTELLVIVPRRLGEALAQQERVRAYAPPLPLPTFAVKQHWHERFHADAGNAWLRRTLVDL. 294
153 2.000e-82gi|657257282|ref|WP_029363081.1| LysR family transcriptional regulator [Herbaspirillum lusitanum]  clstr ali  24  81FDPLDSQREFRICMTDISEVVLLPTLLNYLKQAGPGIKVDVSKISPETPKN-LESGVVDLAVGFMP---HLEAGFYQQKLFDQNFICLVSREHPRIRNKLSRAMFINESHIQIKSSGTGHSIVDKTLAEEGIERQIVLQLPSFLGVARIVAETEYIVTVPSRYGIAMADHESIKMLQPPIVLPSFSVKQHWHERFHEDVSNRWIRQVMAKL. 287
154 2.000e-82gi|490865794|ref|WP_004727820.1| transcriptional regulator [Vibrio furnissii]  clstr ali  24  91FDPLSVKMTYTIAATDYALKAVVVPFMAALKKRAPGIRVAVITVNHDNLSRQMEQGEVDLAL---VTPQTTPEELHSRALYDEQYVCMMRADHPAATGCLTLDQFCSLEHILVSNKGSFWGPTDEALAGMKRQRHIGLSVNSFLILAEVLRITDMIAVVPRQLA---SRQDDLVIMDTPLEVAGFTKSMAWHERSHRDPAHRWLRSLCLEVS 297
155 2.000e-82gi|655955965|ref|WP_028998815.1| LysR family transcriptional regulator [Azohydromonas australica]  clstr ali  28  85FDPATSQRRFRISMTDTSHLQFLPSLINRVNTLAPSVHIEILRITP-ATPRLMESGESDLAVGFMPE---LEAGFYQQKLFEQSFACVVRKDHPRIEARMTATLFKREKHVAITAAGTGHELVERELERLGVQRRVALSLPTLPGVANLLANTDLIATVPERVAQMLVRIANVKALNPPFEFPTFSIKQHWHERFQQDPANRWLRSTVADL. 291
156 2.000e-82gi|496062012|ref|WP_008786519.1| transcriptional regulator [Citrobacter sp. 30_2]  clstr ali  25  91FDPLTAALTFTVAATDYALKAVIVPFIAALRVRAPGIRVRVIPVEPVLLTTQFEQGKIDLAL---LTPDSTPDNLHSRALYDEEYVCLMRHAHPDAGQPLTLDRFCALEHVLVSYEGESFGVTDEALASVGRQRQIGLSVSSFLVLPDILAISDMIAVVPARLAY---DDPRMHVLSPPLPIAGFTKSMAWHERTHRDAAHQWLRNLVHETS 297
157 2.000e-82gi|503426677|ref|WP_013661338.1| LysR family transcriptional regulator [Marinomonas mediterranea]  clstr ali  26  91FDPQSSDRVFCVNMTDLGEIHMLPRLMAYLAEHAPNLSISTVRDNGHSLREELETGSVDLAIGLLPQ---LEAGFYQRRLFDQEYVCLVREGHPLAEQTLTLDNFSKSEHIIIEAQDTGHGRVEKQLAKSGILRVSKLKLPHFISAPYIIAHTDLVATVTEKLALQMANSLDLVIKPHPVDIPAAQINMFWHRRFHQDSGNVWLRNVFFEL. 298
158 3.000e-82 [KEGG:K14657] LysR family transcriptional regulator, nod-box dependent transcriptional activator;|[COG0583] Transcriptional regulator :  ali  28  91FDPLTATFTFTLAATDYALRAVVVPFIAALKVQAPGIRVRVVPVESDRLVSQLEQGSVDVAL---ITPHTTPDELHSRALYDERYVCMMRADHPDAGQPMTLDRFCALEHVLVSYEGDGFGVTDGALEKTGRTRHVGLSVSNFLVLPDVLALSDMIAVVPSRIAE---KQTGMFVCETPVPVPGFTKSMAWHGRTHRNPAQAWLRGLLLETS 297
159 3.000e-82gi|515899706|ref|WP_017330289.1| LysR family transcriptional regulator [Burkholderia pyrrocinia]  clstr ali  31  91FDPGTATHSWRVAATDYAESTIVLPTLNTLRAAAPGTRLAVVELAPPRIVKQAELGEIDLA---FHTTDCSPDGIRRRALFTERYVLVGRDGHPKLKRRPTLAQFCALEYVIVSPEGGGFAVTDTALAKLGLTRRVALSVPHFLFAISAVAHTDLVAMLPERLVR---DAPALRIVDVPVEVPGYEMSMLWHERSHRDPAHRWLRDTIAA.. 295
160 4.000e-82gi|950252742|ref|WP_057289262.1| LysR family transcriptional regulator [Noviherbaspirillum sp. Root189]  clstr ali  28  90FDPSTTNTTFTVALSDIGEMVFLPKLLQAIRERAPLATVSSVTLPASEVGDALESGTVDLAMGYFPDLKRH--NFFQQRLFSHSFVSLLRKDHPVRSEKMTLSQFLALGHAVVKAEGRSQEVFERYLERKNIRRRVVLSTPHFLSIPFIVATTDLVVTVPLAVGTSFAEFSDVRLVAPPLQIPRFDLKQHWHRKYHDDGRHQWLRSLVAEL. 298
161 4.000e-82gi|654797683|ref|WP_028251622.1| LysR family transcriptional regulator [Variovorax sp. URHB0020]  clstr ali  27  88FDPGEAKRNFRICMTDISEVVLLPALLDHLRRVAPGVHIETEIISIE-SGRRLEDGEVDLAVGFMPQ---LDAGFYQQTLFMQNFVCLVARNHPRIGARLTRKRFEAEAHAVISSSGTGHAIVDKTITRLGLERNVVARLSSFLSVARIVAHTEMIVIVPRILGEVLVTQEPVRLLDPPFALSPYAVKQHWHERFHADAGNAWLRRTVAQL. 294
162 5.000e-82gi|1019398486|emb|SAL60803.1| LysR family transcriptional regulator [Paraburkholderia telluris]  clstr ali  29  91FDPASATHTWRVAATDYSESTVLLPALGGLRTAAPRTRLAVLELAPPHIARQAEQGVIDLAL---HTSDEAPAGLRRRPLFTERYVLAGRAGHPRLKRKPTRTQFCALDHVIVSPDGGGFGVTDEALSEAGLTRRVVLSVPHFLFVMSVLANTDLVAMLPARLVR---DSPALRIVEPPVDVPGYEMAMLWHERSHRDPAHSWLREHIAA.. 295
163 5.000e-82gi|503304174|ref|WP_013538835.1| LysR family transcriptional regulator [Variovorax paradoxus]  clstr ali  30  88FEPAGAQRRFRICMTDISEVVLLPGLLDHLRHVAPGVHIETEIIST-NSGRRLQDGEVDLAVGFMPQ---LDAGFYQQTLFMQNFVCLAAQNHPRIGARLARKRFEAEAHAVVSTSGTGHAIVDTTIARLGLKRDVVVRLSSFLSVARIVAHTELLVVVPRILGKVLATQEPVKLLELPFALPDYAVKQHWHERFHADPGNAWLRRTLAQL. 294
164 5.000e-82gi|737741392|ref|WP_035710096.1| LysR family transcriptional regulator [Haematobacter massiliensis]  clstr ali  30  90FDPKTSQRSFAFSTSDIGELVFLPEILSTLRREAPGVTLRCLSLPPDELQQALADGIVDIAFGYFPDLQGAL--IYQQKLFVHPFTCVVRADHPLIGDGLTLEQFASLEHAVVEQKGRSQEIAEHRMKELGIERRIVLRSPHFMSVPLLVASSDLISIVPLAVGRAYARIAPLKLVPPPFDIPLIELKQFWHRRLHADPGVVWMRGIIARL. 298
165 5.000e-82gi|1003367671|gb|AMO46461.1| transcriptional regulator LysR-like protein [Enterobacter sp. FY-07]  clstr ali  26  100FDPQVATLTWTLAATDYALKVVIVPFIAALKTQAPGIRVRVEPVEPRQLVSQLERGEIDVAL---MTPYSTPPELHSRALFDERFVCMMRANHPAARESLSLDRFCALEHALVSWDGDRFGVVDEALAAQGRTRRVSVSVGNFLILPDILAASDMVAVVPQRLANLT---EGMSTLATPLPVPGFTKTMTWHERTHRDPAHQWLRNVLLETS 307
166 5.000e-82gi|1019477340|emb|SAK99150.1| LysR family transcriptional regulator [Burkholderia sp. LMG 29323]  clstr ali  28  88FDAATSTRMFGLCMTDIGQRIVMPRLLEHLRRAAPGVRID-LSYTSEHTARQLESGEIDLAIGFLAQ---LDAGYFQQKLFDDRFVCIVNRKHPRLRGPISLDQFQAESHLIVATQGTGHVVVEQTLERNHVHRKVGLRIPNFLGVVSNIASTEYLAIVPERFARIIAEGNQIKVMELPFPVPKYRVMQHWHERYARDPGVVWLRNTIAEL. 295
167 6.000e-82gi|913611639|gb|AKU94171.1| Transcriptional regulator [Labilithrix luteola]  clstr ali  32  93FDPKTAKRQFTLATSDYVELTLFPRLVARLRAEAPGVDVRVLHLVERATGP-LSEGRLDLAFGLVLVGPAAANGIRAQRIFDEKFVCVVRNGHPVVKRKLTLEDFVRLPHALVSLSGDPTGVVDEALAKIGKTRRVAVTVPHFLVAPHVVQDTDLVLTLAERVARMFSPMLGLAQFAPPLPIPGFAMSMVWHERMHSDSAHAWLRKVVKE.. 303
168 7.000e-82gi|763323332|ref|WP_044181781.1| LysR family transcriptional regulator [Enterobacter massiliensis]  clstr ali  29  91FDPASASQTWRIVATDYTESAVILPLLGRLRAAAPGTRLAVFELNPPQILRQAEQGEVDL---IFHLREGSPASLHQRLLFSERYVLAGRLNHPALKRRPTLAQFCKLEHVVVSPDGGGFAATDSALANLGLSRQVVLSVPHFLFMLEALRNSDLVAVLPERLVRAAA---GLTVVEPPVAVAGFDMLMLWHERLHRDPAHRWLRQQIA... 294
169 8.000e-82gi|493874208|ref|WP_006820649.1| transcriptional regulator [Yokenella regensburgei]  clstr ali  24  91FDPMTAELTYTIVATDYALKAVVVPLMAALKQRAPHIKIAVRPVDNERMYQQLSRGEVDLAL---VTPQTTPDDLHGRSLYEEAYVCVARSHHPLAASEMTLEQFCKQEHILVSTEGHFTGVTDEALAQLNLTRRVGMSVNSFQVIPDILRLTDMIAVVPHRMVLT---NNDLIILPLPLKVPGFTKSMAWHERTHRDPGHQWIRALCVEVS 297
170 8.000e-82gi|719256764|ref|WP_033536179.1| MULTISPECIES: LysR family transcriptional regulator [Burkholderiaceae]  clstr ali  28  97FDPAIADNTWRIAATDYSESTVLLPALSGLRAAAPHTRIAVLEMLPPRLAKQAENGEIDLA---FHITSPEMANFHQQALFTESYVLVGRKDHPRLKRRPTLAQFCALEHVIVSPDGGGFGPTDDTLATFGMKRHVALSVPHFLFVRSVLATTDLVSMQPARLAKRW---PELRIVAPPVDVPGYEMSMYWHERVHRDPAHRWLREFIAQ.. 301
171 8.000e-82gi|737564995|ref|WP_035537352.1| LysR family transcriptional regulator [Burkholderia sp. BT03]  clstr ali  30  86FEPLQSKRVFTIRTRDIGEVACFPRLIQRLRSTAPNVRIRSIWKPIDETLSGLASGQIDLAVGYLP---ALEAGIHGKSLFSQRYVTVLRKGHPLEKSVLTRDRFLTQEHLLVEYSGSGHVLLEKALIEAGAKDRIRLRLPQYLSAPHIVTSTDLIWVVPELLANELAKHFELVVKPLPLSVPEFDVAMYWHERYHRDPASRWLREQFDEL. 293
172 1.000e-81gi|489144561|ref|WP_003054320.1| LysR family transcriptional regulator [Comamonas testosteroni]  clstr ali  30  85FDPASSSRAFRLAMTDISHLEFLPALMNKLGNIAPKVRVEVLRIT-ADTARLLEAGDADLAIGYMPE---LDAGFYQQKLFRDGFACVVRRTHPRIDDNLTMTRFKTERHVIITAPGTGNEIVEQELKRQGAQRNVALSLPTLPGVGNLLAHTDLIATVPHRIAQTLVKIAQVKAIASPYRLPEFAIKQHWHERYQQDPANRWLRSTLAEL. 291
173 1.000e-81gi|654774262|ref|WP_028228745.1| LysR family transcriptional regulator [Paraburkholderia ferrariae]  clstr ali  29  88FDPATSTHTFSIALSDVGEIVFLPRLLQLFAERAPHANLRSVSLPPGQVERGLESGDIDLAVGYFPDLGG--NNFFQQRLFTHRFICMMRSGHPLAGKPITLEQFLATGHAVVRAEGRSQEVLEQFLEKKRLRRRAVLETPHFMSLPFILTRTDLIATVPHAIGAYVAEQASITLVEPPLALPHFDLRQHWHRKYHNGPRAAWLRGVVAEL. 297
174 1.000e-81gi|516370492|ref|WP_017760525.1| LysR family transcriptional regulator [Pseudacidovorax intermedius]  clstr ali  28  88FDPATAKRRFRICLTDISEVVLLPRLLDHLGREAPGVQVET-EIVSAASARRLEDGEVDLAVGFMP---LLEAGFYGQTLFRQNFVCLVAKDHPRIGARLTRKGFAAESHALIASSGTGHAIVDKTIARAGIERKVAVRLSSFLGVARIVAQTELVVIVPRVLGQILATQEPVRIIEPPFALPAYAVKQHWHARFHADDGNAWLRRTMAQL. 294
175 1.000e-81gi|516630723|ref|WP_018005510.1| LysR family transcriptional regulator [Cupriavidus taiwanensis]  clstr ali  29  95FDPATSTHTWRVAATDYGESTIVLPALQGLRKSAPGARLAVVEMVPARIARQAERAELDLA---FHTTDGSPPALHRRALFTERYVLVGRAGHPRLKRRPTLAQFCALEHVIVSPDGGGHGVTDEALARAGMQRRVVLSVPHFLFVTAALAATDLVAMLPERLVR---GAPALRAVAPPVEVPGYEMSMLWPERVHRDPAHRWLREHIA... 298
176 1.000e-81gi|652940544|ref|WP_027194029.1| LysR family transcriptional regulator [Paraburkholderia sprentiae]  clstr ali  30  96FDPAAATQTWRIAATDYAESTIILPMLAGLRAVAPGTRLAIVEAAPPRLARQAELGDID--IG-FHTSEGAPEGLRRRVLFAERYVLVGRAGHPKLKRRPSLAQFCKLEHVIVSPDGGGFGVTDETLAKVGLARKVVLSVPHFLFMQSVLASTDLVGMLPARLVR---GSHALRMVEPPVEVPGYEMAMLWHERVHRDPGHQWLREFIAA.. 300
177 1.000e-81gi|654386181|ref|WP_027864892.1| LysR family transcriptional regulator [Massilia alkalitolerans]  clstr ali  27  87FDPAASTREFRICMTDISEVVLLPRLLNHLREVGPGIRLQIAKISPDSPAE-LADGSVDLAVGFMP---HLEAGFYQQVLFDQHFVCLAAAAHPRVKEALSREALREEAHVRVLTSGTGHAIVDKVLAEEGIERRIALKLPSFLGVARIVAQTELLAIVPYRYAAEVAGSEAVRALPVPVELPRFQVKQHWHERYHADVSNRWLRQTIASL. 293
178 1.000e-81gi|521292136|ref|WP_020456404.1| LysR family transcriptional regulator [Enterobacter sp. R4-368]  clstr ali  27  91FDPARASVTWRIAATDYTESAVLLPLLGTLRRDAPASRLAVFELNPGQIKRQAEQGDIDL---FFHLREGAPASLHQRLLFTERYVLAGRLGHPALKRRPSLKQFCQLEHVIVSPDGGGFAATDDALAARGLTRNVVLSVPHFLFMLDALARTDLVAVLPERLVATTGA---LQVVDPPLDLPGFDMLMLWHERLHRDPGHKWLRQQVLAV. 296
179 1.000e-81gi|947998031|ref|WP_056657497.1| LysR family transcriptional regulator [Rhizobacter sp. Root1221]  clstr ali  30  91FDPAKSTHTWCVAATDYTESTILLPALAGLRAAAPGSRLAVVEAVPPRLARQAERGEIDLA---FRTSEGAPPELHCRALFTEEYALVGRAGHPRLKRRPTVAQFCDLEHVIVSPDGGGFGVTDEALAKVGLTRRVVLSVPHFLFVMSALASTDLVAMLPLRLVRNT---PVLKVVAPPVAVPGYEMAMLWHERVHRDPAHQWLREHIA... 294
180 1.000e-81gi|505090405|ref|WP_015277507.1| transcriptional regulator [Pseudomonas stutzeri]  clstr ali  31  96FDPGAAQDVWRIAASDYGESAIVLPALAGLRCAAPGTRIAVVEMQPSRIARQAEQGDIDLAL---HTVDGSPSNLRRRVLFTERYVLAGRAGHPRLRRRPTLKQFCALDQVIVSPDGGGHGATDDALAAHGLQRRVVLSVPHFLFLRSVLESTDLVAMLPERLVQGAA----LQVVEAPLEIPGYEMAMLWHERAHRDPAHQWLREQIV... 298
181 1.000e-81gi|516562533|ref|WP_017938206.1| LysR family transcriptional regulator [Pseudomonas thermotolerans]  clstr ali  33  90FNPAQASKTFRISMTDLSEEILLPPLFQRLRRQAPGVRIESFLAKRRETTSELAAGRLDFAV---DAPLNTDPQVRHVKLLDDRYVCVMRKGHPLAKDKLSLDEYLSLTHIHISSRRSGLGYVDLALGKMGIQRKIALRSQHYLMATMVLRETDMAMTVPERLARR----HDLHFVELPVDVPPLETHLYWHESTDQDPANRWMREQLIELS 295
182 1.000e-81gi|737971938|ref|WP_035934776.1| LysR family transcriptional regulator [Paraburkholderia glathei]  clstr ali  29  91FDPSKASHTWRVAAADYGESTVLLPALAGLRSAAPGARLAVLQLAPSRIVRQAEQGEIDLA---FHTSEESPSALHRRTLFTERYVLAGRAGHPRLKRRPTLAQFAALDHVIVSPEGGGFGITDEALAGAGLARRVVLSVPHFRFVMSVLETTDLVAMLPSRLVRDCAA---LRVVEAPVDVPGFEMAMLWHERSHRDPAHRWLREHIAA.. 295
183 2.000e-81gi|754972383|ref|WP_042328239.1| LysR family transcriptional regulator [Paraburkholderia ginsengisoli]  clstr ali  32  96FDPAMATHTWRVAASDYAESTIILPALAGLRATAPGTRLALVEAAPPRIARQAERGEIDLA---FHTSEGSPEGLRRRVLFAERYVLAGRTNHPRLRRRPTLAQFCKLEHVIVSPVGGGFGVTDEVLAQRGLTRKVALSVPHFLFMLSVLASTDLVGMLPERLVRGVGA---VRMVEPPVEVPGYEMAMLWHERSHRDPAHQWLREQIA... 299
184 2.000e-81gi|654765126|ref|WP_028219915.1| hypothetical protein [Paraburkholderia oxyphila]  clstr ali  27  90FDPLSTTRTFTVYMNEIAEVVCLPKILQRLQTVAPGIGIKVSRIPEKGAHEAMASGEVDLAFGVF---SNLKAGFFQQRLYTDRFVCIARGDHPSIGAALSLQEYLDGVHVTVASTGTGHDTIEQVLAAQHLERKVALTVPHFLVLPVVVAQTNAIATVPYRMVSPPVSFHNIRVLETPVPFPQIEIRQHWHERYHHDAANKWLRQLMVQL. 299
185 2.000e-81gi|1011000010|ref|WP_061958125.1| LysR family transcriptional regulator [Cupriavidus pauculus]  clstr ali  29  91FEPASAANTWRIAATDYSESTVLLPALPGLRQAAPGTRVAVLEMAPARLARQAEQGDIDLA---FHTTHDSPQTLHRKALFTERYVLVGRAGHPKLRRKPTLAQFCALEHVMVSPDGGGFGVTDEALATAGASRRVVLSVPHFLYVAAVLAGSDLVAMLPERLVR---DNAALQVVEAPVDVPGYEMSMLWHERSHRDPAHRWLREFIAA.. 295
186 2.000e-81gi|571247792|emb|CDL43879.1| Transcriptional regulator [Klebsiella pneumoniae ISC21]  clstr ali  25  30FDPLEADFTWTIAATDYALKAVIVPFIAALKPMAPGIRVRIIPESPATLLAQTERGEVDIAL---LTPHDTPPELHSRALYQEEYVCLLREDHPQANQPLTLDRFCALEHVLVSWQGDSFGVTDDALAALGRTRRVGLSVSSFLVLPEVLAVSEMIAVVPRRLAKM---ASGMKIAAPPLAIPGFTKSMAWHERNHRDPAQQWLRELLLQTS 236
187 2.000e-81gi|737555982|ref|WP_035528667.1| LysR family transcriptional regulator [Paraburkholderia sacchari]  clstr ali  31  96FEPATAHHTWRVAATDYTESTLVLPALRALRMAAPHTRLAIVELVPPRIAKASEQGEIDLA---FHISSDAPEGLRQRVLFKERYVLAGRAGHPRLKRRPSLKQFCELEHVIVSPDGGGFGVTDEALANMGLTRHVVLSVPHFLFVMSALAQTDLVALLPWRLVR---DNAALKTVEMPIEVPGYEICMLWHERVHRDPAHQWLREQIAA.. 300
188 3.000e-81gi|503556258|ref|WP_013790334.1| LysR family transcriptional regulator [Pseudomonas fulva]  clstr ali  28  92FDPASAKRRFRLCMSDASHITLLPKILELLRRDAPGIRLEVARID-GNTERALETGEADLAIGFVP---WLGGGIYQQVLFPQDWVCLVSPNHPRIGDVMQLDEYVGESHVFVSA-GTGQKLLEAALARNAIERQIVLELPGFLGLGAVVSSTDLIATLPRHIGETLARPHGLKVHACPFPIENFLVKQHWHARYHQDPGNRWLRTTL.... 294
189 3.000e-81gi|771615398|ref|WP_045226284.1| LysR family transcriptional regulator [Methylococcaceae bacterium 73a]  clstr ali  32  90FDPARSQRRFVMAATDYMDFLLIPPLIERIAREAPGIDIHVKRTDLPFPEKELEAGELDIVVG-FEAILKPAAYLNGRKLFEDRMTCLLRQEHPSIQGTVSLEDYVGLKHMLISRTGTRTGVIDDWLAERGLERRIALIVPHFLSAPFIVANTDMLLSLPLRIAEQFVRLAPLRVVPVPIELPSYDLVMIWHPLRESDPAHRWLREQIWDV. 300
