current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}, from SCOP206

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst NCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTLast
1 -2.700 VFG043734(gi:23574040) (cdtC) cytolethal distending toxin C [CDT (VF0185)] [Escherichia coli O157:H str. 493/89]  ali follow..  16  88....PNTDQCLGTPDGKNLLKMTCNQTDKKTLFSLIPSTT 123
2 -1.970 VFG000994(gi:31983573) (ipgF) type III secretion system protein IpgF [TTSS (VF0118)] [Shigella flexneri 2a str. 301]  ali follow..  85SHPCLSAAKLLNEFMMMYGRGWEAVGAYNAGTSPKKKKER 127
3 -1.880 VFG001874(gi:52841589) (lspJ) general secretion pathway protein J [<  ali follow..  4....NKGFTLIEILIALTVFAILATITSSTLYYAFNTRTR 39
4 -1.800 VFG013418(gi:16273103) (gmhA/lpcA) phosphoheptose isomerase [LOS (CVF494)] [Haemophilus influenzae Rd KW20]  ali follow..  27  50...CGNGGSHCDAMHFAEELT................... 67
5 -1.560 VFG001932(gi:15791467) (cdtC) cytolethal distending toxin C [CDT (VF0115)] [Campylobacter jejuni subsp. jejuni NCTC 11168]  ali follow..  88....KESDLCLAILEDGTFGAKSCQDDLKDGKLET..... 118
6 -1.550 VFG001991(gi:52841448) (flgB) flagellar basal body rod protein FlgB [Flagella (VF0157)] [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]  ali follow..  14  80...................YRMTHHASLDGNTVDKDMETT 100
7 -1.550 VFG043331(gi:52841456) (flgJ) flagellar rod assembly protein/muramidase FlgJ [polar flagella (AI149)] [Legionella pneumophila subsp. pneumophila str. Philadelphia 1]  ali follow..  177...........DGSSSNNLFNIKTGSHSEVESIQVKTTE. 204
8 -1.530 VFG000465(gi:16764449) (sopB/sigD) type III secretion system effector SopB, phosphoinositide phosphatase [TTSS(SPI-1 encode) (VF0116)] [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  13  446..................AMLAHEIDAVPAWNCKSGKDRT 467
9 -1.530 VFG000992(gi:31983575) (ipgD) type III secretion system effector IpgD, phosphoinositide 4-phosphatase [TTSS (VF0118)] [Shigella flexneri 2a str. 301]  ali follow..  13  425..................TLLAYTIGAVPCWNCKSGKDRT 446
10 -1.530 VFG000517(gi:16764767) (ssaP) type III secretion system needle length regulator SsaP [TTSS(SPI-2 encode) (VF0321)] [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  36  67............................DGVECEVCESG. 77

FFAS is supported by the NIH grant R01-GM087218-01
9 9 7 8 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. FATCAT: a web server for flexible structure comparison and structure similarity searching. Nucleic Acids Res. 2004 Jul 1;32(Web Server issue):W582-5.