190 3.000e-81gi|742879540|ref|WP_039008065.1| LysR family transcriptional regulator [Xanthomonas translucens]  clstr ali  29  91FDPAQASNRWRVAATDYGESTILLPALAALRSAAPGTRLAVLEMAPLQIARQAEQGEIDLAL---HTRDGAPPHLRQRTLFAEDYVLVGRAEHPRLQRRPTLAQFCKLEHVIVSPDGGGFGVTDAALHARGLQRRVVLSVPHFLFVIDVLRRTDLVAMLPERVVR---AHSGLKVCAPPVPVAGYEMAMLWHERVHRDPAHRWLREQIAA.. 295
191 3.000e-81gi|780902892|gb|KJS70826.1| LysR family transcriptional regulator [Comamonadaceae bacterium BICA1-1]  clstr ali  33  92FEPASVERTFSIAMADISQLVLLPSLWERLRKVAPGVHINVVNLSAE-TARMLEAGEVDLALGFLPQ---LDAGFYQQSLFHQRYVCLASSEHPRVCGHLNLAQFEAEEHAVVLTSGTGHHYVEREIARQHINRRVAVRLPSFLGVAFVVERTDLLVTIPARLGEILAGRGRFTTYPVPFPLSEYTVKQHWHERYHHDLGNRWLRSVIREL. 298
192 3.000e-81gi|327480247|gb|AEA83557.1| transcriptional regulator [Pseudomonas stutzeri DSM 4166]  clstr ali  30  93FDPAAAQDVWRVAATDYGESAIVLPVLSRLRSMAPGTRLAVVEMVPARIARQAEQGDIDLA---FHTAEGSPPGLRRRTLFPERYVLAGRVGHPQLKRRPTLERFCTLEQVIVSPDGGGFGATDEALAQRGMQRRVVLSVPHFLFLRSVLESTDLVAMLPERLVR---GSSALQVVEAPLEVPGYEMAMLWHERSHRDPAHQWLREQIA... 296
193 3.000e-81gi|504564727|ref|WP_014751829.1| LysR family transcriptional regulator [Advenella kashmirensis]  clstr ali  29  85FDPASSYRTFRISMTDISHLEFMPAMMNKVARVAPNVQIEVLRI-KADTGKLLESGDADLAIGYMPE---LEAGFYQQKLFKDGFACVVRRDHPRIDARLTQSRFKSERHVVLIAPGTGNEIVERELKRQGTQRKVALSLPTLPGVGNLLANTDLMATLPGRVAKILVNIAHVKALAPPYRFPDFSIKQHWHERYHQDPGNRWLRSTVAEL. 291
194 4.000e-81gi|648261349|ref|WP_026042498.1| transcriptional regulator [Pantoea sp. A4]  clstr ali  25  91FDPATAELTYSIMATDYALQAVIVPLMSALKKRAPGIRVAVRAEDSTRLFALLERGEVDLAL---VTPSTTSDELHGRALYQEQYVCVMRHHHPLANAPLTLDQFCEQEHILVSFEGRFTGVTDEALARLGRTRHVGMSVNSFLVLPEILRGTDMIAVVPQRLVR---QQDNLTVVAMPLEVPGFTKSMAWHERTHRNLAHQWIRALCVEVS 298
195 4.000e-81gi|917770995|ref|WP_052284999.1| transcriptional regulator [Kluyvera cryocrescens]  clstr ali  27  91FDPLSAELTFTLAATDYALKAVVVPFIAALKVQAPGIRVRVVPVEPERLHSQFEQGKIDLAL---LTPNTTPGDLHSRTLYEERYVCMLRADHPDAQRPLTLDRFCSLEHILVSYEGESFGVTDDALAKVGRNRRIGLSVSSFLVLPEVLAVSEMIAVVPSRMARSPAL---ICVQEPPVEIQGFTKSMAWHDRSHRDAAQQWLRELL.... 293
196 5.000e-81gi|632870568|gb|KDB08145.1| transcriptional regulator, LysR family [Burkholderia sp. lig30]  clstr ali  28  159FDAATSTRQFTFAMTDIGEFNFLPPLTQKLATVAPGVTVSTVRSTAVNLRFEMEEGKVDLALGHIP---GLATDFHRRTLFSQRYVCLFRKGHAMDREHPLLDDFTSADHAVVISAGTGHGRADELIERAGIHRRIRLRVPHFVALADILESSDLIATVPETFARRSVKHFNLRYIPHPVELPAIDISLFWHSKFHRDPSNLWLRELVAQ.. 365
197 6.000e-81gi|503578871|ref|WP_013812947.1| MULTISPECIES: LysR family transcriptional regulator [Serratia]  clstr ali  29  91FDPASAGNTWRVAASDYGESTIILPALIGLRSVAPGTRLAVFEAVPARLARQAEQGEIDLA---FHTHEGAPENLRRRTLFSERYVLAGRAGHPQLAVTPTLEQFCRLEHVVVSPDGGGFGNTDSVLSEAGLQRRVVLSVPHFLFIMSVLASSDLVAMLPWRLVRN---NRALQVVEAPIEVPGFEMAMLWHERSHRDPAHQWLREHIIA.. 295
198 6.000e-81gi|1019429577|emb|SAK45791.1| LysR family transcriptional regulator [Burkholderia sp. LMG 29326]  clstr ali  30  92FDPSVAANIWRIAATDYSESTVLLPALGALRAVAPNTRLAVVEANPPRLAKEAELGDIDLA---FHITSDAPAGLHRRALFTESYVLAGRKDHPRLKRRPTLSQFCALDQVIVSPDGGGHGPTDEALAALGLSRRVVLSVPHFLFVRSLIETTDLVAMLPSRLVQ---DSAALRIVAPPVDVPGYEMSMYWHERVHRDPAHRWLREFI.... 294
199 6.000e-81gi|946914029|ref|WP_055836662.1| LysR family transcriptional regulator [Xylophilus sp. Leaf220]  clstr ali  28  88FVPESAARTFRICMTDISEIVLLPVLLNHLRTAAPRVRIEVEKIGT-DSARRLEEGEVDLAVGFMPQ---LDAGFYQQVLFAQNFVCLAAADHPRIGRRLTRAAYGRESHLVVTASGTGHAIVDKVLAKAGVERDIVLRVPSFLGVARIVAETELLATVPLRYGQVMQTRERIRMLALPHPLPRYEVKQHWHERFHADPGNAWLRRTVAE.. 293
200 7.000e-81gi|496340246|ref|WP_009049424.1| LysR family transcriptional regulator [Pseudomonas chlororaphis]  clstr ali  31  91FDPGAAANTWSVSASDYGESTVILPALAGLRAAAPGTRLAVLELEPGRLVRQAEQGRIDLAL---HTSEDSPPGLRRRVLFSERYVLVGRAGHPRLQRRPSLAQFGKLEHVVVSPDGGGHGVTDSALGEVGLTRRVVLSVPHFLFVLSALASTDLVAMLPSRLVR---DNPALKVVEPPLEVPGYEMTMLWHERCHRDPAHQWLREFIVA.. 295
201 7.000e-81gi|504712692|ref|WP_014899794.1| LysR family transcriptional regulator [Burkholderia cepacia]  clstr ali  30  96FDPATAQRRFRICMTDASHITLLPRLLAHVRAQAPGVRLEAARID-GNTERALESGEADLAIGYVP---WLGGGIYQQKLYDQDWVCLANRHHPRIRGRLGAKQYRSEGHVAIT-GGTGAQLLEQALRQARIERDVVLELPGFLGLGAIVQTTDLITTLPRHIGQTLAQASDLAVHACPIPVDGFAVRQHWHARYHHEAGNRWLRGVVIQL. 301
202 8.000e-81gi|490299089|ref|WP_004194519.1| LysR family transcriptional regulator [Burkholderia pseudomallei]  clstr ali  27  89FDPAKSARTFSIALSDVGEIVFLPRLLQAFAQHAPHANLRSASLSHAEVAHALEDGGVDLAVGYFPDLGGT--NFFQQRLFTHRFICLLRRGHPLAERPLTLERFLACGHAVVRAEGRSQEVLEQYLTKRRLTRRAVLETPHFMSLPFILSRTDLIATVPHAIGAYAAEHASITLVEPPLPLPRFDLKQHWHRKFHNDPSITWLRGVVAQL. 298
203 8.000e-81gi|503834289|ref|WP_014068283.1| transcriptional regulator [Enterobacter asburiae]  clstr ali  26  91FDPLIARQTFTLAATDYALRAVIVPFIAALKVQAPYIRVRVVPVEPDRLVTQLEQGKIDLAL---LTPHTTPDELHSRALYDERYVCMMRADHPDAGKPLSLERFCTLEHVLVSYEGSFHGVTDDALAKAGRERRVGLSVSSFLVLPEVLAISDMIAVVPQRMAEN---RADMFVCDTPVPVQGFTKSMAWHARTHRNPAQVWLRELLLETS 297
204 9.000e-81gi|503106847|ref|WP_013341605.1| LysR family transcriptional regulator [Burkholderia sp. CCGE1003]  clstr ali  31  97FDPAEATQTWRIAATDYAESTIILPVLPRLRAAAPATRLAVVEAAPPRLAKQAERGEIDL---GFHTSEGAPAGLRRRVLFAERYVLACRADHPRLKRRPTLAQFSKFEHVIVSPDGGGFGVTDEVLAKAGLTRRVVLSVPHFLFMISALASTDLVAMVPARLVRN---HPALRVVEPPVEVPGYEMAMLWHERSHRDPAHQWLRAQIAD.. 301
205 9.000e-81gi|781565032|dbj|GAO20731.1| LysR family transcriptional regulator [Alicycliphilus sp. B1]  clstr ali  28  92FDAGTSTRCFTLAMTDIGECHFLPPLARLLRERAPGVSLATVRNTAINLRFAMEQGKVDLALGHLPD---LSNDFHQRVLFMQRYVCLFRKGHPLDVPEIALQQYAQAEHAIVLSVGTGHGRVDEVIERAGVQRRILLRVPHFVALADVLEDSDLVATVPEVFARRSVRRFHLSYRPHPVALPPIEIGLFWHTTYHRDPASVWLRELIAD.. 298
206 1.000e-80gi|503140076|ref|WP_013374737.1| LysR family transcriptional regulator [Stigmatella aurantiaca]  clstr ali  29  101FEPRATAHRFTLATSDYFASIFLPPLLALLGQEAPRVDLDLRPIDSRWTPELLESGAVDLIIQAFPNPA---PALRQQKLFQEEFACLVRKDHPEVNRRLELAQYLRLPHVLISPQGQGEGIVDQALAKQGLSRRIALRVPFFLAAPLVITRSDLVLTAPRRMAEGFAQGWPLQVLKPPLALPTFNAVQLWHERFEDDPAHRWLRGAL.... 305
207 1.000e-80gi|491007363|ref|WP_004869080.1| transcriptional regulator [Raoultella ornithinolytica]  clstr ali  27  91FDPLQADFTWTMAATDYALKAAIVPFIAALKTRAPGIRVRVIPDSPQMLFAQTERGDVDIAL---LTPHSTPPDLHSRTLYQEEYVCLMRADHPLAAAPLTLDLFCSLEHVLVSWQGDSFGVTDEALAALGRSRRVGLSVSSFLVLPEILAISDMIAVVPRRLAKM---ADGMRIAPPPLTIPGFSKSMAWHERSHRDPAQQWLRELLF... 294
208 1.000e-80gi|827456339|ref|WP_047216397.1| LysR family transcriptional regulator [Pandoraea thiooxydans]  clstr ali  29  93FDPGTAERTFRLAMSDMSEFFFLPPLLARLEREAPGVKLEVVQVPVDKLADALRSREIDLAIGYLP---GLERDCSTQHLFSDSHVCLVRARHPQAGRKLTLAALLTMKHVFVPSNATGHRMVEQWLTESGVHRHIVLRLPHFTVAPEIVRGTDLAVLLPRSIAERFNRGRAYRLLEIPVALPSIDVNVYWHARFDADQAVRWLRDMLLGM. 300
209 1.000e-80gi|502031994|ref|WP_012700685.1| LysR family transcriptional regulator [Azotobacter vinelandii]  clstr ali  28  92FDPARAGQTWRIAASDYGESTILSPALAGLRSAAPGTRLAILELLPPMLARQAEQADIDLA---FHISAEAPPSLQRRPLFTERYVLAGRVGHPRLKRRPTLAQFCKLDHVIVSPDGGGHGVTDTALAELGMTRRVALSVPHFLFLASVLTSTDLVAMVPSRLVR---DNDALQVVEPPLEVPGFEMLMLWHERVHRDPAHQWLREHIV... 295
210 1.000e-80gi|947609159|ref|WP_056272325.1| LysR family transcriptional regulator [Hydrogenophaga sp. Root209]  clstr ali  28  86FDPSQASRVFTVRTRDIGEVVCFPGILAELGRSAPGIKLKTTFKPIDETLAGMASGHIDLALGFLPSLETA---IHRRKLFSQHYVCAMRVDHPLSKAPLDLDAFLAQEHLLVEYSGSGHQVIEKALVEAGAKNRIRVRMQQYLSAPHFIITSDMLWSVPAVLAETLARHFPLVIKPHPLPLPSFEVALYWHDRYHQDPANRWLRELLVA.. 292
211 1.000e-80gi|738055722|ref|WP_036014609.1| LysR family transcriptional regulator [Budvicia aquatica]  clstr ali  27  96FDPASATNTWRISAFDYGESTILLPALAGLRSAAPGTRLAIFEVTPSLLTKKAEQGEIDLA---FHIHECVVPGLRHRILFSEKYVLVGRVGHPKLKAPLSVEQFCQLEQVIVSPDGGGHGVTDRELSKIGLSRCVVLSVPHFLFVKSVLATTDLVAMLPSRLVR---GEPELQAIEPPIEIPGYEMAMFWHERCHRDPAHQWLREFIA... 299
212 2.000e-80gi|124899755|gb|EAY71598.1| Transcriptional regulator [Burkholderia dolosa AU0158]  clstr ali  31  96FDPATATNTWRVAATDYGESTIVLPALGTLRSAAPGTRLAVVELVPPRIEHDAERNGIDLA---FHTTEGSPPGMRRLPLFTERYVLVGRADHPKLRRRPTLAQFGTLEHVIVSPDGGGFGVTDEVLAKAGATRRVVLSVPHFLFVLSAVASTDLVAMLPERLVR---DTRALRVVEAPVDVPGYEMSMLWHERVHRDPAHRWLRETIAA.. 300
213 2.000e-80gi|495923450|ref|WP_008648029.1| MULTISPECIES: LysR family transcriptional regulator [Cupriavidus]  clstr ali  27  91FDPAEATQTWRIAATDYSETTVLLPALAGLREAAPGTRMAVVELAPPRIARQAEQGDVDL---VFHITTDAPESLHLRPLFTERFVLAGRREHPRLKRKPTIAQFCALEHVIVSPEGGGFGATDEALVEVGLSRRVVLSVPHFLYLESVLANTDLVAMLPARLVR---DNDRLQIVDAPVEVPGFEMSMLWHERVHRDPAHQWLRESIAA.. 295
214 2.000e-80gi|518258441|ref|WP_019428649.1| hypothetical protein [Limnohabitans sp. Rim47]  clstr ali  25  90FDPASSTRSFTIAMTDVGEMYFLPVLIDALARSAAGVTLQVVSVTQPTLKEDMATGRIDLAVGLLPQ---LQAGFYQQALFKQKYICLMREAHPLAGQRLNLVSFTEAEHVRIVAAGTGHGRVDVALEQQKLRRRFRLTVPHYVALGDVLSHSNLIATVPERFADRTLVPFGLVKRELPMAVDESAIHQFWHGRLHRDPGHQWLRQLIDQL. 298
215 2.000e-80gi|499934557|ref|WP_011615291.1| LysR family transcriptional regulator [Cupriavidus necator]  clstr ali  27  34FDPAQARRTFTLALSDVGEAAFLPRLLARLMKEAPHVDVRTVSARHTDIMDQLERGRIDLAIGYYPDLGG--SDVFQQRLFRHGFVCLARKNHPVARGRMTAQQFREPPHAMIQNESRSQELVEAYLRQHGIARREMLRSPHFLSIPLVIASSDLVVTVPLPVGELFARIADVQVLEPPFPIPAFDLRQHWHRCQHDDPGNRWLRAITQEL. 242
216 2.000e-80gi|550929106|ref|WP_022677568.1| MULTISPECIES: LysR family transcriptional regulator [Novosphingobium]  clstr ali  25  90FEPASCQRRFVISTSDIGELIFLPRLMAALSRLAPQATLQSRSMTPIELETAMAEGKVDLALGYFPDLNG--SNFMTQKLFDHDFACIAAADHPHARPGWTLDTFLRLGHIVVAQSGRSQELVEQEMRRKGLERRVQLQSPHFMSVPLLVAESELISTVPAAVAGIFATMARLRVVAPPLALPRINIQQFWHRRVHDEPSNRWLRGLICEL. 298
217 2.000e-80gi|737052758|ref|WP_035047910.1| LysR family transcriptional regulator [Caulobacter henricii]  clstr ali  30  90FDPEVSRRPFTVCLSDIGEMVFLPKLMEQLRVRAPYMAVTSVSLRPRELGEALEAGQVDLALGYFPD---LKTGIHQQGLFDHAFVCLARRGHPRIGDRLDLETFLALDHLVVSAEGRSQEIFEQVMVDRGVSRQVVLRTPHFMSAPLVVAKSDVIATVPRAVGAAWAVSAGLQLLEPPLAIPTIPLKQFWHRRFNDDGRLRWLRGLAAEL. 297
218 2.000e-80gi|158187214|gb|ABW22834.1| LysR-like regulatory protein [Burkholderia sp. NCIMB 10467]  clstr ali  32  88FDPSEAQRIFRIAMTDISQIVLLPTLLNKLRIVAPRAQLRISHITTE-TPRMLESGEVELAVGFMPQ---LDAGFYQQKLFPQRFVVLAASRHVALGDSMSLEYYLSAGHVTVTPSGTGHSIIDRTLREQQLHRHVVLDVPNYLAIADIVAQTDLLATVPQKLADLMSSSVDARRYPVPFEIPQYDVKQHWHARTHQDAGHRWLRALLAEL. 294
219 2.000e-80gi|947519623|ref|WP_056183627.1| LysR family transcriptional regulator [Pseudorhodoferax sp. Leaf267]  clstr ali  31  88FDPPRTQRRFRICLTDISEVVLLPRLLEHLGQAAPQVGIET-EIVSAGSARRLEDGEVDLAVGFMPQ---LEAGFYGQTLFRQNFVCLAARDHPRIAGKLSKKAFAAEAHAVVSSSGTGHAIVDKTLLRQGIERRVVLQLSSFLGVARIVAQTELLAVVPRILGEVLATQEPVQLIEPPFALPDYAVKQHWHARFHADDGNAWLRRTLAEL. 294
220 2.000e-80gi|738009466|ref|WP_035970926.1| LysR family transcriptional regulator [Paraburkholderia grimmiae]  clstr ali  27  91FDPYTAALTWKIAATDYSETTVLLPTLPRVRQYAPNTRVSVAQIAPRLIARQCEIGEVDLA---FHTADEAPDGLRRKTLFQEKYVLVGRPDHPRLKRKLTMSQFCKLDHVIVSPDGGGFGVTDMTLAQLGLKRRVVLSVPHFTFVQDVLSRTDLVAMLPSRL---LKGDSRLRSVAPPVEVPGYEMVMLWHERSHRDPSHQWLRELI.... 293
221 3.000e-80gi|971489495|ref|WP_058897656.1| LysR family transcriptional regulator [Herbaspirillum rubrisubalbicans]  clstr ali  24  88FNPGTTERRFTLALSDIGEMTFLPKLLDHLRQAAPRASLLSVTMPPPELAAALESGEVDLAVGFFPDLKN--RNFFQQRLFSHDFICLLSASHPHRSRRISIDKFLSMGHAVIKAEGRSQEVFEQFLLRRKIERRIVISTPHFMSIPFLIASSDLIATVPRAVGESFAQFADIKLVEPPFEIPSFDLKQHWHRKYHKDGGNVWLRSVLARM. 296
222 3.000e-80gi|730243913|ref|WP_033947623.1| transcriptional regulator [Pseudomonas aeruginosa]  clstr ali  30  90FDPSAARLTFTIAATDYALRAIAVPFLSTLKRQAPHVRVALVPIEERQVHTQLERGDIDLAL---MTPESTPPDLHARNLFEERYVCVLREDHPAVQGRLTVNQLCALDHVLVSYTGGGFGVTDDSLEKLGKQRQVTLSVKCFLILPDILRASDMVAILPSRLV---AGMSGLAVFTPPIDVPGFTKVAAWHERTHRDPAQRWLRELLFE.. 296
223 3.000e-80gi|515869665|ref|WP_017300274.1| hypothetical protein [Nodosilinea nodulosa]  clstr ali  34  96FDPATSDRVFAIGMSDYVEFTLLPRLMQRLQSVAPGVSLQIRSGDRQALFALLDEGAIDIACGLFPEAVPWHQE---QPLFQETYLCAARPGHPSLGDALSLDNYLALPHLLVSVKEDRVGRVDNLLAKQGLKRQVALSVPHFLAAPFVLAQTDLIATLARRVALGFAQTQPLKLLPLPFELEGFSIAMRWHRSSQSSPPAQWLRSLIGEV. 303
224 3.000e-80gi|505190796|ref|WP_015377898.1| LysR family transcriptional regulator [Serratia marcescens]  clstr ali  27  91FDPAVATDTWRVAAFDYGESTIVLPALNGLRSAAPGTRLAVLETAPARIAKLAEQGEIDLA---FHTREGAPPGLRQRTLFSERYVLVGRVGHPKLHENLTLAQFCELEQVMVSPDGGGFGITDQVLADVGLTRRVVLSVPHFLFVISVLTQSDLVAMLPERLARN---HPLLQQLKPPLAVPGFEMTMLWHERSHRDPAHQWLREHIV... 294
225 3.000e-80gi|918244485|ref|WP_052375487.1| hypothetical protein [Chondromyces apiculatus]  clstr ali  33  113FEPERAERTFTLVASDYASMILLPPLVRHLAQSAPGIAISV-RAGLQNWAVPLEEGRVDLVIGIFD--SELPSAYRQQIL-QERFVCVVRADHPEVGDELTLEQFVRLPHALISPRGSIGGYVDDELARLNLRRRVVITVPHFLVAPHVVAGTDVILTVAERIALQLADKLGLRIVKPPLDIPGFQLNQYWHERQHHDPGHTWLREQIAQV. 320
226 4.000e-80gi|653022521|ref|WP_027274419.1| LysR family transcriptional regulator [Leminorella grimontii]  clstr ali  28  91FNPMNSSHEWRVMASDYSEMTILLPVLGALRRKAPGTRLAVFENVPEKISRLVEQGDIDLA---FHTRNDAPPGLRSRKLFTERYVLACRAAHPLLTAAPSVEQFCSLEHVIVSPDGGGFGETDRALAAIGTSRRVVLSVPHFMFLVPILMKTDLVAMLPSRLA---ADIPNLVTYEPPVEVPPMEMLMLWHERLHRDPAHQWLREFIAGV. 296
227 4.000e-80JCVI_PEP_1096665706391 /source_dna_id=JCVI_ORF_1096665706390 /offset=0 /translation_table=11 /length=261 /full_length=261  ali  28  46FEPATVQRTFNIIMTDIAEAVILPRVLDMCRGSAPGVSIRALNLSIDDTPDALKSGEADIAIGFLPEFSG---QFYQRFLFDTDYACIAAADNPIAKGRFTLKKYLSARHVIPELQGTGHSVVQQTLERQGIELKVGARVPHFLSIPFVVAASDLIATIPKAFGTTLGAGPSVKVLPHPLDLPKVEIKLLWHERFHAEPANRWLREQLVAV. 253
228 4.000e-80gi|495916531|ref|WP_008641110.1| MULTISPECIES: LysR family transcriptional regulator [Cupriavidus]  clstr ali  25  90FDPLTSTRAFTVAMTDIGEIYLLPGLMEQLGKLAPGVRISTVCIHGDSLKGAMESGCIDLAIGFLP---GLTAGFFQRRLLLQQYVCIFRKGHPLGRRDLTLAAFATADRVSISAEGTGHTRVDAAIQQAGVTRRSRLSVPHFAALGHILQSTDLIAVVPQAYAERALALFNLVSAPCPVKISEISVNVFWHATRHREVGNQWLRNVISD.. 296
229 4.000e-80gi|493624205|ref|WP_006576387.1| LysR family transcriptional regulator [Cupriavidus sp. HPC(L)]  clstr ali  30  85FDPPRSERTFRISMTDISHLQFLPGLMNRLNTLAPAIRVEVMRISTETPKE-LETGASDLAVGFMPE---LEAGFYQQRLFNQGFACVVRQDHPRVERRMTATLFKREKHVAITAAGTGHELLERELARRRVTRNVALSLPTLPGLGNLLANTDLVATVPERVAQMLMGIANVKALAPPFPLPTFSIKQHWHERYHQDPANRWLRSVIADL. 291
230 5.000e-80gi|544758738|ref|WP_021185590.1| LysR family transcriptional regulator [Pantoea sp. AS-PWVM4]  clstr ali  29  91FDPATAEMTLNVAATDYALRAVVVPFMAALRQQAPGIRVAVLPVNNDLLPMQFERGAVDVAL---ITPETTPPELHAKTLYAEDYVCLLRADHPLAQGVLSLDEFCSQDHALVSYVGGSFGVTDEALAALGRTRRVTLSVCSFLVLPEILRVSDLISVVPRRLALNTA---GLKIVAPPLDIPGFTKSVAWHERTHRDPGHRWLRELLFS.. 296
231 5.000e-80gi|310760860|gb|ADP16309.1| bacterial regulatory helix-turn-helix protein, LysR family protein 86 [Achromobacter xylosoxidans A8]  clstr ali  25  121FDPASAMRVFTLCMTDMGELVFLPPLIKRLRELAPHCTLRTRQVPLQQVEPLLASGEVDLVLGSL---RAAPQGLFQQQLFMHRFVTLVSVKNKEVGDELTLEQFQRMPQIVVTLAGRSSEAYDSALEEQGVKRNIFLSTPHFLVVPLLLQHPDLIATVPQELGNVFGGYGVVKVLEPPLPLPSFALRQHWHPRFHQDPAIIWLRELVKD.. 328
232 6.000e-80gi|388538679|gb|AFK63867.1| LysR protein [Advenella kashmirensis WT001]  clstr ali  27  127FDPATASHHFTIASTDYALRAIALPFLATLKRLAPNIKVALVLVNDTQMLSQLERGVIDLAL---VSPEYTCPDLHARKLFDEHYVCVVRQDHPIIRRQLTLERFCELDHALVSYTGAGFGATDEALEKMGKTRRVTVSVKSFLIVPDLLRASDMVSILPSRLVTDLA---GLAVFEPPIAIAGFTKMAAWHERTHRDPAQRWLRQLLFDI. 334
233 6.000e-80gi|515270815|ref|WP_016832662.1| hypothetical protein [Herbaspirillum lusitanum]  clstr ali  28  88FEPEKSERTFRICVTDVSQNVVVPGLMNALKVSGPHLRLSLINAS-DQTSTLMKTGEVDMAIGFIP---VLDSDFRQERLFDEDFVCIASASHPRIGKSLTLAHFTNENHLIVTTSGTGHWIVSKTLDAKRITRKIALEVENFLGIGSIISQTDLIATVPRRFGESLAQTHPLKTYPSPVVLPPYSVKQYWHERFDNDLSNRWLRNAIAHL. 294
234 6.000e-80gi|516095181|ref|WP_017525761.1| hypothetical protein [Pusillimonas noertemannii]  clstr ali  27  90FDAAVATRTFTINTPDIGEMVFLPKLLKRLSTVAPSIRLRATTVPHEQLETALETGKVDLAVGYFPDLT--KAEIFQQRLFSHSFVCVVREDHPKVGNRLSMKQFLDLAHMVVYVSGRSHEIFEYLLHQRGIRRKIALETRHFMSLPMIIEESDLVATVPRAVGVAYSRFANLKLLELPMAVPQYDLKQYWHRRFHRDGASVWFRNLITDL. 299
235 6.000e-80gi|120593425|gb|ABM36864.1| transcriptional regulator, LysR family [Polaromonas naphthalenivorans CJ2]  clstr ali  31  125FDPATAQRGFRIFMTDASHITLLPRLFSHVRALAPQVRLEAATIDAR-MAPALQSGEGDLALGLVP---GLEAGFYQQTLFGQDWICLCNARHPRIGEMFTLQDYAAEAHIGIVS-GTGYQLLDGALKSQGIARRVLLELPGFLGLAAILSTSDLVATLPRHIGETLANAAGLRVLPCPFEIPGFTVKQYWHARYHHDAGNRWLRGVCAEL. 330
236 7.000e-80gi|734940761|ref|WP_034148767.1| transcriptional regulator [Pseudomonas fluorescens]  clstr ali  28  91FDPLTASMTIRIASTDYALRAVVVPFLSALRKKAPNIRVSVQPVDHQELQSQLDRGEIDLAL---VTPEAITPGLHSIALFDESYVCVMRADHPALDNTLSLDRFCALDHALVSPSGGGHGVTDEALEKLGRLRRVTVSVSSFLVLPEILLYSDLIAVVPRRLA---IHNVGLTTLEPPVEIPGFRKTLIWHERTHRDAAHRWVRSLMVE.. 296
237 8.000e-80gi|737541274|ref|WP_035514548.1| LysR family transcriptional regulator [Paraburkholderia nodosa]  clstr ali  28  92FDPASARDTWCVAASDYGESTIALPALRGLREAAPHTRLAVVELAPARVAKQAAQGEIDLA---FHTTSDAPENLRRRALFTERYVLAGRADHPRLKRRPSVKQFCALEHVIVSPDGGGFGITDETLSQTGLTRRVVLSVPHFLFVVSVLERSDLVAMLPWRLVR---ESAALRVVEPPVEVPGYEMCMLWHERPHRDPAHRWLREQIA... 295
238 8.000e-80gi|518683179|ref|WP_019844872.1| hypothetical protein [Dickeya zeae]  clstr ali  28  91FNPATAENTWRISAFDYGESTILLPVMNQLRQDAPHTRLAILETPPSAMLQRMEQGDIDLAL---HTSDMAHPAMRRRVLFREHYVLAGRVGHPQLGGSLTLEQFSQLEHVIVSPDGGGHGTTDVALMERGLTRKVVLSVPHFLFMMSVLTTTDLVAMLPSRLLR---GQTGLQVATAPIELPGFEMAMYWHERWHRDQAHQWLRGLIAQ.. 295
239 8.000e-80gi|494278290|ref|WP_007160291.1| LysR family transcriptional regulator [Pseudomonas psychrotolerans]  clstr ali  29  92FEPATAQRLFRLCLSDASHITLLPRILAQLREVAPGVRLEIARID-GNTEQALEIGEADLAIGFIP---WLGGSLYQQLLFPQDWVCLVSARHPRLGEQLTATAYAEEGHVLVSA-GTGQKLLEAGLVRAGVQRRIVLELPGFLGVGAVVGTSDLIVTLPRHIGTTLAETYGLRVHECPVPIEGFAVRQHWHARYHQDAGNRWLRGVLLEL. 297
240 1.000e-79gi|972721765|emb|CUU25202.1| Nodulation protein D 1 [Erwinia gerundensis]  clstr ali  29  74FDPASATQTFTLAATDYALGTLAVPLLAALKQQAPQMRVSLIAVDHQRIQQQLERGEVDLAL---LTPEIAPPDLHARRLFDEHYVCVMREGHPQAAQPLTLDRFCQLDHALVSPGGNAHGVTDAMLAQLGRQRQVTLSVQSFMLLPAILRASDMVAVLPSRLV---ADLKGLIGCPPPLAIPGFTKIAVWHARSHHDSAQRWLRELLFTLS 281
241 1.000e-79gi|543577482|ref|WP_021025950.1| transcriptional regulator [Comamonas sp. B-9]  clstr ali  28  90FDPSSARLTFRIAATDYALRAIAVPFLAALKRQAPSIRVSLIPLEPRLVQGQLERGDIDLA---FLTGDNTPQDMHARELFQEHYVCVMREGHPAAGRKLSVKQFCALDHALVSYEGGGHGVVDEALEKLGQRREVTLSLKCFVVLPDILRSSDLVAVLPSRLV---AGMEGLSVCKPPVEVPGFSKLAVWHERSHHNPAQRWLRELLFS.. 294
242 1.000e-79gi|739540855|ref|WP_037399213.1| MULTISPECIES: LysR family transcriptional regulator [Serratia]  clstr ali  26  91FDPATANVIWRVAAADYAESTILLPALAELRRLAPGSRLAVFELAPTRIAKQAEQGEIDL---VFHTRDCSPPGMRQRILFKERYVLVGRKGHPQLNRPLTLAQFSQLEHVVVSPNGGGFGITDQALEQVGLSRRVVLSVPHFLFVMSALVTTDLVAMLPERLVR---DSTVLQIVETPVAVPGYEMAMLWDERSQRDPAHQWLREHIVQ.. 295
243 1.000e-79gi|740599040|ref|WP_038384584.1| LysR family transcriptional regulator [Bradyrhizobium elkanii]  clstr ali  25  90FDPATADITVSIAASDYVQYAVLMPLTLELARKAPKLRIAWRPIDGRLIGDQLARGEVDLAV---TTPDTAPEQLKSRKLYDERFVCIARRNHPLLRRSCDLDAFCSLPHVIVSPRGGGFGATDAALAKLGRSRRVVLSVSSFLMVPEVVAGSELIAVVPERVVRD--RSDRVKVFEPPLSIPGFNIANVWHERTDGQPAFRWLRQSIVE.. 295
244 1.000e-79gi|516095033|ref|WP_017525613.1| hypothetical protein [Pusillimonas noertemannii]  clstr ali  28  31FNPETAQREFQVTLSDIGETVFLPKLMAHISRLAPQCNLRSRALTVEELPEAMESGSTELAIGFFPDLERT--GFYMQRLFEHNFVCLVRKDHPRVKGRVSLPVFLDLPHAVVEPEGRSHELFEQLLKKKGLSRRVQLNIPHFMSVPAIIAATDMIVTVPHAVAEYFLRLEGLRMVKLPIKAESYSLKQHWHARLNADPALKWLRGQVAHI. 240
245 1.000e-79gi|546341130|gb|AGW93334.1| LysR family transcriptional regulator [Ralstonia pickettii DTP0602]  clstr ali  26  94FDPAQARRTFTLALSDVGEAAFLPRLLARLMLDAPNIDVRTISARHADLMDRLERGKVDLAIGYFPDLGG--SDVFQQRLFRHGFVCLARKQHPVARGRISARQFVELPHAVIQSESRSQELVEEYLRQHGVKRRELLHSPHFLSIPLVIASTDLIVTVPLPVGELFARIADIQVLEPPFPIPAFDLKQHWHRCQHDDPANRWLRAITLEL. 302
246 1.000e-79gi|558565727|ref|WP_023495870.1| HTH-type transcriptional activator NahR [Methyloglobulus morosus]  clstr ali  31  91FDAATSQRRFVLAATDYIEFLLMPELSGLIENIAPGIDLHVKRTETSFPVAPLENGSLDVVLG-FESVLNPPAHLHRQYLFSDKMACVVRENHPLISKPPSLEEFVAVPHMLISRTGSNVGIIDQKLAEQGLERRIKLIVPHFLSAPLIVAKTDMILSLPYRIADQFTKIAPLVIFPVPLELPDYDLCMIWHPLRDRDPAHQWLRDKII... 298
247 1.000e-79gi|745783432|ref|WP_039076864.1| LysR family transcriptional regulator [Enterobacter sp. Bisph2]  clstr ali  28  91FDPASADLTWRIVATDYTESAVVLPALNSLRAAAPGTRLALFELNPPQILRLAEQGDVDL---IFHTREGAPPALHQRLLFTERYVLAGRLNHPALKRRPTLAQFCRLEHVIVSPEGGGFSAIDEVLAKSGLSRRVVLSVPHFLFMLEALATSDLVAVLPERLVK---KAGALQVVEPPVPLPGFDMLMLWHERLHRDPAHQWLRQHLLD.. 295
248 1.000e-79gi|502968796|ref|WP_013203772.1| transcriptional regulator [Erwinia billingiae]  clstr ali  29  90FDPAQSEMQLTIASTDYALRAVVVPFLARLRTLAPGLQIAVRPVENRQLQQQLERGEIDLAI---VTPESTPPELHARRLFDEEYVCMLREGHPAAAKKLTLTRFCALDHALVSYEGEMFGVTDSALLALGLKRKVTLSVTSFLVLPEILRDSDLIAVVPKRLA---VNTHGLTLLAPPLAIPGFTKTVAWHERTHTSAGHRWIRQQLFD.. 294
249 1.000e-79gi|759635954|ref|WP_043353667.1| hypothetical protein [Cupriavidus basilensis]  clstr ali  29  89FDPLNARRDFVVTLSDIGEVVFLPKLMARLSRLAPHCNLRAKALSVRELPEAMQSGQVEMAIGFFPDLER--PGFYMQRLFEHRFVCLVRKDHPRVKERIPLAVFLELPHAVVEPEGRSHELFERLLKSKGLSRRVQLSIPHFMSVPAIVAATDMIVTVPQAVAEYFVRFGEVRIVQPPVNTRRYALKQYWHARFHADPGLKWLRGQIVE.. 297
250 1.000e-79gi|398204921|gb|EJM91716.1| transcriptional regulator [Pantoea sp. YR343]  clstr ali  27  102FDPATAEMTINIAATDYALRAVIVPFMAALRQQAPGIRVAVLPVNNEQLALQFERGSVDIAL---ITPDTAPPELHARALYAEEYVCLMRDDHPLAKQKLTLDDFCAQDHALVSYGGNFHGVTDAALNAIGRSRRVTLSVCSFLVLPEILRVSDLISVVPRRLALH---HAGLKVFAPPLEIQGFTKTVAWHERTHRDAGHRWLRDLLFA.. 307
251 2.000e-79gi|499574387|ref|WP_011255170.1| LysR family transcriptional regulator [Achromobacter xylosoxidans]  clstr ali  28  90FDPLASRRKFVIAMTDLGEITLLPRLMDLLSHAAPGVTISTVRNTHDSLSTEMEAGHVDLAIGLLPQ---LKTGFFQQRLFMQRYVCLMRSEHPYAGTAISSKQYFDSEHVQVVSAGTGHAKLDEIIDSSERKRTVKLLVPHFVAVGHILSNTDHIATVPELYALHYAKPFNLTYVDHPIPLPRIGINLFWHAKYHKEPGNQWM........ 290
252 2.000e-79gi|736353432|ref|WP_034379143.1| LysR family transcriptional regulator [Herbaspirillum sp. CF444]  clstr ali  25  93FSPETSERHFTIAMTDVGEVYFMPVLIEQCSRLAPGIQISTVRAGAIDLKTEMESGRVDLAIGAFDNVSGA---LYQRRLFRQNYVSMFRQGHPLADKKTTIREFLAARHLVVSSLESPYDRINQNLEKAGIRPNVHFRVPHFTAVPYIVSTTDLIVTVPQKLAESAAQPFNLQYIRPPLRLPSLQTNIFWHRRFNQDEGNQWLRGFISE.. 299
253 2.000e-79gi|1019384468|emb|SAL72911.1| LysR family transcriptional regulator [Burkholderia sp. LMG 29314]  clstr ali  27  87FDPMASDRVFRICMTDVGQMVIMPRLLDRLSAVAPHIRVETHNLD-EHTTRMLESGEADVAMGF---TQAIQAGFHERRLFREEMVCMVSRAHPRIGDGITREQFLNERYITVHTPGTAHWIVDRALEQQQVVRNIAVRVPSFLGLSLIVASTPLLALVPLHLGEIFARGGDVKLLAPPVTLPAYDVVLYWHDRYHRDPPNQWLRGVIADV. 293
254 2.000e-79gi|489149322|ref|WP_003059049.1| transcriptional regulator [Comamonas testosteroni]  clstr ali  31  91FDPATAHMTLRIAATDYALQAVVLPFLAVLRQRAPGLCVAVVPAQHLPLHERLERGDIDLAL---VTPERTAPDLHARRLFDERYVCVMRQGHPDARRRLSLQRFCALDHALVSYDGGSHGVTDEALERLGLRRRVALSVTSFLVLPEILRSSDLIAVVPRRLVK---PDSGLVVLEPPLEIPGFTKTAAWHARTHRSPGHQWARELLFEL. 297
255 2.000e-79gi|935525425|ref|WP_054434460.1| LysR family transcriptional regulator [Novosphingobium sp. ST904]  clstr ali  25  90FDPTSSDRRFTISTSDIGELVFLPRLMFELAVRAPGITLQSRSMAPDELQAAMADGAVDLALGYFPDLDG--SNFLTQKLFDHPFACIARADHPHANVGWSLQTFLGLGHIVVAQRGRSQELFEAKLREMGLSRRIQLQSPHFMSVPLLVAGSDLISTVPAAVGGIFATMAHLKVIAPPLPSPMISLQQFWHRRAQDDPAVLWLRRLIAEL. 298
256 2.000e-79gi|873955508|ref|WP_048637956.1| LysR family transcriptional regulator [Brenneria goodwinii]  clstr ali  27  92FDPAQATHTWRVAAFDYGEFTILQPALAGLRAAAPGTRLAIMQSIPSQVARKAEQGDIDLA---FLIGSEASPDLHRRSMFTERYVLAGRAGHPRLTRRPSLAQFCKLDHVIVSPDGGGHGVTDTELAKRGMTRRVVLSVPHFLFLGAVLASTDLVAMVPSRLVR---GNTALQVVEPPLDVPGFEMLMLWPERVHRDPAHQWLRERIAS.. 296
257 2.000e-79gi|498026132|ref|WP_010340288.1| LysR family transcriptional regulator [Xanthomonas sacchari]  clstr ali  28  91FDPARAQTLWRVAASDYGASTVLLPAIDALRRVAPGTTLAVLQLAPPTIAQQAEQGQIDLAL---HTVADAPPGLRRRTLFAEHYVLVGRAGHPRLRRRPSLAQFCALEHVIVSPDGGGFGVTDAALRARGLQRRVVLSVPHFQFVVAALQRSDLVAMLPERLVR---DQPGLRVCAPPLELPGYEMAMLWHERVHRDPAHRWLREHILA.. 295
258 3.000e-79gi|740365776|ref|WP_038201298.1| LysR family transcriptional regulator [Xenophilus azovorans]  clstr ali  28  97FDAASVIRQFRLAMTDIGEFHFLPQLMATLESSAPGISISTVRGTAVNLKFEMEAGNIDFALGYLPD---LVTDFHRRTLFSQRYVCLFRQGHPMDQAGAGLDVFAQSEHAAVISAGTGHGRVEEIMERSGVRRQVRLRVPHYVALADVLEGSNLIATVPEVFAIRSVKHFNLRYCPHPIDLPQIDIGLYWHTRFHRDPANRWLRSLLAD.. 303
259 3.000e-79gi|497201639|ref|WP_009515901.1| MULTISPECIES: LysR family transcriptional regulator [Hydrogenophaga]  clstr ali  28  90FDPARGQRCFTLALTDVGEIYFLPVLMDALAAEAPGVTLRCVPVAHDALREEMASGHVDLALGSLPQ---LQSGFFQQALFRQPYVALMRAGHPLARKPLGAAQYRQAAHVRVVAAGTSHGQVDTALERLGVARHVHLTVPHYVALGHVLADTDLIATVPERFAQRALGPFNLVMRALTLRLPTNTIHQLWHAHLHRDPGHLWLRGLVARL. 299
260 3.000e-79gi|918382860|ref|WP_052435135.1| LysR family transcriptional regulator [Pseudomonas sp. SHC52]  clstr ali  30  90FVPAQSERKMVLCMSDIGEMVFLPRLMAVLNERAPGICIRTPALSAEGLEEGLGTGDVDAAIGYFP--RLLNSSIRNRALYNHSFVCIVRQDHPTIGERMSAEQYQAAEHVAVQADGRGMGVLERELMMRDIKRRVRFTLSRFMGVPFLVAESDMIATVPLAVGRRFAEIARVRMVPLPWNIPGYDIHLHWHTRFHHDAANCWLRSTLIEL. 298
261 3.000e-79gi|517254615|ref|WP_018443433.1| LysR family transcriptional regulator [Burkholderia sp. JPY347]  clstr ali  26  88FDPGTTTRTFSIALSDVGEIVFLPRLLQVLAQRAPHANLRSLSLPPAELERGLAAGEIDLAIGYFPDLSG--NNFFQQRLFSHRFICLMRNGHPLAKRSLTLEAFLRCGHAVVRAEGRSQEVLEKYLEKHRTHRRAVLETSHFMSLPFILSRTDLIATVPHAIGAYAAEHASITLAEPPLALPRFDLKQHWHRKFHNDARTIWLRGIVAEL. 297
262 4.000e-79gi|516021993|ref|WP_017452576.1| MULTISPECIES: LysR family transcriptional regulator [Herbaspirillum]  clstr ali  29  92FDPAQSQQTWRAAAFDYSEYTILMPALDALRKAAPATRLAVIQTTPALVARKAEQGEIDLA---FLTATEAPPELRRLPLFTERYVLAGRAGHPQLKRRPTLAQFCKLEHVIVSTDGGGHGVTDTVLAEMGMTRKVALSVPHFLFLTAVLANTDLVAMLPSRLVRGSAA---LKVVDAPIEVPGFEMFMLWHERVHRDPAHQWLREHIAS.. 296
263 4.000e-79gi|738282996|ref|WP_036237180.1| LysR family transcriptional regulator [Massilia sp. JS1662]  clstr ali  27  89FDVSKAQATFRMAMADATAALWLPSLVRSIEKEAPGVNIRMVPLTTREPRPMLLRGDIDLAVGFFPGVAATGSPIRHERLYSGEYVVVMRKNHPLAQGTLSLDDYCKANHLLVSFSGRAHGLVDEALAQIGRERRILLTVNQFFTAGRVVANSDLVTVLPKHLIASTGAAEQLIWRELPFQLPAVHLDMLWHERDGRSPAHRWLRKNLESLS 305
264 4.000e-79gi|497370904|ref|WP_009685117.1| MULTISPECIES: LysR family transcriptional regulator [Pseudomonas]  clstr ali  31  92FQPATAQRRFRLCVSDASHITLLPSILNHVRSHAPGIRLEAVRID-GNSESALESGEADLAIGFVP---WLGGGMYQQVLFDQDWVCLSARGHPRLAGGLSMACYRAEGHVQISA-GTGQKLLETALARAGIERRIVLELPAFLGLGMILGSTDLIATLPRHIGQTLADMHDLQVHDCPFAVEGFTVKQHWHARYHQDGGNRWLRAVVHGL. 297
265 4.000e-79gi|544786771|ref|WP_021209272.1| LysR family transcriptional regulator [Pseudomonas stutzeri]  clstr ali  30  96FDPADATHTWRVAATDYAESTIVLPALADLRLQAPGARLAVVEMAPTRIAKQAEQGDIDLA---FHTSDDAPLGLHRRVLFAERYVLAGRAGHPDLKTAPSIARFCELAHVVVSPDGGGFGVTDGVLRAAGLSRRVALSVPHFLFVMAALASTDLVAMLPWRLVR---GNAALRMVEPPVEVPGYEMAMLWHERCHRDPAHRWLREHIA... 299
266 5.000e-79gi|797191465|ref|WP_045853775.1| transcriptional regulator [Raoultella terrigena]  clstr ali  26  91FTPLDADFTWTIAATDYALKAVIVPFIAALKPLAPGIRVRIIPESPSTLLAQAERGEVDVAL---LTPASTPPELHGRALYLEEYVCLMRADHPQAGAPLTLDLFCALEHMLVSWEGDSFGVTDKALAAVGRSRRVGLSVSSFLVLPEILAVSDMIAVVPRRLAAVTS---GMLIAPPPLTIPGFTKSMAWHERNHRDPAQRWLRELLWQVS 297
267 6.000e-79gi|95111282|emb|CAK16002.1| putative transcriptional regulator, LysR family [Pseudomonas entomophila L48]  clstr ali  29  100FDPAQARQTWRVAATDYSASTLLQPALATLRSEAPGTRLAVLDLVPGTLLRQAEQGEIDLA---FHIAEQAPAGLRQRSLFHERYVLAGRVDHPRLKRRPSLAQFCALEHVIVSPDGGGFGPTDAALADQGLARKVVLSVPHFMLLASVLAGSDLVAMVPERLV---AGDARLKVVEAPLAVAGFEMLMLWPERVHRDPGHRWLRELI.... 302
268 6.000e-79gi|506367815|ref|WP_015887534.1| LysR family transcriptional regulator [Sinorhizobium fredii]  clstr ali  31  93FEPEESTRQFVLGLSDYAAFVLLPRLTARLEREAPNISLVIRNTSHGVGLPMLEEGSVELIAGNFPGP---PSHMREELLYEEDFVCAGRGDHPALAYPLDLDRYLSLRHLQVSTRGNPHGYVDAVLAERGLKRKVAVTVGHFLMAPFLVDSSDLVATEPRRLFEPMPSRLPLRFFAPPIDLPPFRVVQAWHARHEADPGHQWLRRVLREIS 301
269 6.000e-79gi|913710615|ref|WP_050462327.1| LysR family transcriptional regulator [Herbaspirillum autotrophicum]  clstr ali  24  88FTPATTSRKFTLALSDIGEMTFLPKLLDRLRHDAPGASICSVSLPPPELALALENGDVDLAVGYFPDLKN--RNFFQQRLFSHTFICLLSANHAIKSRKISMAQFLSLGHAVIKAEGRSQELFEQFLIKKKIQRRIVLSTPHFMSIPFLIASSDLLVTVPRAVGESFAQFANIRLVEPPLEIPHFDLRQHWHRKYHKDGAVVWLRSVLAQM. 296
270 6.000e-79gi|941922863|gb|ALK92354.1| HTH-type transcriptional regulator SyrM 1 [Limnohabitans sp. 103DPR2]  clstr ali  24  90FDPKTSRRNFTIALTDVGEMYFLPVLVNVLAKVAPGVTLQIVSVAQSALKEDMSTGRIDLAMGLLPQ---LQAGFFQQSLFKQKYVCLMRKKHPLTQTTISVAALFASEHVRVLATGTGHGKVDAAMDQQKYSRQVRLTVPHYVALGDVLQNANLIAVVPERFAQRIVKPFDLVMRDLPIKVENSAIQQCWHGRLHRDPGHQWLRQLMREL. 298
271 6.000e-79gi|837941903|ref|WP_047905737.1| LysR family transcriptional regulator [Pandoraea faecigallinarum]  clstr ali  28  90FDPATSQRAFEIAMTDIGEVHFLPKLMHALGERAPGITISTVRNTAINLREAMASGQVDLAVGHLPD---LTAEFFQRRLFRQKYVCMFRPGHPLDRAAVTREDFERSEQVMVVAAGTGHGQVDEFMARAHVQRNIRLRVPHFVALADILHATDLIATVTEKFAQRSAQHFGLRYVDHPIDIPDVQINLFWHARYHREPGSQWIRSLLFDL. 312
272 7.000e-79gi|960943943|ref|WP_058356091.1| LysR family transcriptional regulator [Vitreoscilla sp. SN6]  clstr ali  30  88FNPLESNQEFTLSMTDISHLNLLPTLLQYLRVHAPSVRLNVVPIG-GQTAAMMSSGDIDLAIGFIPQ---LEAGFYQQTLFKQKYVALIREDHPRITGELTLDAYLHELHVDVIANGTGHYIIETEMHKQGINREVVIKLPSYLGVGLVIQETELLATVPERLSKLLLSRGNLKMLDLPFKLPTYSVKQHWHERMHGNPANQWLRQTCFQL. 295
273 8.000e-79gi|494986185|ref|WP_007712208.1| transcriptional regulator [Sphingobium sp. AP49]  clstr ali  25  90FDPLHAERCFSISTSDIGELVFLPTLLEVLKERAPRATLRSHSMPPHELERAMSDGVVDMAMGYFPDLQG--SNFLCQTLFEHPFSCILRKDHPEVGDALSLEQFLGLGHILVSQKGRSQELVEIRMQQLGLSRRIQLQSPHFMSVPLLVAGSDLISTVPHAVAAIFATMAPLKLLPPPFETPLISLQQFWHRRVDRDPAIVWFRSLVAEL. 298
274 8.000e-79gi|357969534|gb|EHJ91982.1| HTH-type transcriptional regulator syrM 2 [Halomonas boliviensis LC1]  clstr ali  30  109FHPGTATGRFTVATADHLALLLMPELVAKLASSAPGIDL-VMPAPVGDNVDLIAQGGADLAVGSF---EELPARFYSRRLYDEDFVCVVRQSHPIIAEQLTLENFVSLSHLSVIITGQGRSAVDDALAQHGLTRRIAVRTPHFLVAPMIVAESDLILSIPRRLAHRIARSAPIEILELPIEIQPFTPTIIWHERQHYDPAHVWLRNQIVEI. 315
275 8.000e-79gi|643472420|ref|WP_025214406.1| LysR family transcriptional regulator [Pseudomonas brassicacearum]  clstr ali  30  90FVPEHSDRQLVLCMSDIGEMVFLPRLMRMLDKTAPNLRIRTQALSSEQLEEGLDAGEVDAAIGYFP--RLLNTSIRHRALYSHSFVCIVRNDHPTIGDSISAEQYQGAVHVAVQAEERGMSVLDRELAAHGVTRRVRFSLPRFMGVPFLVAESDMIATVPLAVGRRFAEITDVRLVRLPWDICGYDIHLYWHTRFHHDPANRWLRQSFIEL. 298
276 9.000e-79gi|310881470|gb|EFQ40064.1| hypothetical protein PA39016_001650007 [Pseudomonas aeruginosa 39016]  clstr ali  31  98FNPATAQLTFSIAATDYALRAVAVPFLSALKRHAPRVRVSLVPVESGQLQNQLERGQIDLAL---LTPEITPPNLHARELFKEHYVCVLREDHPAAGRKLTVKQFCALDHALVSYDGGGFGVTDDALEQLGKRRSVTLSVKSFLILPDILRASDMVAILPSRLV---AGMDKLAISLPPVKIPGFTKTAAWHERTHHDPAHRWIRALLF... 302
277 1.000e-78JCVI_PEP_1096701278997 /source_dna_id=JCVI_ORF_1096701278996 /offset=0 /translation_table=11 /length=324 /full_length=324  ali  27  103FDPAASTHTFSIALSDVGEIVFLPKLLQAFATRAPHANLRSVSLAHDEVGRGLEAGSIDLAVGYFPDLDG--NNFFQQRLFTHRFVCLMRRGHPFEQAPPTVEQFLGCGHAVVRAEGRSQEVLEKYLAKQRMQRRAVLETPHFMSLPFILSRTDLIATVPHAIGYAYAAEHAFIVVEPPLALPRFDLKQHWHRKYHNDPRTAWLRGVVASL. 313
278 1.000e-78gi|334197326|gb|AEG70511.1| hth-type (hthlysr) transcriptional activator [Ralstonia solanacearum Po82]  clstr ali  30  116FDPSTARLTLSMAATDYGLRAVVVPFLLALRQRAPHVRLAARPVKDALIQAQLERGELDLAL---LTPDSTPADLYARHLFEERYVCALRQDHPDASGRLSLDRFCALDHALVSYVGGGFGVTDEALARLGRTRRVTLSVGSFLVLPEILRASDLVAVVPRRLV---AGVEGLTLLDPPVEIPGFTKVVAWHARTHRHPGHRWLRALLFE.. 321
279 1.000e-78gi|521291536|ref|WP_020455804.1| MULTISPECIES: hypothetical protein [Enterobacteriaceae]  clstr ali  29  91FDPLSATFIWTLAATDYALKVVIVPFIAELKKHAPGIRIRVEPVEPQRLVSQLERGEVDAAL---MTPHSTPEALHSRALFEERFVCMMRADHPAAQDTLTLERFCALEHALVSWDGRFRGVADNALAAIGKSRRVGVSVNNFLILPEMLTVSDMIAVVPQRLASLT---PGMCMREAPLPIPGFTKTLAWHERSHRDPAHQWLRNLLFDIS 298
280 1.000e-78gi|760081307|ref|WP_043763879.1| transcriptional regulator [Aeromonas taiwanensis]  clstr ali  27  90FDPATATLRWSVAATDYALQAVLLPFLRQLRQLAPGIQVVAHPVEDAAVYSQLERGELDLAL---MTPDSTPDNLHLSPLYQEEYVCVVRADHPVTTGKLSLDRFCELDHALVSYSGGGQGVTDHALAAQGRTRRVALSVPSFLVLMEVLRCSDLVAMLPRRLV---SRAQGLAVVNTPLAIPGFTKSMAWHERAHNDPAQRWLRELMQATS 297
281 1.000e-78gi|648419043|ref|WP_026110794.1| LysR family transcriptional regulator [gamma proteobacterium WG36]  clstr ali  28  91FNPAISSKTWNVSASDYGESAILLPTLSAFRAVAPHARLAIFETQPAGVAKKMEQGDIDV---LFHTGDGVPAGLRRRKLFDESYVLVSRKGHPRLAKRPTLAEFTALEHVMVSPEGGGFGITDKMLEETGLKRKVVLSVQHFLFALSALASTDLVAMLPARLVK---ENSTLQIFEPPIEIPGFEMAMLWHERCHRDVAHRWLRDFFAA.. 295
282 1.000e-78gi|647470356|ref|WP_025798322.1| LysR family transcriptional regulator [Hafnia alvei]  clstr ali  26  91FEPATAQNDWTVSAADYGESTVVLPVLIGLRGVAPNTRLSVIELAPAKIAKQLEQGEIDIA---FHVSDEAAPELHLKKLFSERYVLAGRRKHPQLSQALTPAQFCDLEHVIVSPNGGGFGVTDEALAQAGLTRRVVLSVPHFLFVKSVLASTDLVAMLPLRLA---IASPELQYIEPPMPIAGYEMSMLWHERSHRDPAHPWLRDFIVE.. 295
283 1.000e-78gi|575433061|gb|AHG65367.1| transcriptional regulator, LysR family [Advenella mimigardefordensis DPN7]  clstr ali  27  105FDPATATQQFTIASTDYALRAIVLPFVARIKRLAPHIRVALVLANDTQLLTQLERGVIDLAL---VSPEYTCQDLHARKLFDEHYVCVLRQDHPLIKQDLTLERFCELDHALVSYSGGGFGSTDEALEKMGRSRRVTVSVKSFLIMPDVLRASDMVSMLPSRLVT---DMTGLAVFEPPIAITGFTNMAAWHERTHRDPAQRWLRQLLFDI. 312
284 1.000e-78gi|746329770|ref|WP_039375794.1| LysR family transcriptional regulator [Pandoraea pnomenusa]  clstr ali  28  96FEPANADLTWRIAATDYTESTIVLPLLQRLRSEAPNTRLAAFDLAPSRLTRQAEQGVIDIA---FHTTENAPEGLRRQALFTERYVLVGRQGHPKLKRRPSVRQFCELEHAIVSQDGGGHASTDDALAQLGVSRRVVLSVPHFLFLRAALANTDLVAMAPERLVR---GDPALQVMAPPVDVAGFEISMYWHERVHRDPAHDWLRACIASV. 301
285 1.000e-78gi|944372495|gb|ALL69958.1| transcriptional regulator, LysR family (plasmid) [Paraburkholderia caribensis MBA4]  clstr ali  31  96FDPATAELTLTIASTDYALQAVVLPFLEALRRKAPGVRVAVVPVQDALLQAQFERGEIDLAL---VTPESALPELHARRLFDERYVCVMRASHPDAGGTLSLDRFCALDHALVSYSGGSFGVTDDALARVGRERRVTVSVTSFLVLPRILKGSDLIAVVPQRLV---ARSRGLATVEPPLDIPGFTKTVAWHERTHRALAHRWVRELLF... 300
286 2.000e-78gi|808941023|ref|WP_046289333.1| transcriptional regulator [Pantoea sp. 3.5.1]  clstr ali  29  90FDPLTADMTLHIAATDYALRAVIVPFMARLRREAPGIRVAVVPVNNETLQDQFERGAVDLAL---LTPDTTPQELHTRRLFDEEYVCLLRDDHPLITGPLTLDAFCALEHALVSYPGGNFGVTDTALAALGRSRRVTLSICSFLVLPEILRLSDLISVVPRRLA---IAGAGLTQLPPPLTIPGFTKTLAWHERTHRHKGHQWLRQLLITI. 296
287 2.000e-78gi|808993536|ref|WP_046289731.1| LysR family transcriptional regulator [Pandoraea oxalativorans]  clstr ali  31  96FEPANADVTWRIAATDYTESTIVLPLMQRLRTQAPKTRLAVYDLVPSRLSRQAEQGNIDVA---FHTTENAPDGLHRKALFTERYVLAGRRGHPKLKRRPTLKQFCALDHSIVSQDGGGHAATDDALAAMGLSRRVVFSVPHFLFLRAALASTDLVAMAPERLVR---DDPALQIMVPPLGLPGFEISMYWHERVHRDPAHRWLRETLASV. 301
288 2.000e-78JCVI_PEP_1096683604719 /source_dna_id=JCVI_ORF_1096683604718 /offset=0 /translation_table=11 /length=307 /full_length=307  ali  29  96FDPLTSNRMFGLCMTDIGQRVMMPRLLAHLREVAPSVRID-LSYTSEHTAHQLEAGEIDLAIGFL---SQLDAGMYQQQLFTDRFVCIVNRDHPRLRESVTLEEFERESHLIVATQGTGHVIVEETLERNNIRRKVGLRIPNFLGVVSNIASTEYLAIVPERFARIVAENTPIKLIELPFAVPTYRVMQHWHERYSRDPSLSWFRATIGQL. 303
289 2.000e-78gi|1011251123|ref|WP_062170082.1| LysR family transcriptional regulator [Burkholderia sp. PAMC 26561]  clstr ali  28  98FDPAVTTDTFAIALSDVGEIVFLPRLLQTLAVAAPRANLRSVSLKHDQVERALENGEIDLAVGYFPDLDG--ANFFQQRLFSHRFICLMRRDHPCARGPLTLAQYIECGHAVVRAEGRSQELLEDFLHKKRLRRRAVLETPHFMSLPFILSRTDLIATVPHAIGYAYVEHASIMLAEPPLPLPHFDLKQHWHRKFHNDPRTMWLRGVIASL. 307
290 2.000e-78gi|517137497|ref|WP_018326315.1| hypothetical protein [Rhizobium giardinii]  clstr ali  26  90FDPAGTERVFSLTMSDIGELVFLPKLLKALRALAPRASIRCVSMRPGELKEAMANGLVDLALGYFPDLS--DSAFYQQSLFDHPFSCIVRKDHPLIGDTLTLQLFLAAEHAVVVAEGRSQEIFERRMQDMGLQRRVLLRSPHFMSLPFQIANSDMISVVPRAVGQLAVRSANVKAFQPPLDIPAIELKQFWHRRVNNDLAVVWMRNLVAKL. 298
291 2.000e-78gi|654508375|ref|WP_027977685.1| transcriptional regulator [gamma proteobacterium L18]  clstr ali  28  91FEPSTAALTVTLASTDYALRAVVVPFLAALREQAPNIRVAVRPMDYQALEGQMDRGDVDLAL---ITPDSLSPGLHATTLFDERYVCLMRADHPDAAAELTLERFCALDHVLVSSSGGSFGVTDAALARIGHSRRVVTSVTSFLVLPDILRLSDLIAVVPQRLALN---QPGLVMREPPVDIPGFSKTLAWHERSHRDAGHQWVRSLLMATS 298
292 2.000e-78gi|738091753|ref|WP_036050404.1| MULTISPECIES: LysR family transcriptional regulator [Burkholderia]  clstr ali  29  88FDPSSSQRMFGLCMTDIGQRVMMPRLLEHLQKVAPGVRLD-LRYTSDRTACQLESGEIDLAIGFLTQ---LDAAIYQQQLFTDRFVCIVNKDHGRLHGTISLDEFERESHLIVATQGTGHVIVDETIARNNIKRKVGLRIPNFLGVISNIVCTDYVAIVPERFARIVADTNPIKILELPFKVPSYRVMQHWHERYARDPAIIWLRDTLGTL. 295
293 2.000e-78gi|740279838|ref|WP_038119767.1| LysR family transcriptional regulator [Variovorax sp. URHB0020]  clstr ali  30  88FDAASATRSFRVCMTDLGEIALLPRLLNHLQSSAPGIHIEADKIT-ADSARRLEEGAVDLAVGYMPQ---LYAGFYQQSLFEQDFVCIASASHPRIGKRLGKHGYSAERHVEVSASGTGHAMVDKALAAAGVTRLVALQVPSFLALAQIVADTELLATVPRHYAHVMLTREPIRQLAVPHELPRYTVHQHWHARFHRDPGNVWLRQIISAL. 295
294 2.000e-78gi|829822929|ref|WP_047352071.1| transcriptional regulator [Enterobacter sp. GN02616]  clstr ali  26  91FDPRQATLTFTLAATDYALRAIAVPFIAALKVRAPAVRVRVIPVDSERMMNQLERGNVDVAL---ITPHTTPDDLHSRALYDERYVCMMRADHPDAGKPLSLARFCALEHVLVSYEGDSFGVTDGALEKMGRTRHVGLSVSNFLVLPDVLAISDMIAVVPSRIAEN---QTGMFVCDTPVPVPGFTKCMAWHARTHRNPAQMWLRGLLLE.. 295
295 2.000e-78JCVI_PEP_1096681380921 /source_dna_id=JCVI_ORF_1096681380920 /offset=0 /translation_table=11 /length=306 /full_length=306  ali  25  91FDAATSTRTFTIAMSDVGEVYFMPVLAQLCAEQAPGVRLDTLRAGGFDMKAEMEAGAIDLCIGAFDDLSG--ESLFQRRLFQQDYVTMFRRGHALSEGKLTLERFRAASHLVVASSASPYNAIGPLLDKAGITQSARFSVPHFVAVPYIVSTTDLVVTVPRKLAERAAPPFGLEFVAPPLKLPALQTNVFWHRRFHQDAGNQWLRNLVAQ.. 298
296 2.000e-78JCVI_PEP_1096683534527 /source_dna_id=JCVI_ORF_1096683534526 /offset=0 /translation_table=11 /length=313 /full_length=313  ali  27  99FDPSTARVTWKIAATDYSESTVLIPALPGLRRLAPDSRLAVVQLAPRSIGRQCERGEIDLA---FHSADEAPSGLRHRSLFMEKYVLVGRRGHPRFNRKMSLTQFCKLDHVIVSPDGGGFGVTDAALAEAELQRRVVLSVPHFTFVREVLLSTDLVAMLPARLVR---GMPGLQSVAPPVDMPGFEMVMLWHERSHLDPSHQWLRDVIVS.. 303
297 2.000e-78gi|950252433|ref|WP_057288953.1| LysR family transcriptional regulator [Noviherbaspirillum sp. Root189]  clstr ali  26  90FDIATAQNTFRMAMADATAALWLPSLVRSIEREAPGLTIRMVPLTTREPRPMLLRGDIDLAVGFFPGVVAQLAGIRHEQLYSGRYVCVMRKNHPLAKEELTIDSYCSANHLLVSFSGRAHGLIDETLAQLGRERRILLTVNQFFTAGRVVATSDLITVLPRHLIASTGITGALITKELPFPTPTVHIDMLWHERDTRGPAHKWLRSHL.... 305
298 2.000e-78gi|848256187|gb|AKN27096.1| transcriptional regulator [Pseudomonas stutzeri]  clstr ali  31  103FSPAQANKTFRISMTDLTEAVMLPPLFQRLRRLAPNVKIESMLAKRRETTKELAAGRLDFA---MDAPLNTDPQVRHVKLLEDRYICAMRRGHPLAKDKLTLEQYLSLSHIHISSRRSGLGLVDLALGKMGLQRKIALRSQHYLMATQVIDQTDMAVTVPERFARR----HNLHQVDLPVDIMPLETHIYWHESTDQDPANRWMREQMIEI. 306
299 2.000e-78gi|398136978|gb|EJM26052.1| transcriptional regulator [Pseudomonas sp. GM25]  clstr ali  29  96FDPAQATHTWKVAASDYGESTILLPALGGLRSQAPGTRLAVLDLSPRQLVKQAEQGVIDLAL---HTSEDAPLELHRRALFTERYVLAGRAGHPKLQRKPTRAQFCELEHVLVSPEGGGFGVTDKALAEVGLTRNVVLSVPHFLLLMSVLASTDLVAMLPSRLAR---GNTALQVVEPPLQVAGYEMAMLWAERSHRDPAHKWFREHLAA.. 300
300 3.000e-78gi|873926613|ref|WP_048627616.1| LysR family transcriptional regulator [Pandoraea apista]  clstr ali  28  90FHPASSRETFVMCMSDIGEMVFLPRLLKHLDGVAPHVKIKTVAPTPQELEAGLTEGDIALAVGVFPDLES--ASIRQKLLYQHSFVCVMRIDHPNIGQTMTKDEYEAADHVAVRPEGRRADQFEKTLERLGVHRNVRLSLPRYMGVPFIVADSNMIATVPLSVGRRFADFARVRLVPLPFNVPAYDLHLHWHSRFHNDPANAWIREVMSAL. 298
301 3.000e-78gi|546164689|ref|WP_021806547.1| transcriptional regulator [Serratia fonticola]  clstr ali  27  91FEAASANITWRVAASDYGESTVLLPALARLRQAAPNSRLAVLELAPTRIARQAEMGEIDLA---FHTPDSAPAGMRQRVLFKEKYVLVGRFGHPALMARPTLAQFSQLEHVVVSPNGGGFGITDHTLDQVGLSRRVVLSVPHFLFVKSVIAKTDLVAMLPERLVR---DSPEVQIAEPPVEIPGYELAMLWDERSHRDPAHQWLRELIAQ.. 295
302 3.000e-78gi|769912258|ref|WP_045046905.1| transcriptional regulator [Rouxiella chamberiensis]  clstr ali  27  91FDPVRAELTYTLAATDYALRAVIAPLMLALKQRAPLIRVAVRSYDSERIFHQLERGDVDLAL---LTPQTTPVDLHSRALYQEEYVCVMRAGHPLAQGSLTLEQFCAQEHILVSNEGRFWGGTDEALAEKGLTRRVGMSVNSFLALPELLRLTDMIAVVPYRLAYH---HDYLVIMKTPLTVPGFIKSMAWHERAHRNVAHQWIRALCVEVS 297
303 3.000e-78gi|659836906|ref|WP_029889187.1| LysR family transcriptional regulator [Polycyclovorans algicola]  clstr ali  26  90FDPATAQHTFHLGLTDLGEVYLLPRILAETAKSAPLLRFTTVRGTADSLREEMENGCVDLAVGLLPQLQG---NFFHRRLLKQNYVLCLRKGHPLAKARWTLKDYVAQEHVVVVSSGTGHGNIDIVMARKGIVRNVRLIVPHFMAVGHVLQATDMVATVPEGFSRLIEQPFDLLSLTHPAGLPTVNIDAYWHRRQHRDPANMWLRNLLVEL. 298
304 3.000e-78gi|950176522|ref|WP_057224101.1| transcriptional regulator [Acidovorax sp. Root275]  clstr ali  32  91FDPATAQMTLHLASTDYALQAVVVPFLARLRRHAPGVRVAVVPAQHLPVYERLERGDIDLAL---ISPENTAPDLYARHLFDERYVCVMREGHPDAQGVLSLDRFCALDHALISYTGGSFGVTDEALARLGRSRRVALSITSFLVLPQILRTSDLIAVVPQRVV---ADAPGLVVMEPPVAIPGFVKTAAWHERTHRSAGHRWVRSVLFD.. 296
305 4.000e-78gi|737541081|ref|WP_035514357.1| transcriptional regulator [Paraburkholderia nodosa]  clstr ali  33  85FAPAEAEMTLTLASTDYALRAVVVPYLARLRETAPGVRAVIVPVQHERLQAQLESGDVDLAL---ITPETTPADLHARRLFDERYVCVMRADHPAAARRLTLERFCALDHALVSYAGGSSGVTDEALARVGRARRVTVSVNSFLVLPDILLTSDLIAVVPSRLVK---DAQGLAVVEPPLAIPGFTKTLAWHERTHRSPGHQWARALLFE.. 289
306 4.000e-78gi|494614734|ref|WP_007372979.1| LysR family transcriptional regulator [Kosakonia radicincitans]  clstr ali  30  91FDPARAAVTWRVAATDYTESAILLPLLSRLRVAAPGSRLAIFELSPLQIQRQAGQGDIDL---FFHLREGAPPALHQRLLFTERYVLAGRLHHPALTGRPTLAQFCQLEHVVVSPEGGGFAATDIALAERGLQRNVVLSVPHFLFMLEALARTDLVAVLPERLV---ANNHTLQVVEPPLDLPGFDMLMLWHERLHRDPGHQWLRQQIIA.. 296
307 4.000e-78gi|499255422|ref|WP_010952962.1| LysR family transcriptional regulator [Pseudomonas putida]  clstr ali  26  90FQPRQSDRLFTISTSDIGALIFVPPILRRLGEDAPNTDLRCVSLPHQQLEQALEQGSVDLAVGYFPDLQG--EQVKTQALFEHNFTCIVRRNHPSIGDTLSLEQFLAADHLVVNQEGRSQEIFEQRLRELKLQRRVHLEVPHFMSVPQLIASTNMVATVPLSLGVWFA-SEQIKMLTPPIEVEKFELKLHWHRQMEDDPAVSWFRNAVFE.. 296
308 4.000e-78gi|922793910|gb|KON81530.1| hypothetical protein PA01_07870 [Azoarcus sp. PA01]  clstr ali  28  90FDPAQSTRRFTLCMADIGESNYVPMLMNALQVKAPGVSLRTVFMPSNAMKEAMLTGEVDLAIGPFTDLE--QAQYFQQGLLDCGFVCIVRSDNPLARDELTMERFLAARHVTVSSPARSMVLIEQHMHQLRLDLDVKLRVSSFLSLLHIVTRTDLIAVVPAEVARTLKESGGVEALPLPFDAPTFTIRQFWHQRFHNDPGNRWLRREIHQL. 298
309 5.000e-78gi|380733569|gb|AFE09571.1| LysR family transcriptional regulator [Corallococcus coralloides DSM 2259]  clstr ali  29  108FEPATTTRRFTVATRDFFGSVLLPGALELLGREAPGVDLSVLHVDSNTFSSHLETGEVDLAIIVAPVPSG--PGLRQQKLLTEDFVCVVRKDHPTVRRKLDLDTYLKLSHILISPKGDGVGAVDLALAQRGLPRRIAVRVPYFLIAPLAVSRSDHVLTAPRRLIAAFRDAYELQVFPPPIPLRPFDILQVWHERFDGDPAHQWLRGLVA... 315
310 5.000e-78gi|739557111|ref|WP_037415313.1| LysR family transcriptional regulator [Serratia grimesii]  clstr ali  25  91FDPGIADNIWRVAAFDYGESTIVQPALMGLRAAAPYSRLAVIETVPSRIAKQAELGEIDLA---FHTREGSPPNLRQRILFSERYVLVGRAGHPGLQKTPSLAQFCMLEHVMVSPDGGGFGVTDKVLADAGLNRRVVLSVPHFLFVMSVLANSEMVAMLPSRLVH---KNSALQVVEPPVEIPGFEMTMLWHERSHRDPAHQWLREHIVA.. 295
311 5.000e-78gi|740881659|ref|WP_038666907.1| MULTISPECIES: LysR family transcriptional regulator [Enterobacteriaceae]  clstr ali  28  91FDPATADNTWRVSAFDYGESTIVLPALSQLRREAPHTRLAILETLPSAMLRLMEQGDIDLAL---HTSDMAPSGMRRRILFREHYVLAGRVGHPHLAHPLTLDQFSRLEHVMVSPDGGGHGATDGALAAMGLARKVVLSVPHFLFMMSVLATTDLVAMLPSRLLR---DQPGLQVAAAPIEIPGFEMAMYWHERWHRDRAHQWLRGLIAQ.. 295
312 5.000e-78gi|495217295|ref|WP_007942073.1| LysR family transcriptional regulator [Pseudomonas sp. GM18]  clstr ali  28  91FNPAEARQTWNVMASDYGESTIILPALAGLRSAAPGTRLALFDLVPSQLARQAEQGAIDLA---FHTSEDSPLGLRRRTLFTERYVLVGRAGHPRLKKRPTLAQFCELDQVIVSPDGGGFGVTDKALAKVGVTRRVVLSVPHFLFVRSVVESTDMVAMLPSRLVR---DGRGLEVVEPPLEVPGYEMSMLWAERCHRDPGHQWLRDFIVS.. 295
313 5.000e-78gi|655958055|ref|WP_029000835.1| LysR family transcriptional regulator [Azohydromonas australica]  clstr ali  30  93FDPAQAQRRFRICMTDASHVTLLPQMLAHVRAVAPGVRLEAARID-ADTARALEAGDADLAIGLVP---GLEAGFYQQTLFAQDWVCLVNRRHPLADGRLTLRRYEAEPHVAIAS-GTGYQLLAATLKERGITRDVHLELPGFLGLPAIVSTTDLVATLPRHIGETLARTADLLVLKCPLPIPGFEVKQHWHARFHHDAANRWLRGVCAAL. 299
314 7.000e-78gi|503104903|ref|WP_013339671.1| LysR family transcriptional regulator [Burkholderia sp. CCGE1003]  clstr ali  30  92FDPGTAQRRFRICMTDASHVTLLPRLLAHVRAQAPGVRLEAARID-GNTERALGSGEADLAIGYVP---WLTGGIYQQQLYEQDWVCLANRHHPRIKKRMSVNAYCREGHIAITA-GTGTALLEQALLRGRIERRVVLELPGFLGLGTIVQHTDLITTLPRHIGETLAQASDLAVHSCPIPVEGFAVRQHWHPRYHQEAGNRWLRSVVARL. 297
315 7.000e-78gi|515379296|ref|WP_016874980.1| hypothetical protein [Chlorogloeopsis fritschii]  clstr ali  26  96FNPATSDRTFRIGMDDYTEIVFLPKLFQTIEELAPHIKIQIRSSNWQKAPKLLDANEIDLAIGYCPQYQTWH---QRQILYEERFVCVTNAKQFKKRKAITLDEYITASHLLVSPKEDMVGMVDEILQEHNLQRTVALSVPNFLIVPFVLCNTDLIATLPTQIVQTFVEVWKLHALPLPFEMLGFSVDLLWHTKSDRDPAHRWLRNLIAQL. 303
316 7.000e-78gi|285027773|gb|ADC34238.1| LysR transcriptional regulator-like protein [Methylomonas methanica]  clstr ali  33  104FDPASSQRRFTIAATDYMEFLILPELSKLIEQSAPGVDIHVKRTESAFPLPQLENGSLDVVLG-FASVLNPPAHLHCEHLFTDRMACVVRQDHPRIKAAPSLEDYLAATHMLISRTGDKLGVIDEKLVELGLERRINFIVPHFLSAPLIVAQSNMILSLPYRLAIAFQKLVPLDVLPVPVSLPDYDLAMIWHPLWEKDPAHGWLREQI.... 310
317 7.000e-78gi|491513284|ref|WP_005370918.1| MULTISPECIES: LysR family transcriptional regulator [Methylomicrobium]  clstr ali  31  91FDPLTSQRRFVLAATDYMELLMLPALSERISRLAPGIAVQVKRTEASFPTGALENGSLDVVLG-FESVLNPPSHLHRQTLFSDRMACLARKGHPMLEDGLSLTDYVALPHMLISRTGSPVGLIDQKLQEMGMERRIQLIVPHFLSAPLIVAQTDMVLSLPQRTAKQFTRFAALDIFPVPVDLPDYDLTMIWHPLCDKDPALVWLRGLLTDI. 300
318 8.000e-78gi|736828208|ref|WP_034829713.1| transcriptional regulator [Enterobacter cancerogenus]  clstr ali  27  91FDAATAEMTIKIAATDYALRAVIVPFMAALRAQAPGIRVAVLPVNNEQLSAQFERGDIDIAL---ITPDSAPPDLHARSLYDEEYVCLMREDHPLAQTGLTLDSFCAQDHALVSYVGGNFGVTDEALAAVGRSRRVTLSVCSFLVLPEILRVSDLISVVPRRLTHDL---PGLKVLPPPLAIQGFNKIVVWHERTHRDAGHRWLRELLFS.. 296
319 8.000e-78gi|491917271|ref|WP_005670729.1| hypothetical protein [Massilia timonae]  clstr ali  26  91FEPGTSNRRFMLAMTDVGEVYFMPTLIERCRQLAPHVEISSVRVGTLSLKEEMEGGRVDLAVGPFEDVSEA---LYQRHLFRQPFVAMFRKGHPLARGELTLERFAQAEHLLVDAADSPYDRVNAALARAGVGQTTKFRVPHFTAVPYIVSTGDLVVTVPQKLAERAAAPFGLDWATPPLDLPPLQTNIFWHRRFNQDPGNQWLRGLLADV. 298
320 8.000e-78gi|772680924|ref|WP_045287924.1| LysR family transcriptional regulator [Pluralibacter gergoviae]  clstr ali  23  88FEAKTTRRTFTIAMSDVGEMVFLPRLLKRIEKEAPFASVRSVTPPPEKLITALQRSEIDLAVGYFPDLQGH--DVFQQRLFHHSFVCLVRSGHSILREGITEENFPRLPHAVVHFGGRSQEIVEQFLQSKGIERREMLHSSHFLSIPMVIASTDMVVTVPAAVAEIFSSFTDITAVPPPYKMPGFDLKQNWHRSQQNDPANRWLRTLVLEL. 296
321 8.000e-78gi|27261391|gb|AAN86077.1| NahR/VP16 activation domain fusion protein [synthetic construct]  clstr ali  28  90FDPLTSERTFTLAMTDIGEIYFMPRLMDVLAHQAPNCVISTVRDSSMSLMQALQNGTVDLAVGLLP---NLQTGFFQRRLLQNHYVCLCRKDHPVTREPLTLERFCSYGHVRVIAAGTGHGEVDTYMTRVGIRRDIRLEVPHFAAVGHILQRTDLLATVPIRLADCCVEPFGLSALPHPVVLPEIAINMFWHAKVPQGPSQ........... 287
322 9.000e-78gi|518779314|ref|WP_019936603.1| LysR family transcriptional regulator [Bordetella sp. FB-8]  clstr ali  31  90FDPQRSERNFVVGVNDVGQLYFLPRLMRLLSGDAPGVTVRAELMGSLDVKADMERGRMDLALGFLPE---LKSGFFQRRLFRQPYVCLFRRDHPLARTGVSLKQFQAAEHAAVVSVGTGHGIVDEIINRQGLRRRVKITVPHFMALGPLLQATRMIAVVPRRFADLACEPFGLATAACPVKIPESVINVFWHARNHREAANQWLRQRVVQ.. 296
323 9.000e-78gi|518533017|ref|WP_019703224.1| LysR family transcriptional regulator [Acidovorax avenae]  clstr ali  30  92FDPAHSRQTWRVAAFDYGEHAVLLPALAGLRASAPHSRLAVVQVPPSQLAAKAEQGDIDLA---FHAGEQAPPDLRRRRLFTERYVLAGRAGHPGLRRRPTLAQFCRLDHAIVSPDGGGHGATDAALAKLGLERRVALSVPHFLFLAAVLASTDCVAMVPSRLVR---GNTGLKIVEPPLEVAGFDMLMLWPERVHRDRAHQWLRDRI.... 294
324 1.000e-77gi|860301578|ref|WP_048368236.1| LysR family transcriptional regulator [Pseudomonas helleri]  clstr ali  33  90FVPGESQRTFRVAMSDYGAAIVLPKLVEQLRVLAPGISLVVVQDSRLGMLEQLEHGKIDLALGVFAT---LPEFLCSEVLFEEIFTCLLNRNVLPESGVLDLDTYLQRPHVLVSMDGNTQGEVDNVLRAQGLQRHVAVNVPHWSAAPSVIGDTDLILTVATRTLDSLPLADSLVRLPPPLNVAPFNYVQVWHQRFSDDPGHRWLRSVLRQIS 298
325 1.000e-77gi|489900974|ref|WP_003804410.1| LysR family transcriptional regulator [Alcaligenes faecalis]  clstr ali  30  90FDPVSEQREFRLAMSDYGAQIVLPPLMRRLRQQAPGIRLAVSQASREAMLAQLSDGEIDLAFGVF---SEMAASLRAQTLFDEHLICIADQASLSGGQPPGLDEWLQRPHVLLAMRPGGESEVDKALSQHGLHRQIVLSLPHWSAAAQVLEGTDLILTVSSRSAEHLRDQARLVFFQPPLPIPPVLFQQVWHRRRHTDPAHAWLRQQVMQ.. 296
326 1.000e-77gi|827202298|ref|WP_047194511.1| LysR family transcriptional regulator [[Polyangium] brachysporum]  clstr ali  28  88FSPADEQREFRICMTDISEIVLLPKLINHLQQTAPGVSVQAEKISP-DSRRGLESGELDLAVGFTPD---LDAGFYQQALFVQNFVCLASQAHPRIRGKLDRRAFSAEGHIVVTTAGTGHSIVDKVLVKHKLERQAVLRVPSFLGVGRIVAQTELLVIVPRLLGTALASQERVQVLEPPVPLPSYKVKQHWHERFNLDAGSIWLRRTMAGL. 294
327 1.000e-77gi|653546407|ref|WP_027579423.1| LysR family transcriptional regulator [Bradyrhizobium sp. Ai1a-2]  clstr ali  25  88FDPKHASRTFTIALVDVGEMALLPKLLGRLMSEAPSIDVRSVSMPPRELMLALQRGEVDLAIGYFPDIDGV--DFLQQRLFQHGFVCLVRAGHSVVHGALTKKQFRELPHAVVQAEGRSQEIVERHLKQFRIRRRQLLRSPHFLSIPMVIASTDLVVTVPQPVGEVFGRIVELQVLRPPYPFPSFDIKQYWHRCQHADPGNRWLRNMVADL. 296
328 1.000e-77JGI.Meta 7044240985 SRS042984_LANL_scaffold_14578__gene_19423 putative transcriptional regulator, lysR family [Human Supragingival plaque mi  ali  30  97FDPARARQVWRIAASDYAAITIIQPMLAPLRKQAPGIRLALVNLDPPALARQAEQGDIDL---VFHIPDDSPPGLRSRAMFTEHYVLAGRRNHPHLKRRPTLARFCRLEHAIVSPDGGGFGMTDRVLQRQGLSRHVVLSVPHFGTLLSVLASTDLVAMVPSRLVQNHAA---LRIQPAPLDIPGFDMHMLWPERLHRDAAHQWLRDMIVQ.. 301
329 1.000e-77gi|258554261|gb|ACV77203.1| transcriptional regulator, LysR family [Nakamurella multipartita DSM 44233]  clstr ali  33  96FEPETTERQFRICMTDASHITLLPTLLVELRRQAPRARLVATGID-KRTEQALQSGEADLAIGFAP---WLGPGIRRQELYAQDWVCLASRRHPRIQSPLTLADYLAADHVAV-PSGTGSNLLDEALAQERTTRRVVLELPGFLGLGVVIGRTDLLVTVPRHIGETLARASGLTVHPCPLPVEGFTVGQHWHPRYHEDPGNRWLRNLVARL. 301
330 1.000e-77gi|1019388968|emb|SAL13750.1| LysR family transcriptional regulator [Burkholderia sp. LMG 29314]  clstr ali  26  93FDPATAKRRFRICMTDASHVTLLPRMLAHIRAQAPGVRLEAARID-GNTERALESGEADLAIGHVP---WLSGGIYQQQLYTQDWVCLTNRHHPRVRAKLGLKQYRTEGHVAIAA-GTGAQLLEQALVRAQVQRDIVLELPGFLGLGAIIQTTDLIATLPRHIGQTLAKVNDLSIHSCPIPVEGFAVRQHWHARYHHETGNRWLREMVAQL. 298
331 1.000e-77gi|947574917|ref|WP_056238387.1| transcriptional regulator [Erwinia sp. Leaf53]  clstr ali  29  90FDPSSARLTFTLAATDYALRAVALPFLAALKTLAPQIQVALVALDDRQIQGQLESGEIDVAL---VTRDSTPADLHARDLFTEHYVCVLREGHPALGGALSLDRFCQLDQALVSYTGGGHGVTDAALAQQGRQRRVTLSVNSFLILPEVLRASDMVAVLPARLV---AGMVGLAVCEPPLAIPGFVKVAAWHPRSHHDVAQRWLRQLLFS.. 297
332 1.000e-77gi|764527687|ref|WP_044407313.1| LysR family transcriptional regulator [Pseudomonas sp. FeS53a]  clstr ali  32  91FDPAQAQGTWRVAATDYGESAILLPALPRLRA-APGMRVAVVEMVPSRIARQAEHGEIELA---FHTVEGSPTSLHRRTLFAERYVLAGRAGHPGLRRRPTREQFCALDQAIVSPDGGGFGPTDEALASLGLERKVVLSVPHFLFLRAVLESTDLVAMLPERLL----KGSTLQVVDAPVDVPGYEMAMLWHERVHRDPAHQWLREQIVS.. 293
333 1.000e-77gi|291151496|gb|ADD76080.1| SyrM1 [Pantoea ananatis LMG 20103]  clstr ali  31  105FIPADAVQEWRVAATDYGAQTALVPLMAALRQEAPGTRLAILDMKPALIAQQLEKGTVDL---VLHLRDGVPDGLHIRPLFQERYVVAGRQGHPALHSDITAEALCALEHVVVSPDGGGFGVTDSVLEARGLSRKVVLSVPHFLLMGSVLSTTDLVALMPERVA---AMMPGLMTVKPPMAIPGFELVMLWHERSHRDLGHRWLRERVKQ.. 309
334 1.000e-77gi|493624250|ref|WP_006576432.1| LysR family transcriptional regulator [Cupriavidus sp. HPC(L)]  clstr ali  32  87FDPAKAKRSFRICMTDLGEIALLPRLLNYLQRHAPGIDIDAERIT-ADSARRLEEGAVDVAVGYMPQ---LEAGFYQRTLFEQDFVCIASRSHPRIGKTLPKAVYRRERHATVAATGTGHTVIEKALAGHGASPRVALHVPSFLALAQIVGETELLATVPRHYAAVMQSREPIRLLALPYEIPRYEVKQHWHVRYHRDPANAWLRQVIADL. 294
335 1.000e-77gi|503133122|ref|WP_013367783.1| MULTISPECIES: LysR family transcriptional regulator [Enterobacteriaceae]  clstr ali  28  91FDPQLAANTWRVSATDYMASAILLPAMETLRRQAPNTRLAVFELNPAQIARQAERGDIDL---VFHTRDGAPPSLHQRLLFRERYVLAGRAGHPALRRTPTLDAFCQLEHVIVSPDGGGFAATDTALARLGLSRRVVLSVPHFLFMLETLARTDLVAVVPERL---IPDAAMLQVVAPPVEVEGFDMLMLWHERLHRDTGHQWLRQQLI... 294
336 1.000e-77JCVI_PEP_1096700806787 /source_dna_id=JCVI_ORF_1096700806786 /offset=0 /translation_table=11 /length=307 /full_length=307  ali  29  91FDPATAQRRFRICMTDASHVTLLPRLLAYVRAQAPRVRLEAARID-GNTERALESGEADLAIGYVP---WLSGGIYQQQLYEQDWVCLANRHHPRIRKRLGVNAYRTEGHVAIT-GGTGTALLEQALVRERIERQVVLELPGFLGLGAIVQTTDLITTLPRHIGETLAQASDLSVHPCPIPVAGFAVRQHWHARYHQEAGNRWLRSVVARL. 296
337 2.000e-77gi|490855125|ref|WP_004717169.1| LysR family transcriptional regulator [Yersinia ruckeri]  clstr ali  30  90FEPALATQRFRIALSDYGAAMVLPGLLQRLRQQAPGIDLVVEQASREQMIEQVMAGQLDLALGVFPD---LPADMTASRLFEEHFVCVIDQANPLARKKFTLDDYLVQPHLLVSMRGESVGEVETALAELGVRRRVAAIMPHFLLAPQALAGTDLLLTVASRVVTIQQESMNLQRLTLPFTVPNFDFVQIWHNRNHGKEDHRWLRQQVAE.. 297
338 2.000e-77gi|636787120|ref|WP_024323308.1| LysR family transcriptional regulator [Rhizobium leguminosarum]  clstr ali  25  90FDPATTDRVFSVSMSDIGELVWLPTLLRVLRDEAPNASIRCVSLRPTELKDAMANGSLDLAVGYFPDLS--EASFFQQKLFDHPFACIVRRDHPRIGDAISAEQFLEAEHAIVAAEGRSQEIFEKRMLDLGLKRRVLLRSPHYMSLPVQIAHSDMVSVVPRAVAQLAVQTANVKALEPPFEIPAIELKQFWHRRVNSDLAIIWFRGQVA... 296
339 2.000e-77gi|746546420|ref|WP_039578518.1| LysR family transcriptional regulator [Pseudomonas parafulva]  clstr ali  31  90FNPQQANKTFRISMTDLTEAVILPLLFQRLRRLAPAVVIESFLGKRRETTKELAAGRLDFAV---DAPLNTDPQVRHVKLMEDRYVCAMRQGHPQSGSTLTLEHYLGMTHIHISSRRNGLGYVDLALGKMGVQRKVALRSQHYLMASQVLQQTDMVMTVPERFARR----HQLRYLSLPVEIPPLETHLYWHESTDQDPANRWMREQIIEL. 293
340 2.000e-77gi|538487601|ref|WP_021004604.1| LysR family transcriptional regulator [Variovorax paradoxus]  clstr ali  25  88FDPLRSTRRFRLAMSDIGVLYFVPPLLRRFQESAPHIEIDIVQIP-DALGEDLSVGRLDMAIGNIPALASP---MHSVLLFREHYVCLMSANHPTIGERMSLKEFSSARHVMVSSPRSGHFLIEEALAERGINRNIVARVPQFTVLPQLLSQSDLLVLLPSRVASLYVLQGGLKALPLPVPLPDFQVQAHWHARQEYSAAHRWLVEEIVQ.. 293
341 2.000e-77gi|503339727|ref|WP_013574388.1| MULTISPECIES: LysR family transcriptional regulator [Rahnella]  clstr ali  25  91FDPSTAKNTWNLGAADYGESTIVLPALRALRRAAPSARLAIFETSPARIIRKMEQGTLDLA---FHTGEAVMNGLHSRLLFAERYVLVSRKRHPQVKGEISRSAFCALEHVIVSPDGGGFGNTDIALAATGLSRRVVMSVPHFLFVVQVLMTTDLVAMLPERLVR---GNPALQVTTPPLDVSGFEMYMVWHERAHRDPAHQWLREFIAD.. 295
342 2.000e-77gi|891170142|ref|WP_048913879.1| transcriptional regulator [bacteria symbiont BFo2 of Frankliniella occidentalis]  clstr ali  28  91FDPLSATLTFTLAATDYALSAVLIPLIAELKSRAPGINLAVRPIIDGQVTQQLARGDVDLA---FLTPETTAEELHSRSLYQEEYVCVAHRAHPAAQRSMTLEQFCHYEHVLVSTEGKFSGPTDEKLAELHLERRVGVSVNSFHAVPEILRLTTMIAVLPRRLAMTT---HDLVIIPMPLTVPGFTKSMAWHARRHQDPAHRWLRALCVEVS 297
343 2.000e-77gi|947609106|ref|WP_056272272.1| hypothetical protein [Hydrogenophaga sp. Root209]  clstr ali  28  88FDPKACKKTFQILLSDIGELVYLPRLMNRLREEAPAVNVRALGLPREAYAEAFVHGEADLAIGHLPSLRG---GFYQQRLFSDSYVCLVRKDHPRIKGHLTASQFISESHLLIEPGGSPTRLFEHYLASQNLTRRIALRVPHFTVVSDILLSTELLATLPSYVVRHTPHRPGLKMLELPFETPNFEIKQFWHTRNHDDMANRWLRGVVMSL. 305
344 2.000e-77gi|522145540|ref|WP_020656748.1| hypothetical protein [Massilia niastensis]  clstr ali  28  90FDPATSRRRFTIAMTDVGETYFMPKLVEACAEQAPQADIASVRAGLVDLRTEMEAGRVDLAIGAFED---APAVLYQRRLFRQAYVSMFRRGHPLGSGALTLERFKAARHLVVTSMESPYDCINEALAQAGIDVGTTFSVPHFAAVPYIVGTTSLVATVPQRLAERAAGPFQLEVAASPLRLPPLQTNMFWHRRYNQDHANGWLRALVASL. 297
345 2.000e-77gi|654306157|ref|WP_027819773.1| transcriptional regulator [Paraburkholderia bannensis]  clstr ali  31  91FDPARADFTLTLAATDYALQAVVTPYLAALRRDAPGIRVAVVPAQDPSLHAQLARGDVDIAL---ITPESTPSDLHARRLFDERYVCAMRENHPAARGRITLPRFCALDHALVSYSGGTFGVTDEALAQLGRKRRVALSVTSFLVLPQILRDSDLIAVVPRRLAERAA---GLAIVPPPLAIPGFTKTAAWHERTHRDPARRWARALLFDV. 297
346 2.000e-77gi|947751633|ref|WP_056413612.1| LysR family transcriptional regulator [Sphingomonas sp. Leaf28]  clstr ali  32  90FDPTTSTQSFTLALSDHPAFVLLPRLTNRLRAVAPGVTLRVAYTHRDDTVSLLDAGEADLTIGV-PARQGAGGRILMRPLFEDRFVCILRRDHPAASQPLDLAAFLGLSHLLVSPEGDRFGQVDAVLAAQGQRRRVALSLPQMHAAPNAVACSDMIATVLEGVVAASGSRNRLAMFPPPVDLAPVSFVMSWHRRNEAHQAQRWLRETIAELE 301
347 2.000e-77gi|505163481|ref|WP_015350583.1| LysR family transcriptional regulator [Myxococcus stipitatus]  clstr ali  28  118FEPRTSSRRFTIASGDYHAATLLPPLLEILDAEAPGVDITIRPLVVPQLEAQLESGEVDLVIAAFPDPF---PALRQQRLFREDFVCIVRRDNAAVKRGLDLETYLRLPHVLISPRGDGAGAVDMALERLGQSRRIGLRLPYFLTAALAVVRSNHVLTAPRRLAELFQDLCPVRLMPPPVTLAPFDVLQLWHERFDDEPAHRWLRTQIA... 323
348 2.000e-77gi|913712979|ref|WP_050464691.1| LysR family transcriptional regulator [Herbaspirillum autotrophicum]  clstr ali  26  91FSPADSQRRFTIAMTDVGEVYFMPRLVEQCRQQAPGVVISTVRAGAIDLKTEMEAGRVDLAIGAFDNVSDA---LYQRRLFRQNYVSMFRRGHPLAGGEVSLKEFLAAQHLVVASLESPYDRINQILEKAGVRANVHFRVPHFTAVPYIVSTTDLLVTVPHKLAESAVGPFNLQYIKPPLRLPSLQTNIFWHRRFNQDEGNQWLRGLIAD.. 299
349 2.000e-77gi|502208673|ref|WP_012732952.1| LysR family transcriptional regulator [Burkholderia glumae]  clstr ali  29  92FDPAAATGTFSLALSDVGEIVFLPRLLQELARLAPHANLRSVSLPHTEVERGLEAGAVDLAVGYFPDLGG--SNFFQQRLFSHRFICLARRGHPLAGAPLTLEQYLACGHAVVRAEGRSQEILEQHLAKARLHRRAVLETSHFMSLPFILGRTDLIATVPHAIGAYAAEHASITLLEPPLALPRFDLRQHWHRKFHNDPRTSWLRGVVAGL. 301
350 3.000e-77gi|495010027|ref|WP_007736039.1| LysR family transcriptional regulator [Burkholderia sp. BT03]  clstr ali  26  90FNPQTSDRSFTIYMSDLGQMVFMPKLISHIASVAPNIRIITVDATPKDAQNAMSTGEIDLALGLFMSFD---PGFHQQRLFREHYVAVVRDGHPGISTSLSLRRFLDARHAVYKPTAGSHAIFEEAFEENGRVRQVPVRLAHSLGLSQMIATSDLLVCVPSRLANAFNDYASVRVFPLPFEAPTFDISQLWHDRCHRDAGHRWLRSTVASL. 301
351 3.000e-77gi|644869737|ref|WP_025374865.1| hypothetical protein [Advenella mimigardefordensis]  clstr ali  25  88FDPKTSSRVFRIGMTNTGQIVVIAKLKNALNMLAPNIRLEVVELTANSPM-QLERGEIDIVMGF---TKIMGPGFYQQKLFSEHYVCLVRSNHPRIKNSLSIEQFIKEDHVSVKSSGTAHWLLEKAIDDAGVTRKIALWVPSFLGLAEIVRTTDLLALAPIHLARILCRDKSVRSLDIPIQIPSYDVKQYWHERYHQESGNIWLRKIIA... 292
352 3.000e-77gi|900951771|gb|KMZ11316.1| LysR-family transcriptional regulator [Candidatus Burkholderia humilis]  clstr ali  28  99FDPATAKRHFRICMTDASHITLLPRMLAHVRAQAPGVRLEAARID-GNMERALESGEADLAIGHVP---WLGGGMYQQQFYMQDWVCLANRHHPRVRARLNLKQYRSEGHVIIAA-GTGAQLLEQALLREGIERDVVLELPGMLGLGSIIQSTDLIATLPRNIGETLAKVNDIAVHPCPFPVESFAVRQHWHAKYHHEAGNRWLRSVVADL. 304
353 3.000e-77gi|549790867|ref|WP_022557111.1| MULTISPECIES: transcriptional regulator [Rhizobium/Agrobacterium group]  clstr ali  27  94FDPASSDRMFTIAASDNPAAIVAPELLSLVHKQAPGINIRFVFPDRGHIGRQLESGDVDLYIG---AANDAPLDLIGRRLFTDELVTAQRIGHPRGRGPLSLDEFCAHEHLLISSNGGMFGVIDEVLAEHGKSRRVSVSVQSYALAPLIVAGTDCLCTLPKRLLERFSHSLDL--FKPPIELGEFALKYFWHPRMTSDPAHQWLRTIVAD.. 299
354 4.000e-77gi|646839550|ref|WP_025597321.1| hypothetical protein [Burkholderia sp. WSM2230]  clstr ali  29  88FDPSSAERLFSIAMTDISQILLLPTLLNEIRLVAPKVRLKVSHITTE-TPRMLETGQVDLAVGFMPQ---LAATFYQQKLFVQHFEVLAATGHRALRDGMSLEAYLSGDHVAVIPPGTGHSIIDTALREQQLRRNVVLEVPNYLAVADIISRTHLLATVPQKLAAAIGTANSVQRYAAPFHIQKYDVKQHWHTRCHRDAGHRWLRSLFAEL. 294
355 4.000e-77gi|752319339|gb|AJG21946.1| LysR-family transcriptional regulator [Cupriavidus basilensis]  clstr ali  25  93FDPLAARRTFNLCMTDMGELVFLPPLISRLRREAPHCKLRTLQVPLQQIEGMLGTGEADLALGSI---RAAPEGLFQQRLFMHSFVTIVSARNQEVGDALTLEQFQRMPQIVVTLSGRASAAYDSAFDDHGIQRNIYLSTPHFLVVPLLMQQPDLIATVPLELANVFARYGTVRVMQPPVALPEFAIKQHWHPRFHHDPAIIWLRELV.... 298
356 4.000e-77gi|517969759|ref|WP_019139967.1| LysR family transcriptional regulator [Herbaspirillum massiliense]  clstr ali  24  90FDVSTARNTFRMAMADATAALWLPSIVRAIEREAPNLTIRMAQLTTREPRPMLLHGDIDLAIGFFPGVVAQLASIRHQQLYSGRYVCVMRKHHPLAKEELTVDAYCSAKHLLVSFSGRARGLVDEALARLGRERRILLTVNQFFTAGRVVATSDLITVLPRHLIASTGITSALITKELPFPMPSVHIDMLWHERDTRNPAHKWLREKM.... 305
357 4.000e-77gi|503958834|ref|WP_014192828.1| LysR family transcriptional regulator [Burkholderia sp. YI23]  clstr ali  27  88FEPAHSHRTFRVCMTDLGEISLLPRLLRYLQSNAPGIHVEAEKINADSPRR-LEDGAVDLAVGYMPQ---LDAGFYQQALFEQDFQCIASLSHPRIGKRLGKSAYAAERHVEVSNPATGHAMVDKALAAAGVSRDIALRVPSFLAVAQIVSETELLATVPRYYALAMLSREPIRRLVVPYELPRYSVKQHWHARFHRDPGNVWLRQTIADL. 295
358 4.000e-77gi|947850704|ref|WP_056511422.1| ABC transporter substrate-binding protein [Variovorax sp. Root411]  clstr ali  25  90FDPATARRAFTLCMTDMGELVFLPPLISRLRRDAPHCTLHTLQVPVSQVEATLAGGDADLAVGSL---RAAPEGLFQQRLFMHSFVTIVSARNKSVGDTLSLEEFERLPQIAVTLTGHVSGAYDNALEALGVKRNIYLTTPHFLSVPLLMEHPDLIATVPLQLANVFEEYGRIRVVKPPVDLPTFALSQHWHPRFHHDPAVIWLRETMKE.. 297
359 5.000e-77gi|1019454952|emb|SAK82547.1| LysR family transcriptional regulator [Burkholderia sp. LMG 29322]  clstr ali  26  111FDPTTAKRRFRICMTDASHITLLPRMLAYVRAQAPGIRLEAARID-GNTERALESGEADLAIGYVP---WLGSGMYQQQLYMQDWVCLVNPNHPRVRARLTLKQYCNEGHVIIAA-GTGAQLLEQALLREDIERDVVLELPGMLGLGSIVKSTDLIATLPRNIGETLARVNDVTAHTCPFPVDKFAVRQHWHAKYHHEAGNRWLRSVVADL. 316
360 5.000e-77gi|338169666|gb|AEI80720.1| transcriptional regulator LysR family [Cupriavidus necator N-1]  clstr ali  26  99FDPATMQRTFTLCMTDMGELVFLPPLMQRLRAIAPRCSLRTLQVPMPQIEALLASGEADLVLGSV---RTAPEALFQQQLFMHGFVTIVSSRNKTVGDTLTVEQFETMPHIAVSLAGRSSPAYDAAFESHGLKRRVYVYTPHFLSVPLLMREPDLIATVPEELANVFSRYGVVRVVKPPVALPSFALSQYWHPRFHHDPAIVWLRQLVKQ.. 306
361 5.000e-77gi|501409628|ref|WP_012441194.1| transcriptional regulator [Erwinia tasmaniensis]  clstr ali  26  91FEPIIAELTYTIAATDYALKAVVIPLMAALKQRAPRVKIAVRSVDSERIYQQLSRGAVDLAL---LTPQTTPDDLHGRTLYEEHYVCLARSHHPLAAKNITLKQFCEQEHILVSTEGKFSGVTDEALAELKLTRRVGMSVNSFLVIPDILRLTNMIAVVPRRMV---PADSDMAIIPLPLNVPGFSKSMAWHERTHRDPAHQWIRTLCLEVS 297
362 5.000e-77gi|939347070|ref|WP_054892524.1| MULTISPECIES: LysR family transcriptional regulator [Pseudomonas]  clstr ali  30  90FEPGRARRTFRLAMSDYGAQVVLPALMRELRTLAPQIDLVVSQGSREAMLGQLIDGEVDLALGVFPE---LPSEIHEQGLFDESFVCVADRGTLPMRGNLTLDAWLARPHVLVAVRPGIDNEIDQALKALGVRRRIALTLPHWGVAQTVLAGTDLVLTVARRSLAASPPDKALRVFEPPLPISAFSFAQAWHARREGDAGHQWLRELILA.. 296
363 6.000e-77gi|655049596|ref|WP_028498178.1| LysR family transcriptional regulator [Microvirgula aerodenitrificans]  clstr ali  28  92FDPARASQTWRVASFDYGESTILLPALAGLRAAAPGTRLAVLEVAPADMGRQLEQGGIDLA---FHVGDEAPGGLRRRLMFAEQYVLVGRAGHPGLSRRPTLAEFSRFEHAIVSPDGGGFGVTDSALLERGLSRRVVLSVPHFLFLKSVLASTDLVAMLPSRLVQ---DDPRLQQVEPPVAVPGFEMHMLWHERSHRDPAHQWLREHIAA.. 296
364 6.000e-77gi|501372597|ref|WP_012404163.1| LysR family transcriptional regulator [Paraburkholderia phymatum]  clstr ali  25  95FVPDKAQRTFTIALSDVGEMVSLPRLLQRVTSLAPSVNVTTVSFAPKQLLSSLQRSEVDLAIGYFPDLDGV--DVFQQHLVRHSFVCLVRQNHPAVQGRLTKKLFCELPHAVVQVEGRRQEIVEQFLKENGIRRREVLHTPHFLSIPMTIAMTDLVVTVSSDVGEIFARIAELEILDPPYKMPRFDVNQYWHRSQHDDPGNRWMRGLVREL. 303
365 6.000e-77gi|506942769|dbj|BAN22889.1| transcriptional regulator LysR family [Burkholderia sp. RPE64]  clstr ali  28  107FDPSASTDIFSIALSDVGEIVFLPRLLQAFAKEAPHANLRSVSASHGNVERGLEAGEIDLAVGYFPDLRG--NNFFQQRLFSHRFICLMRRDHPYANEPLTLERFLECGHAVVRAEGRSQEVLENYLDRERVRRRAVLETPHFMSLPFILSRTDLIATVPHAIGAYVAEHASITLAEPPLALPRFDLKQHWHRKFHNDTRTVWLRGIVASL. 316
366 6.000e-77gi|950514272|ref|WP_057399657.1| transcriptional regulator [Pseudomonas fluorescens]  clstr ali  28  91FDPVMANMTLTIASTDYALRAVVVPFLSALRVQAPNIRVAVQPVDSQHLLNQLDRGDVDWAL---VTPENTASGLHAAKLFDERYVCVMRADHPDAGETLALDRFCALDHVLVSSSGGAFGVTDQALARIGRSRRVTVSVTSFLVLPEILMASDLIAVVPRRLAT---KSNGLIMLEPPVDIPGFSKTVAWHERTHHEPGHKWLRSLLID.. 296
367 6.000e-77gi|518239177|ref|WP_019409385.1| LysR family transcriptional regulator [Pseudomonas psychrophila]  clstr ali  29  90FVPADSQRTFRVAMSDYGAAIVLPKLVTQLREQAPDISLVVIQDSRLGMIEQIEQGKIDLAVGVFP---MLPADVCSDVLFVETFTCLLNRNALPDSGVLDLDTYLQRPHLLVSMDGNTQGEVDNVLRSQGLQRRVAVNVPHWGTAPGMIGDTDLILTVASRTLDNLALGDSLVTLAPPLNVAPFNYVQVWHQRFNEDPAHRWLREWVKQVS 298
368 6.000e-77gi|948123175|ref|WP_056781667.1| transcriptional regulator [Serratia sp. Leaf51]  clstr ali  31  90FVPAECEMTFTLAATDYALSVIIVPFFSLLRQRAPGIHLSVQRAEASNIQERLERGEVDLAL---LTPETTPPDLHIRHLYDERYVCTLRKGHPALKGTISLGTFCHYDHALVSLSGENFGVTDTALRALGKKRNVVLSVNSFLVLPPVLQTTDLIAVVPERLVR---DAAGLEVMPPPLDIPGFTKVAAWHERSHLSPAHQWLRQQLAQV. 296
369 6.000e-77gi|654841380|ref|WP_028294015.1| transcriptional regulator [Oceanobacter kriegii]  clstr ali  29  90FDPATANMQFSIAATDYALRAVGLPLLSRLRQQAPGIQVALLPVQDAELTEKMERGDIHLAL---MTPESCQPDWRGRKLFRERYVVAMREGHPVLQQDWDLTAFCQWQHALVSYSGGGFGVTDTALEAMGVEREVMVSVSSFLVIPELLAGSDLLAVVPERLV---AGIDGLVTLEPPVAIPGFTKLAAWHERVHRDPAQRWIREQLF... 293
370 6.000e-77gi|753915074|ref|WP_041642461.1| LysR family transcriptional regulator [Azoarcus sp. BH72]  clstr ali  30  92FDPGLARQNWRVAATDYGASTILLPALTTLRAAAPNTRLAVVELQPATLVQRSERGDIDLA---FHISSEAPPGLHQRLLFAERYVLAGRVGHPRLTVRPTLAEFCELEHVIVSPNGGGHGVTDTALAALGMTRKVALSVPHFLFLSATLARTDLVAMVPSRLVRY---NTALQVVDTPLELPGFQMVMLWHERVHRDPAHQWLREQIA... 295
371 8.000e-77gi|654705053|ref|WP_028163090.1| LysR family transcriptional regulator [Bradyrhizobium elkanii]  clstr ali  29  90FVPEESDRVFTVTTSDIGVLIFIPPILQRIRMMAPGAGLRCVPTSHEQLEDALENGEIDLAIGYFPDL--LGPNIVTEDLFDHPFTCIVRKDHPTIGDTLSLEQFLTADHIVVNQQGRSQEIFERRVRELKLQRRVVLHLPHFMSVPQLIATSDMISTVPFSLGAWYADA-GLKLLPPPVSIPLIQLKQHWHRRMDNEPAVRWLQSIVAE.. 296
372 8.000e-77gi|738151710|ref|WP_036109091.1| MULTISPECIES: transcriptional regulator [Luteibacter]  clstr ali  29  91FDPTTAEWSMTIAATDYALQAVVVPLLAVLRREAPGARVAVLPVQNQPVHAQLERGDLDLAL---ITPSETSPGLHARPLFDERYVCVMRRGHPAAEATLSLDRFCALEHALVSYGGGSFGVTDDALAGVGRTRRVSLSVTSFLVLPEILEASDLIAVIPERLARR---APGLVVRDPPLPIPGFTKTAAWHERTHRSPAHRWARERLFSL. 297
373 8.000e-77gi|737931239|ref|WP_035896114.1| LysR family transcriptional regulator [Kluyvera ascorbata]  clstr ali  28  91FNPWESQREFRVAMTDLGEIYLLPRLMNLLSKEAPGVRITTVRDTAVPLKTEMENGGVDLAIGLLPQ---LEAGFYQRRLFDQRYVCLMRKDHPLSNQSFDEAAFREAQHIKVMAQDSGHKRIFELFAKAGIADQGQLCVPHFMAIPYILSETDFIVTVTEKLALQTAQRFGLVIHTLPYDLPTIQINLFWHSHVHQDAANTWLRRCFMRL. 298
374 9.000e-77gi|736303141|ref|WP_034334734.1| transcriptional regulator [Herbaspirillum sp. B39]  clstr ali  30  92FDPATAHLDFTIAPTDYALRAVALPFLTALKQHAPFIRVALASMEDAPLQERLERGEIDLAL---TTPQDTPPGLHARRLFDEHYVCAMREDHPVVRGRLSLKQFCALDHALVSYAGDPHGVTDEALAQRGLQRRVSLSVKRFLVLPEILRSTDLVAVVPSRLV---AGVEGLKLLPPPLEITGFTKTAAWHERTHRDPAQRWLRQLLFA.. 297
375 9.000e-77gi|503000949|ref|WP_013235925.1| LysR family transcriptional regulator [Herbaspirillum seropedicae]  clstr ali  28  88FTPATTTKRFVLALSDIGELMLLPRLLERIRDEAPHASVVTVTMAPAELVAALESGEVDLAIGYFPDLRN--RNFFQQRLFSQDFVCLLRAGHPLPAQKISLEHYQAAGHIVVKAEGRDQPMCERFLLRRKIRRRVVLSTAHFMAIPLLVATSDLVATVPRAFGEFVVRFAGIRLVEPGFEMPMLDLKQHWHRKYHKDAGNAWLRGLAAAL. 296
376 9.000e-77gi|388538574|gb|AFK63762.1| LysR family transcriptional regulator [Advenella kashmirensis WT001]  clstr ali  27  31FDPAQSHQTWRVAASDYGETSILLGALAGLRSAAPNARMAIVALNPQALASQAEQAHIDLA---FHISSEAPLQLRRRSLFNESYVLAARTGHPALQGTLTLAQFCKLDHVIVSPDGGFHGVTDTALAARGLARRVALSVPHFLFLEAVLVNTDLVAMVPSRLVRH---STALQVVAPPLEIPGFEMLMLWHDRVHRDPSHQWLREHIV... 234
377 1.000e-76gi|654769866|ref|WP_028224382.1| LysR family transcriptional regulator [Paraburkholderia ferrariae]  clstr ali  27  88FDPKTSDRMFSLCMTDIGQRVMMPRLLKHFGDVAPHIRID-LSYTSEHTARQLESGEIDLAMGFL---TNLDPGIYQQQLFTDRFVCIVNREHRRLAGTLTLEEFEGESHLIVATHGTGHVIVEETLKRHDITRRIGLRIPNYLGVVSNIVCTECLAIVPERFARIIAESNPIKVMELPFTVPNYRVMQHWHERYSRDPASVWLRETIGTL. 295
378 1.000e-76gi|500199570|ref|WP_011872777.1| LysR family transcriptional regulator [Herminiimonas arsenicoxydans]  clstr ali  26  89FDVSRATTTFRMAMADATAALWLPFLVRAIEKEAPGLNVRMVPLTTREPRPMLLRGDIDLAIGFFPGVAAAVSQIRHERLYTGEYVCVMRKNHPLAKEELTLDTYCAAHHLLVSFSGRAKGLMDDALSEVGRERRILLTVNQFFTAGRVVASSDLITVLPRHLIASTGMEEALIAKDLPFSLPEVHVDMLWHERDARNPAHKWLREQLI... 305
379 1.000e-76gi|810482746|ref|WP_046345508.1| LysR family transcriptional regulator [Xanthomonas campestris]  clstr ali  28  85FDPDQSKRLFTIRTRDIGEVICLPAVFSALQAQHPGIRLRTVFRPMTDTLTGMSSGQIDLALGFLP---SLENGIHRRRLFEQHYVCVMRSGHPLAKNTLTQQRFCASDHLVVEYSGSGHQILEKSLTEAGIRHRIRIRIPQYLSAPHFICTSDLIWSVPAALAQVMAKSYPLVIKPHPLKLPPFEIALYWHDRFHRDPANKWMREFISE.. 291
380 1.000e-76gi|489535374|ref|WP_003440101.1| MULTISPECIES: LysR family transcriptional regulator [Pseudomonas]  clstr ali  28  90FVPADSQRTLRIAMSDYGAAIVLPKLLVQLRAQAPGTSLVVIQDSRLGMLEQVGQGRIDLAIGVFPAP---GADICTEVLFEETFTCLLDRRSLPENGVLDLDSYLARPHLLVSMDGNTRGEVDNVLRARGLKRRVAVNVPHWGTAPGMIADTDLILTVATRTLTNVPFGDTLVAMAPPLTVAPFNYVQAWHNRFNQDPAHRWLRELVRQVS 298
381 1.000e-76gi|947849118|ref|WP_056509843.1| LysR family transcriptional regulator [Variovorax sp. Root411]  clstr ali  28  98FDPSSATRRFRICMTDASHITLLPRLLAHVRAVAPGVRLEAARID-EQSAQALQSGQADLAIGLVP---WLESGFYQQVLYPQDWVCLVNAAHPRIGRKLGLRDYKTEAHIGIV-GGTGVQLLDAALLRHRVERRVLLEIPGFLGLAAIVSTTDLVATVPRHIGETLARANELKVFDCPVPVPPFTVKQHWHARYHQDPANRWLRGLCEDL. 304
382 1.000e-76gi|544910067|ref|WP_021320114.1| hypothetical protein [Sphingobium ummariense]  clstr ali  26  88FDPAQAERCFTLNLSDLGELTFLPDLMTSMQERAPGVSVRSISLPPAELRRALADGSVDLALGFFKGLDG--DNFFTQTLFEQGFVCLVRTGWKNGSQVMTLQDFLSADHAVVEQEGRSQEVLEQRLRAMGLRRRTLLRSPHFMTVPLLVARSDMIATVPWGVGRIFSRLGGLRFVTPPFDTPRIALQQLWHRRNHHDPGLVWLRRLIADL. 296
383 1.000e-76gi|640717465|ref|WP_025140698.1| LysR family transcriptional regulator [Achromobacter sp. DH1f]  clstr ali  28  89.DPSRLARTFTLRTSDGFVENFGAALIALAGREAPGVTLRFVAKSDKNSAP-LRDGSVDLETGVVGAASS--PEIRTRALFRDRFIGAVRADHPLAKGKITPARYAAGQHVLVSRRGLDKGPIDEALASLGLTRQIATIVAGFSDALTLARGTDLVASVPERHTGNL--RAGMYSFALPVDTPGITVSMLWHPRMDADPGHRWLRECVRQV. 293
384 1.000e-76gi|946873034|ref|WP_055795925.1| LysR family transcriptional regulator [Variovorax sp. Root318D1]  clstr ali  32  86FEPATAKRMFTVRTRDIGEAVSFPPIMAALAQCAPGIRLRTVFRTIPETVSGLAAGQIDFALGFLP---SLEAGIHRRLIHTQHYVCVMRAGHPLADKKMTLERFSESEHLLVEYSGSGHIQLERALIDAGARNRIKIRLPQYLAAPHFVVSSDLLWSAPAVLAETLAKHYPLVIKPLPLDLPSFEIFLYWHDRYHQDPANKWMRDFVVQ.. 292
385 1.000e-76gi|739120124|ref|WP_036989717.1| LysR family transcriptional regulator [Pseudomonas bauzanensis]  clstr ali  28  90FNPDQANKTYRISMTDLTEAVILPHLAARIRRLAPNINIDSFLTRRRETTKELAAGRLDFAI---DAPLNTDPQVRHVKLFEDRYVCIMRKGHPLAKDKISLDDYLAQSHIHISSRRNGLGHVDLALGKMGIQRRVVLRSQHYQMAPLVLESTDMVMTVNERFARR----HNLHWVELPIDIPPIQTHLFWHESTDQDPANRWMREQIIELS 296
386 1.000e-76gi|501029320|ref|WP_012081406.1| LysR family transcriptional regulator [Janthinobacterium sp. Marseille]  clstr ali  25  90FDPATTTKTFSFYMTEIGEILLLPKLLKHIQVAAPNACVRVRRIPEQGAKEAMANGEIDLAVGLFP---YLKAGFYQQRLYTDKFACIVRQGHPTVHDSLTPQQYVDTPHVIVMSANTGHAAIEKILLTEHLRRKIVMTSQNFLVLPMIIEQTDAIATIPFRMAQKIASSTGIKILESPIPFPNVDIKQHWHERFHYDPANKWMRDLMVTL. 299
387 1.000e-76gi|734935180|ref|WP_034146482.1| transcriptional regulator [Pseudomonas fluorescens]  clstr ali  28  91FDPLTATMTVSLASTDYALRAIVVPFLGSLRMLAPHIRVAVHPVDTQQLLGQLDRGVIDLAL---VTPEDTASGLHSALLFDERYVCVMRTGHPAVGETLALERFCALDHVLVSSSGGSFGVTDQALARIGKSRRVTISVTSFLVLSEILRTTDLIAVVPRRLAMHSA---GLAILEPPVEIQGFSKTAAWHERTHHDPGQKWLRSLLIDI. 297
388 1.000e-76gi|501097277|ref|WP_012147297.1| LysR family transcriptional regulator [Serratia proteamaculans]  clstr ali  27  90FDPAANRRTLTLCMPDIGEQYFLPPLINHLAQVAPGMAVVSHELAPAQLEEALESGRVDLAIGYFPDLRRAV--FYQQRLFYSGFCCAVRQGHPQIGKTLSLPQFLQAEHVTARLRIRSQEIAEQAMREQGIVRNVKLQTSHFLSLTQIIAQTDLLATVTYEAAQLLQAAGKVHIYPVPFPIPQFPVMQYWHERAHHDRGNQWLRGEIRGL. 298
389 1.000e-76gi|817530119|gb|KKO73518.1| LysR family transcriptional regulator [Kerstersia gyiorum]  clstr ali  28  92FDPQTAERQFRLCMTDGSMLTLLPRILAHLRLQAPQVKLKAIKI-NARTPRLLESGEADLALGFVPT---LATGFYQQALFDQVWVCLVNPDHPVIGKRLDLETYAQARHIEI-PGGTGHAMLADALARHQIMRRVALEIPVYLGIPAIISSSDLIATVPSLTGHTLARRSGLSIHPCPVPVPPFTVMQYWHERVHLDAGHRWLRQAVHEV. 297
390 2.000e-76gi|503993760|ref|WP_014227754.1| LysR family transcriptional regulator [Klebsiella oxytoca]  clstr ali  26  91FDPATAAQTWRVAATDYMASAILLPVLSTLRIASPASRLALFELQPARLVQQADRDEVDL---FFHTRDGAPPGLHQRLLFRERYVLAGRAGHPALRSALSLAQFCQLEQVIVSPDGGGFAATDSALANLGLARRVVLSVPHFLFMLETLRNSELVAVLPERLVR---GAGGLTVVEPPLAVAGFEMLMLWHERWHRDPAHRWLRQQIV... 294
391 2.000e-76gi|656275604|ref|WP_029221260.1| transcriptional regulator [Xanthomonas cassavae]  clstr ali  28  90FDPSTARQTFTVAATDYALRAIAVRLLSALKQHAPHMRMALMPVEDGRMPMQFERGEIDVAL---VTPDGAPPDLHFRNLFVERYVCVLRNDHPALRERLTLDQFCALDHALVSYSGDSFGVSDDALEALGRQRTVSLSVKSFLILPEILRASDMVALLPSRLVQ---DMHGLTVFDPPFDVPGFTKIAVWHERTHLDPAQRWLRELLFTV. 297
392 2.000e-76gi|516093522|ref|WP_017524102.1| hypothetical protein [Pusillimonas noertemannii]  clstr ali  29  86FDPSTSRRLFTIRTRDVGEVVCFPQILQDVAEAAPSIRLRTTFQPIDDTLVGLASGRMDLALGFLP---SLETGIHRRPLFKQDYVCVVRKGHPLARSTLSRERFCEQDHLLVEYSGSGHQVIERGLLDAGLRNQIRIRLPQYLSAPHFILTSDLVWCAPAALAEKLARYYPLVLKPVPITLPAFEIALYWHDRFHRDTANQWLRDVVA... 291
393 2.000e-76gi|495728103|ref|WP_008452682.1| LysR family transcriptional regulator [Janthinobacterium sp. HH01]  clstr ali  32  90FDPARATVRFTLALSDHPAFVMLPALLARLAQQAPGVTLRIAYTAREDALALLDAGEADAAVGV---PGGSTPRIPTLPLFEERFVCVARKGHPLAEKKMTLERFLSCQHLLVSPEGDGVGHVDVRLAQWQRRRRIAVTLPQMYAAPAIVAGSDLLATLMEGVVRASGLAGALAVLPLPLELAPVPFVLHWHRRNDAHPAQRWLREQIVQV. 299
394 2.000e-76gi|515692716|ref|WP_017125316.1| hypothetical protein [Pseudomonas gingeri]  clstr ali  26  87FDPSRSSDEFTFCLSEIGEVVFLPTLFEHLRKVAPKARIRTFGLSPRDLAEHLREGRVDMVLGYFPDLDA--PNIYQQRLFSHDLVCLIRRDHPIKDERLSLEDFCALEHLQVRDGSRSQEMYESHLAALGVERNIVLQMSHYMSTSAIIERSDLVVVLPRTVARLYAEDSAVRTIEPPVDFPSYDLKQHWHARFQKDPRHMWLRQTVREL. 295
395 2.000e-76gi|902505728|ref|WP_049596606.1| LysR family transcriptional regulator [Yersinia nurmii]  clstr ali  32  90FVPAQASQSFRIALSDYGAAIVLPGLLQRLRQQAPGIDLVVVQLSREQMVEQVLAGQLDLALGVFP---HLPAGLSSCRLFEEHFVCVADANHPLGEKRLTLDAYLAQPHLLVSMRGESVGEVEAALTDLGIRRRIAAILPHFLVAPQTVVGTDLLLTIASRVVATQPESMRLLHLELPFVVPSFDFVQIWHPRHSHKEDQRWLRQQVVE.. 297
396 2.000e-76gi|495104130|ref|WP_007828953.1| LysR family transcriptional regulator [Variovorax sp. CF313]  clstr ali  26  99FEPASATRRFRICMTDASHITLLPQLLAHVRAAAPGIVLEAARID-EQTGPALQSGQADLAIGLVP---WLESGFFQQVLYPQDWVCLVNAKHPRVGKRMGLREYRAEAHVGIS-GGTGVQLLEAALQRHRVVRRILLELPGFLGLAAIVSTTDLIATVPRQIGETLARTTGLSVFDCPVPVPPFTVKQHWHARYNQDPANRWLRGLCEHL. 305
397 2.000e-76gi|658598851|ref|WP_029754644.1| LysR family transcriptional regulator [Pandoraea pnomenusa]  clstr ali  29  96FDPARAEVTWRIAATDFTESTVVLPVLASLREVAPNTRLAIFDMSPSRLLRQAEQGVIDLA---FHTTDGAPQGLRRRTLFTERYVLAARRGHPKLRRKPTLKQFCELEHAVVSQEGGGFRATDDALAQLGMARRVVFSAPHFLFLKSVLANTDLVAMAPERLVR---DDPALQLTAAPVDVPGFEISMLWHERVHRDPAHRWIRECIA... 299
398 2.000e-76gi|947672766|ref|WP_056335371.1| LysR family transcriptional regulator [Massilia sp. Leaf139]  clstr ali  26  91FDPAGSTRRFSIAMTDVGEVHFMPALIERCRALAPLVQLSSRRAGSIALKEEMESGRVDLVIGPFDDISEA---LYQRLLFRQPYVSMVRRGHPLTVGKVDLARFAAAEHLFVDSSESPYDRINQLLEKAGIGASTRFRVPHFTAVPYIIGSSDLVVTVPQRLAERAGPPFGLAWITPPLQLPLLQTNMFWHRRYNQDPGNQWLRGMVAD.. 297
399 2.000e-76gi|398106135|gb|EJL96185.1| transcriptional regulator [Pseudomonas sp. GM16]  clstr ali  30  99FDPAQATHTWKIAATDYGESTVVLPALSSLREQAPGTRLAVIDLTPAHLVKQAEQGVFDLAL---HISEDAPPELHRRPLFAERYVLAGRVGHPGLMQAPSREQFCALEHVMVSREGGGFGVTDRALADVGLMRKVVLSVPHFLMAMSVLAATDLVAMLPSRLVR---GNPALQVVDVPLEVPGYEMAMFWGERSHRDPAHKWLREHLLA.. 303
400 3.000e-76gi|970479531|ref|WP_058757196.1| LysR family transcriptional regulator [Pantoea dispersa]  clstr ali  27  91FDPARAELTWRIAATDYMSSALILPALKLIREAAPRSRMAVFALNPPQVAQQLEKGELDV---VFHTGDNAPPTLHQRRLFSERYVLAGRRDHPQLQQPLTLDRFCQLEFVMVSPDGGGFAATDRALARLGRTRRVALSVPHFLFMLDTLASGDLVAVLPERLVRN---APQLTVLAPPLEIEGFDILMLWHERLHRDPAHQWLRQQIVA.. 295
401 3.000e-76gi|737838682|ref|WP_035805980.1| ABC transporter substrate-binding protein [Cupriavidus basilensis]  clstr ali  25  93FNPLTAERRFSLCMTDMGELVFLPPLIAQLRKAAPRCTLRTLQLPLQQIPQALEAGDADLALGSM---QTMPQGLYRQQLFTHPFVTLVAKRNRKVGTALTLAQFQAMPHVVVTLTGKRNEAYDRVLDDMGIRRNIYLITPHFLVVPLILQNPDMVATVPRELGTVFSRYNAVRVVAPPLSLPRFALRQHWHPRFHHDEANVWLRQLI.... 298
402 3.000e-76gi|299069061|emb|CBJ40312.1| HTH-type (HTHLYSR) transcriptional activator [Ralstonia solanacearum CMR15]  clstr ali  28  103FEATTSTRTFTIAMSDVGEVYFMPVLAQLCVEQAPGVRIDTVRAGAFDMKAGMASGAIDLAIGAFDDLSG--ESVFQRRLFQQDYVTMFRRGHPLEAGRLTLERFRAASHLVVASSASPYNAIGPLLDKAGISQSARFSVPHFVAVPYIVSTTDLVVTVPRKLAERAAPPFGLQFVPPPLKLPALQTNVFWHRRFHQDAGNQWLRNLVA... 313
403 3.000e-76gi|817528927|gb|KKO72389.1| LysR family transcriptional regulator [Kerstersia gyiorum]  clstr ali  28  87FDPQRSSRRFRMAMSDIGVMVFLPELMEQLHTEAPRLQLEIRDVPLEDLPQALRDGEIDLAIGNL-------AGLRQQHLFHEHYCCMGRRGHPLASGKLTRAQYRKLDHILVDSRGSSHRALDGILAEAGVPRRPALTLPHFSAAAEIARRTDLILTLPYRAALWLNRNEAFDILPVPVALPPLQVTVHWHPRFDTDPGTVWLRQRVITL. 295
404 3.000e-76gi|496340774|ref|WP_009049952.1| LysR family transcriptional regulator [Pseudomonas chlororaphis]  clstr ali  26  89.DLQRLVHTFTLRSSDGFVENFGPALVARLRAEAPGVRLHFLQKTSKDS-TALRDGTVDLDTGVVD--ANASPEIHTRALFRDRFIGVVRNGHPLSRGPISAARYAAGEHVLVSRQGPGRGLVDDALQAVGLARDIATVVGGFSAALALVRASDLIAAVPERHTHNL--RSGLHSFALPVATPEITVSMLWHPRMNSDPAHRWLRDCVREV. 293
405 3.000e-76gi|953984713|ref|WP_058069608.1| LysR family transcriptional regulator [Pseudomonas sp. TTU2014-080ASC]  clstr ali  30  90FNPAQANKVFRISMTDLTEAIVLPPLFQRLRRHAPNVKIESMLARRRETTKELAAGRLDFAV---DAPLNTDPQVRHVKLMEDRYICAMRQGHPLAKEIISLDEYLGLTHIHISTRRNGLGHVDLALGRLGLQRNIALRSQHYLMATTVLETTDMVMTVPERFARR----NGLHFVELPIDMQTLETHLYWHESTDQDPANRWMREQIIDIS 295
406 3.000e-76gi|505759257|gb|EOR03349.1| hypothetical protein F896_03459 [Acinetobacter sp. CIP 110321]  clstr ali  25  90FDPKTSTYQFRISMTDISHLVFLPRLMNYMRLHAPSIRLEILPIDS-QTAPMMSNGDIDLAIGFLPQ---LEAGFYQQTLFQQHYTCIASQQHPRLTGTLSASAFAQELHVDILATG-GHYVVEHELQKHGVNRNILVRLPSYLGVGLIVRDTDTIATIPHYLAQVFMTQGGLKTFEPPYNFPQFSVKQHWHSRVHQTPSNQWLRQICFKL. 296
407 3.000e-76gi|937361998|ref|WP_054581216.1| LysR family transcriptional regulator [Acinetobacter equi]  clstr ali  28  87FDPRTSNQQFNISMTDISHLVLLPKLINYLQVHSPNIRINIVPIDN-NTQRLMESGDIDLAIGFLPQ---LEAGFYQQTLFNQHYVVIANAEHPRLRERITVEQYSQELHIDILATG-GHYVVEHELQKLGIKRNTSVTLPSYLGIGLVIQETDAIATIPNYLSHVLLSRGRLKIIELPFNFAKYEVKQHWHSRVHNNPSNQWLRRVCFSL. 293
408 4.000e-76gi|947392125|ref|WP_056058102.1| hypothetical protein [Acidovorax sp. Root402]  clstr ali  27  90FDPATSTRTFSILTPDIGESNHIPRLLSLLSAEAPGVNIKVLSMPRHAAFEALEAGVVDLAVGYFPDLHR--EGLFVQRLFRNEHFCMVRRDHPVIGEKLSLKQFMAADHATVRPEGREH-VFEHYLHARGIQPRVRLEVAHFMSLLPIISTSDLIATVPRDLAEVCVRYGNIRMLPTPFKVPAIEIHQFWHPRVHKDIANQWLRGAMRRL. 297
409 4.000e-76gi|511759328|ref|WP_016392547.1| LysR family transcriptional regulator [Pseudomonas plecoglossicida]  clstr ali  32  90FDPAQAQRRFRLSLSDYSSRIVLPPLVRHLRRVAPGVELAISQASRETMLAQLQDGELDLALGIFPE---LPLDIAAQTLFEDSFISVADRQVLPAKGGLALDDWLARPHVLMAMRPDAHDEIERALAAQGLRRRIALALPHWSAAVEVLGGTDLVLTVAQRAVGSLRPYQTLRQFEPPLPIPTFAYQQAWHARKDSDPGHRWLRKAVWACS 298
410 4.000e-76gi|738186922|ref|WP_036143035.1| LysR family transcriptional regulator [Luteibacter sp. 9135]  clstr ali  27  92FDPARSDRTWRIAAFDYSEFTVLLPALAELRATAPAIRLAVTQSAPAQVARRAEQGDIDLA---FLIGSEASPDLRCRPLFTERYVLAGRADHPQLKRCPTLAQFCKLDQVIVSPDGGGFGATDAVLAERGMHRRVVLSVPHFLFMSAVLASTDLVAMVPSRLVRDNAM---LRVVEPPVDVPGFDMLMLWPERVHRDPGHQWLRERIA... 295
411 4.000e-76gi|495644698|ref|WP_008369277.1| LysR family transcriptional regulator [Pseudomonas sp. M47T1]  clstr ali  28  92FDPATAQRRFRLCVSDASHITLLPRVLAHLRKAAPGIRLEAARID-GNTERALESGEADLAVGFVP---WLGGGMYQQVLFPQDWVCLSGPEHPRIGARLDRAGYRAEGHVQITA-GTGQKLFESALTLQGIERRIILELPGFLGLGAIIGTTDLIATLPRHIGETLAAMHGLTVHDCPVAIEGFSVKQHWHARYHLDSGNRWLRGVMIEL. 297
412 4.000e-76gi|1011618465|ref|WP_062468973.1| ABC transporter substrate-binding protein [Variovorax boronicumulans]  clstr ali  29  93FEPALARRTFTLCMTDMGELVFLPPLLERFKKEAPGCSLRTLQVPLEQVEGLLASGEADLAVGSI---RAAPEGLFHQRLFLHSFVTIASARNKDIGATLTRERFEAMRHIVVSLTGHSAESYDKVLEDQGIRRTVAVMTPHFLMVPLLMRHADLLATVPRELAEVFARMGTVRMFEPPVPVPQFQLNQHWHPRFHHDPAVVWLRDVM.... 298
413 4.000e-76gi|759517753|ref|WP_043238187.1| LysR family transcriptional regulator [Bosea sp. LC85]  clstr ali  31  89.DLQRLVRTFSVRASDGFVEAFGPELIASINAEAPGIRLRFVQKLDKDS-TLLREGGVDLETGVIGPAQS--PEIRTRALFSDHFVGVVRRGHPLAGGEITPDRFAAGRHIFVSRRGLDSGPIDEALEAIGLRREIATIVTGFSPALSLARGSDLVAVVPERHTRTL--RDGMVTFPLPVAVPEITVSLLWHPRLDADPAHRWLRECVRRV. 293
414 4.000e-76gi|544802856|ref|WP_021220020.1| hypothetical protein [Pseudomonas alcaligenes]  clstr ali  33  89.DLQRLVRTFTLRVGDGFVENFGPALIERMGAEAPGVRLRFVAKTDKDSAP-LRDGSVDLDTGVVG--ADAGPEIRTRALFQDRFVGVVRQGHPLTRGAITAERYAGGRHVLVSRRGKDRGPVDDALKAAGLERDVVTLVGGFSAALALARATDLIATVPERHSGSL--RAGLFSFPLPLDVEPIKVSMLWHPRMDADPAHRWLRECVR... 291
415 4.000e-76gi|517220744|ref|WP_018409562.1| hypothetical protein [Methylocystis rosea]  clstr ali  32  91FDPAQSRRRFVIAATDYMDLLVLPPLVERIALGAPGIDIHVKRTELPFPEADLEHNDLDVVLG-FDAILKPPAYLSRTKLFEDRMACVVCRQHTVGKGRLTLEEYVSRKHMLISRTGTRVGLIDEWLAERGLARRIALIVPHFLSAPFIVAKTDMILSLPERIALDFIGLAPLKIVPIPIELPAYDLVMVWHPLHDLDPAHRWLRDQIVEVS 302
416 5.000e-76gi|761527573|gb|AJP47892.1| LysR family transcriptional regulator [Rhodocyclaceae bacterium PG1-Ca6]  clstr ali  30  90FNPAKSSRKFVISAFDIGESYLMPRLMDRLAKEAPGVTLQTTRAGAGDSLKALESGEVDFALGHLP---HLQAGFFQRRLFLQHYVCAFRRGHPMAGSTFGINEFQEADHLTIVTEGSDYELLDKIMAGQAPQRKIRLRVSHFLSTGYLLRDTNLVATIPNKLAEILCGPFGLVYVPHPITLPPTDINLLWHARSHRDPASQWLRNLLFDL. 298
417 5.000e-76gi|654511138|ref|WP_027980442.1| LysR family transcriptional regulator [gamma proteobacterium L18]  clstr ali  27  91FDPARARDTWRLAASDNSTATILLPALGGLRVQAPHTRVALLPMVPARLARQAEEGEIDLA---FHTRDDSPASLRSRVLFDERYVLVGRHDHPRLRRKPTLAQFCALEQVVVSPDGGGFGVTDSALAAQGLSRQVVLSVPHFLVVVQTLLASDLVALLPERLVR---GNPQLRVVEPPLVLPGYQMTMLWPERCHRDPAHRWLREFIA... 294
418 5.000e-76gi|738076848|ref|WP_036035673.1| LysR family transcriptional regulator [Burkholderia gladioli]  clstr ali  30  93FDPATARRAFRISMSDMAEFFFLPPLVALLEREARGIRIEVANIPVEAVSAAMRAGEIDLALGYVP---GLDAECVSQTLFVDEYVCMVRADHPLSKSRPTQEDLATLRYVYASTNGTGHRMVEQWLLELGFERDVVVRLPHFVVAPEIVTNTDLAVIFPSSIARRFNRGKALRILPLPFTLPPIEIRIHSHKQFAGDPGVAWLRETI.... 297
419 5.000e-76gi|727707350|ref|WP_033830946.1| LysR family transcriptional regulator [Stenotrophomonas maltophilia]  clstr ali  30  92FDPAQATQTWRIMASDFGETTIVLPALADLRVRAPGTRLAVVSLAPAQMVAQSERGEIDLAL---HITSDAPASLHHRPLFQERYVLAGRRDHPRLKRRPTLKQFCALDHVIVSPDGGGHGGTDSALAHVGARRNVVLSVPHFLFLRSVLLRTDLVAMMPSRLV---AQDPALKAVAAPIDVPGFEMVMLWHERVHRDPAHRWLRERI.... 294
420 5.000e-76gi|919215658|ref|WP_052771159.1| LysR family transcriptional regulator [Myxococcus fulvus]  clstr ali  31  122FDPKASSRRFILATTDYFASALLPSLLELMDTEAPLVDLVVRPLVIPQIEAQLESGELDLVVGAYPEPS---PVLRQQKLFTEHFVCVVRRDNSVVKQRLDLETFLRLPHVLMSPRGEGVGSVDIALEKLGRTRRIGVRLPYFLTAALAVTRTNHVLTAPRRLAELFVEPGNLRILPPPVELAPFDVLQVWHERFDDDPAHRWLRGMML... 327
421 5.000e-76gi|935506968|ref|WP_054427559.1| LysR family transcriptional regulator [Achromobacter sp.]  clstr ali  30  89.DLMRLERTFTLRTSDGFVENVGPILLNRIGREAPGVRLRFMQKADKDSAP-LREGEVDLDTGVV--SEAASPELRTRALFQDRFIGVVRAGHPLSGGKVTLARYANAHHILMSRRNRETGPVDDALAATGRKRHIATTVGGFSAALALARHSDLIATVPERHTGNL--RTGMHSFPLPFPMPAFTVSMLWHPRMDGDAAHRWLRGCVLD.. 292
422 6.000e-76gi|516022000|ref|WP_017452583.1| MULTISPECIES: LysR family transcriptional regulator [Herbaspirillum]  clstr ali  27  88FTPATTTRRFVLALSDIGELMLLPRLLARIRDEAPHASVATVTMAPDDLVVALESGEVDLAIGYFPDLK--KRNFFQQRLFSQDFVCLLRADHPLLAQKISLDHFLDMGHIVIKAEGRDEPMCERFLLRRKIRRRVVLSTSHCMAIPLLIASSDLIATVPRGFGEFVTRVSNVRLVEPGFEMPSLDLKQHWHRKYHKDGSNAWLRALTVAM. 296
423 7.000e-76gi|738211603|ref|WP_036167298.1| LysR family transcriptional regulator [Massilia sp. 9096]  clstr ali  23  90FEAGTSTRRFTLAMTDVGEVYFMPTLIERCRALAPNVELASSRVNGATLKDDMETGRVDMAIGAFEDVSEA---LYQRQLFRQRFVTMFRKGHPLGRGTVDLARFAAATHLIVDAAQSPYDRINTLLAKAGVQAQGRYRVPHFTAVPYIVATSELVVTVPQKLAESAAGPFGLEWIEPPLQLPTLQTNAFWHRRFNHDPGIQWLRGLIAEV. 299
424 7.000e-76gi|881067775|ref|WP_048784814.1| transcriptional regulator [Pantoea vagans]  clstr ali  28  91FDPATAELTVRIAATDYALRAVIVPFMAALRRQAPGIRVAVTPVSSQPLTAQFERGAIDIAL---ITPDSAPDGLHARALFDEEYVCLMRQDHPLAQDGLNLDSFCAQDHALFSADGSFRGVTDEALAALDRTRRVTLSVCSFLVLPEILRVSDLLSVVPRRLTRDL---PGLSVLPPPLPIPGFSKIAVWHERTHRDAGHRWLRALLFA.. 296
425 7.000e-76gi|502590027|ref|WP_012827679.1| LysR family transcriptional regulator [Haliangium ochraceum]  clstr ali  35  93FDPGRAERRFTIAVGDFAAVTLLPPLLERASREAPGIGFDVRPAEPTRLFERLATGEFDLVIG---AKLDASGDFMRQLLYRDGFVCMARRDHPLSGDALDLERYAALPHVLISPTGEGPSVVDRLLAERGKQRRIALRIPYFLAAPLMVVRSDLVLTAPRSVAGAFASTHALALFEPPLELPSFGVYQLWHQRYQSDDAHRWLRELVAA.. 300
426 7.000e-76gi|754960771|ref|WP_042316768.1| LysR family transcriptional regulator [Paraburkholderia terrae]  clstr ali  26  90FDPARSNRSFTIAMTDIGEIDFLANLMRALERVAPDVSISTVRKGESNLKDELETGAVDLAIGWLPD---LNAGMFQRRLTASQYVCAFRKGHALDKGSITLEEFARADHLVVLAPHTGHMMIEHDLGRLGVRRNVKLRIPHFAAVGHILSETDMIAALPGRLVNHSIVPFNLAWAPLPIKLDPIPLNVFWSAKYHRDPANQWLRAMMFD.. 296
427 8.000e-76gi|820900559|ref|WP_046806658.1| LysR family transcriptional regulator [Achromobacter sp. LC458]  clstr ali  31  89.DLARLTRTFTLRASDGFVENFGARLLARTAHEAPGVRLRFVQKTDKDSAP-LREGNVDLETGVVGD--AASPELRTRALFQDRFVGVVRKGHPLAASKITLARYAKARHIQISRRNRDSGPVDAALATAGRERSIATSASGFSAALALARGSDLIATVPERHTGSL--RGGMHTFALPFTMPPFTVSMLWHPRMDADAAHRWLRSCLLD.. 292
428 8.000e-76gi|538493572|ref|WP_021006890.1| LysR family transcriptional regulator [Variovorax paradoxus]  clstr ali  26  85FDAGSSRRHFRICMTDVSHLEFLPRLIHRVAQDAPSVHVEVLRIGP-DTRRLLENGEADLAVGYMPE---LEAGFYQQQLFEQGFSCVVRNDHPQVGKRMTPTLFKREKHVAITAPGTGHDLLQQQLKRLGVERRLALSLPTLPGLGNLLAQSDLVATVPERVAQMLVSIAEVKLLAPPFELPVFAIKQHWHERFHLDPANRWLRSMIAEM. 291
429 8.000e-76gi|499574377|ref|WP_011255160.1| LysR family transcriptional regulator [Achromobacter xylosoxidans]  clstr ali  29  86FCPETARRQFTIRTRDIGEVVYFPRILQKIALLAPGVRLRTTFLPIDETVTGLASGRIDLALGFLPSLETA---IHRRVLFEQHYVCVMSACHPLANEELTYDLFRAQNHLLVEYSGSGHLVIERALVEAGARNNIKLRLPQYLSAPHFIVSSDLVWCAPAVLAETLSNHYDLVIKPVPLSLPPFEIALYWHDRFHRDPANQWLRELIAS.. 292
430 8.000e-76gi|935685817|ref|WP_054502351.1| LysR family transcriptional regulator [Achromobacter sp.]  clstr ali  28  89.DPAKLSRGFTLRVSDGFVEYFGPALIALAQREAPGVRLRFVQKPDKDSTP-LRDGSADLETGVIGAASS--PEIRTRALFRDRFIGVVRAGHPLAKGKVTAARYAAGQHVLVSRRGLDKGPIDDALHALGLARQITVIVAGFSDALALARASDLIASVPERHTTNL--RAGMHSFALPVQAPGLTISMLWHPRMDADPGHRWLRDCVRQV. 293
431 8.000e-76gi|499513937|ref|WP_011200577.1| transcriptional regulator [[Mannheimia] succiniciproducens]  clstr ali  24  90FDPQTAELTLTIACTDYALRAVISPFLAVLKQRAPKIKVAILAINEQNLQSQLEQGVVDFGL---VTPDFSAPDIHSKDLYQEQYVCALRKDHPVAQGSISLEQFCRLEQALVSYQGGSFGATDKALAKLGLTRNVTVSVQNFIVMPEFLANSDLLAVVPKRLVENLA---NIHYFEPPLQIDGFTKTLVWHERTHRDPAYRWLRELMAEV. 296
432 9.000e-76gi|913461922|ref|WP_050439926.1| MULTISPECIES: LysR family transcriptional regulator [Pseudomonas putida group]  clstr ali  30  103FIAATAQRRFRLCVSDASHITLLPSILNHLRSHAPGIRLEAARID-GNTESALESGEADLAIGFVP---WLGGGMYQQVLFEQDWVCLSNPQHPRLSNGMSLERYRAEGHVQISF-GTGQKLLEAGLARAGIERRIMLELPAFLGLGMIIGTTDLLGTLPRHIGQTLADMHGLQVHDCPFEVEGFTVKQHWHARYHQDNGNRWLRDVVRGL. 308
433 9.000e-76gi|124879717|gb|EAY67073.1| Transcriptional regulator [Burkholderia cenocepacia PC184]  clstr ali  29  120FRPAGSSRNFVLCMSDIGEMVFLPRLESFLDKAAPHVSIKTVALSMPELEEGLASGDVDLAIGYFPGLNS--ESLKRKALYRHSYVCIARDDHPEIGDTLSLDQYRAAAHVMVHSEGREQDVLARTHERLGIRVNVRFSTPRFIGVPFVVAGSDMIAAVPQAVGRRFAEFVNVKLLPLPFPAPTYELYLHWHPRFHHEPANRWIRDAMSEL. 328
434 9.000e-76gi|951198184|ref|WP_057674246.1| LysR family transcriptional regulator [Curvibacter sp. PAE-UM]  clstr ali  32  92FVPGQANTTFVLAMADATAAELIPGLIAVIDREAPGVTIRVVPLTTRDPRRLLDEEAADLAIGYFPATAQAQAGFEHQRLYLSNYVCVMRRDHPLAREELTLDRYCAARHLLVSFSGRPYGFIDEALAGLGRQRHIVLTVNQFFTAGRVVATSDLLTVLPRHFVSVTGIADQLVLRELPFKVPAVHVDALWHRRLQHSGAHAWLREVLAHL. 311
435 1.000e-75gi|916784756|ref|WP_051391812.1| hypothetical protein [Rhodoferax saidenbachensis]  clstr ali  29  91FDPARDQRNFRIAMTDVGQIVILPRLLNTLAQSAPHIRVDISQVS-ADTADHLQQGALDIALGFLPDLEG---RFVQQTIFKETFACLVRQGHPRITNTLSARQYQDEQHVVVETSGTGHVIIERHLARKGLVRQIGAQIPSFIGMATVVGSTDLIATLPSRAAHILCQGSNTHVLALPVEIPGYQVRQQWHERMQRDPGHMWLRTMMAAL. 297
436 1.000e-75gi|516071775|ref|WP_017502358.1| hypothetical protein [alpha proteobacterium LLX12A]  clstr ali  29  90FDPATASLTLTLAATDYALQAVVVPFVMKLCRYAPGIRVATRPIDNDRIAQQFERGELDLAL---MTPESAPLDLHSRRLFDETYVCALRAGHPDAGGTISIERFCALDHALVSFSGGSHGVTDEALAREGRERHVALSFHSFLALAEVLRATDLIAVVPRRLA---AASDGLALIEPPVAVPGFTKLAVWHGRTHNDAGHRWVRALLFE.. 295
437 1.000e-75gi|518763641|ref|WP_019920930.1| hypothetical protein [Duganella zoogloeoides]  clstr ali  28  91FDAATSARHFRLAMTDVGEVYFMPVLIDLLRRRAPQVQVSTVRAGAIDLKTEMEAGRVDLAIGAFDD---VSASLYQRRLFEQEYVTMFRQDHALARGTPTLKRFLAAEHLVVASSESPYDRINMLLEEAGVRAAATFQVPHFTAVPYIVGSTDLVVTVPEKLAQRAAAPFQLAYVRPPLALPTLQTRLFWHRRYSQDAGNQWLRNLVAQ.. 297
438 1.000e-75gi|655967252|ref|WP_029009886.1| LysR family transcriptional regulator [Azospirillum halopraeferens]  clstr ali  30  89.DPGRLVRTFTLRNREGFVETFGPALISRIGEQAPGVRLRFVPKPDRDSAP-LRDGGIDLETGVIGDATG--PEIRARTLFRDRFVGAVRAGHPLGTGPVTAQRYAAGRHVLVSRRGHEHGPIDEALATAGLARTIATVVSSFSEALALARASDLIADVPERYAGRLCD--GMILFGLPVSLPDITVSLLWHPRMDADPGHRWLRECVREV. 293
439 1.000e-75gi|491020702|ref|WP_004882405.1| MULTISPECIES: LysR family transcriptional regulator [Pseudomonas syringae group]  clstr ali  29  93FEPASSQRTFNLAMSDYGAAIVLPRLLVRIRKQAPNTTVVVTQGSRPGMLEQVTQGKIDLALGVFP---GLPADIAQSTLFEETFSCLLDRKTLPSNGVLDLDSYLMRPHISVSMDGSI-GEIDNLLRAQGLHRRIAVSVPHWRTAPRMISQTDLILTVATRTLDEAEVDDTLIKLSPPLAIPPFPFVQIWHHRFNEDPAHKWLREQVEQV. 299
440 1.000e-75gi|914744949|ref|WP_050705531.1| LysR family transcriptional regulator [Pseudomonas sp. 250J]  clstr ali  31  92FDPARAQLTWRVAATDYTEATILLPALGALRAAAPGTRLAIVDMNPPTLVRKAEQGELDLA---FHIAIDAPPGLRQRPLFTDRYVLAGRVDHPRLRRRPTLKQFCALEHVIVSPDGGGFGPTDDALAEQGLARNVVLSVPRFSGVAPMLLDSDLVAMLPQRLV---IGNPALAVVEAPLAVPGFEMLMLWPERVHRDPAHQWLREQLA... 295
441 1.000e-75gi|489264101|ref|WP_003171931.1| LysR family transcriptional regulator [Pseudomonas fluorescens]  clstr ali  31  93FDAASSQRTFQLAMSDYGAAIILPKLLVRLRSEAPNTTLVVTQGSRHAMFEQVAQGKIDLALGVFP---SLTTDVSMEVLFEESFSCLLDRRTLPKDGVLDLESYLERPHIQVSMDGGANGEVDSLLRAEGMRRRIAVSVPHWRTAPSLLHHTDLILTVATRTLEDTLLNPDLVQLSPPFNIPRFPFVQIWHQRFRDDPAHAWLREQVKQV. 300
442 1.000e-75gi|518801789|ref|WP_019957743.1| hypothetical protein [Vitreoscilla stercoraria]  clstr ali  25  88FNPAVSSQEFCLSMTDISHLQMIPKLVEYLKHHAPHIRINVVPI-NSNLPGLMSTGEVDLAIGFIPQ---LEAGFYQQTLFKQHYVALVSKYHPRIQGELSVEAYLNENHIEIVPHGTGHYLVESELRKMGLKRNVVVKLPSYLGVGLVIQETELIATIPERLSHLLLSRGHIKALPLPYALPTYSVKQHWHERMHNSPENQWLRQVCFQL. 295
443 1.000e-75gi|695671187|ref|WP_032627766.1| transcriptional regulator [Pseudomonas syringae]  clstr ali  26  91FDPLTANMIVKLASTDYALRAIVVPFLSALRQLAPNIRVSVLPIDNQGLQLQLDRGDIDLAL---VTVEAAASGLHAKLLFEESYVCVMRSDHPDAKKKLSLDRFCALDHILVSPSGGRFGVTDEALRKIGKSRRVTVSVTSFLVLPEILRVSDLIAVVPRRLA---VHDDGLTVLEPPVEIPGFSKMLAWHERTHHDAGYRWIRTLMMNI. 297
444 1.000e-75gi|755682011|ref|WP_042553747.1| LysR family transcriptional regulator [Pseudomonas fulva]  clstr ali  29  90FNPAQANKTFRISMTDLTEAVVLPPVFQRLRRQAPSVTIESMLVRRRETTKELAAGRLDFAV---DAPLNIDPQVRHVKLMEDRYVCAMRHGHPLGNEKLSLEKYLSLTHIHISSRRSGLGYVDLALGKMGIQRRIALRSQHYLMACRVMRDTDMAITVPERFAR----DNDLHFSELPVAIPLLETHLYWHESTDQDPANRWMREQIIEI. 294
445 1.000e-75gi|500027060|ref|WP_011707778.1| LysR family transcriptional regulator [Aeromonas hydrophila]  clstr ali  30  104.DPARLERTFTLRASEGLVELFGAALLSRLAAEAPGVRLHFLAKPDKESGP-LRSGELDFETGVI--SATTAPELRTQALFQDHFVAVLRPGHPLCDGPLTASRYAEARHVLVSRRGQPHSPVDEALAKLGLTRTVTTLVPGFATALALVRGSDLVATVPEHHCAAL--LGDLVARPLPFTLPGIRVALLWHPRLDADPAHRWLRTLIRDI. 308
446 1.000e-75gi|500127541|ref|WP_011803546.1| LysR family transcriptional regulator [Acidovorax sp. JS42]  clstr ali  31  92FDPASAQTTFVLAMADATGATLIPPLIEIVEREAPGVSLRVVPLTTRDPRRLLDEESADMAVGYFPTARAQSDNVVAHRLYDSQYVCVMRADHPLAAVPMTLDLYCAARHLLVSFSGKPFGFIDGALAALGRERRIVLTVNQFFTAGRVVATTDLLTVLPRHFVGVASVRDELVWRPLPMTLPPVHVDALWHRRRNHDPAHRWLREAIA... 309
447 1.000e-75gi|737047793|ref|WP_035043003.1| LysR family transcriptional regulator [Caulobacter henricii]  clstr ali  31  89.DLQRLARTFTLRTSDGFVENFGPDLIARLAAEAPGVRLRFVQKLDKDSAP-LRDGEVDLETGVVGKTTG--PEVRAQLLFRDRFVGVVRTGHPLSQGEVTAARYATGRHVGVSRRGLDRGPVDEALALLGLEREIATVVGGFSTALALARASDLIATVPERHTGKL--RAGLYSFMLPMPSPEIAISMLWHPRLDADPAHRWLRGCVRDV. 293
448 1.000e-75gi|500599435|ref|WP_011960012.1| LysR family transcriptional regulator [Psychrobacter sp. PRwf-1]  clstr ali  30  88FEPKNSSRRFHISMTDISHMIIVPKLIKYLKQHAPHTKLDISAINSDTPSR-MSSGEIDLAIGYIP---HLEAGFFQQTFFEQHYSVVVRQDHPRLTQTLTLEAYQQEQHADVISSGTGHYLLEDHLRRRHIKRHIAITLPTYLGVGLIIQQTDLVATLPDKLAKLLLQENRLHTLPLPLDIPKYQVKQHWHERMHANPDNQWLRQVCYAL. 295
449 1.000e-75gi|516891429|ref|WP_018150862.1| hypothetical protein [Leeia oryzae]  clstr ali  30  89.DLKTVKRTFTLRTSDGFVENFGPRLVSRVNEAAPGIRLSFMPKTNKDSAP-LREGLVDMDTGVIGE--NTSPELRVRALFRDRFIGVVRQGHPLCQGEITAARFAAGRHIMVSRRNLDKGPVDDALQASGLAREVSIIVGGFSSALALVRETDLIATVPERHTGYL--RAGLFSFALPVNIPDITLSMIWHPRQDADPVHQWLRQCLKDV. 293
450 1.000e-75gi|501198445|ref|WP_012241463.1| nodulation protein D [Sorangium cellulosum]  clstr ali  30  150FVAASAARSFSVATADYGSFVLAPKLLDRLGREAPNVDLWLRALDASF-EEQLARGDADVVV-APARRDGLPAGIHSRLLYRERFACLVRKGHPLVKKGIDLASWTSMRHVFIAPRGTPGGVVDETLAQLGKRRRVALAVPHFLLAPHVVAGSDLVVTVGARVAEAFAEILPLRVVDPPVKLPGFEVRMYWHERHHRDPAQQWFRDAVR... 356
451 1.000e-75gi|827453379|ref|WP_047213457.1| LysR family transcriptional regulator [Pandoraea thiooxydans]  clstr ali  28  91FDPARTEMTWRVAASDYGQSAIVIPLLARLRRLAPGIRVAVHTLVPGEIAHLAERGEIDAA---FMTSYTVPQSLRGRVLFAERYQFIARKRHPQLRGPLTLAQFCGLDHVLVSPDGGGFGPTDVLLEARGRRRRVVLSVPHFLIQLESVRHSDMVAMLPARLLD--GRLQGLQTCDPPVQPPGFEIAMAWHERVHADPAHAWLREQVVQ.. 296
452 1.000e-75gi|921318693|ref|WP_053253018.1| LysR family transcriptional regulator [Ensifer adhaerens]  clstr ali  28  89.DLSRLTRTFTLRTSEGFVENFGPDLLRRIGAEAPGVRLRFLPKPNKES-SALRDGSVDLETGVIG--LATGPEVRTQALFRDRFIGVVRKEHPLSQGLVTSAGYAGGRHVLVSRRGLDKGPIDEALEKLGLERQIVTTVGGFSAALALARGSDLIASVPERHTGNL--RAGMHSFPLPVSVPEVTISMLWHPRLDADPAHRWLRACVRDV. 293
453 2.000e-75gi|489547636|ref|WP_003452278.1| LysR family transcriptional regulator [Pseudomonas pseudoalcaligenes]  clstr ali  30  90FDPSRAERTFRLAMSDYGARVVLPGLVRTLRQMAPGVELAVSQASREAMLADVMDGETDLALGVFPDPG--PASLRSQTLFTESFACLADASTLPESGVLSREAWLARPHVLVAVRAAADGEIDPVLALEGLSRRVSVLLPHWSVANELIAGTDLVLTVARRNLAGIDADPRLKVFEPPLAIPPFDFRMVWHPRRDPDPAHGWLRQLVTDL. 298
454 2.000e-75gi|594026347|gb|AHL74350.1| LysR family transcriptional regulator [Pseudomonas stutzeri]  clstr ali  28  90FDPSTTDRQFHVLTPDIGEINFLPKLLIHFAAHAPNARVKTVSMPKHAAADALESGAVDLALGYFPDLQ--KAGFFQQRLFCNEYVCIVRRDHPDIGQTLTLEQFLSAKHAVVHPEGREH-LFEKFLLAEGVKRAVHLEVSHFMSLLPIISTSDLIATVPHDLAEACIRNGNIRMLPSPIKAPIIELQQLWHRRYHRDAAHAWLRKSVHSL. 299