current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}, from SCOP206

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst FVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQHVGRDAHAWMIGQLKGLDLast
1 -13.900 VFG000441(gi:17233493) (spvR) Salmonella plasmid virulence: regulation of spv operon, lysR family [Spv (VF0107)] [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  85IGPTGKTKQLEIIFDEIYPGSLKNLIISALTISGQKTNIMGRAVNSQIIEELCQTNNCIVISARNYFHR---ESLVCRTSVEGGVMLFIPKKFF-LCGKPDINRLAGTPVLFHEGAKN-DTIYHFFEQTLGITNAFSFDNVDLFSSLYRLQQGLAMLLIPVRVCRALGLS---TDHALHIKGVALCTSLYYPTKKRETPDYRKAIKLIQQE. 291
2 -8.830 VFG001983(gi:15792250) (pebA) bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein [PEB1 (VF0327)] [Campylobacter jejuni subsp. jejuni NCTC 11168]  ali follow..  10  55.DQATGEIKFEVDVAKLLAKSIL----------GDDKKIKLVAVNAKTRGPLLDNGSVDAVIATFTITPERKRIYN----FSEPYYQDAIGLLVLKEKKYKSLADMKGANIGVAQAATTKKAIGEAAKKIGIDVKF-SEFPDYPSIKAALDAKRVDAFSVDKSILLGYVDDKSEILPDSFEPQSYGIVT----KKDDPAFAKYVDDFVKEHK 247
3 -6.230 VFG044083(gi:15597454) (ptxR) transcriptional regulator PtxR [pyoverdine (IA001)] [Pseudomonas aeruginosa PAO1]  ali follow..  12  97...GEPSGRLRITAPQDFVKWHISSVSAAFIRQFPKVQVEMLADDQ---FSDLVGQRIDLAVRI----WPRDSGLHASKLCDFQQVAVATPGYLAGLPPVLQPHDLARCEWIGHTSTPWTWTFERQRERATVQTRGRLLANNTLAVYRLVLDGAGVSVLPSFLVAREIARGRLVRLLPGWRLPQGGIYALYPSARYMPVRVRAFIESLRE.. 299
4 -5.900 VFG042522(gi:33469481) (csdD) CS19 fimbrial ahesin CsdD [coli surface antigen CS19 (AI032)] [Escherichia coli O114:H- str. WS0115A]  ali follow..  19  191...GNYTVNITVDLTDKGNIVWLPGF-----HSNPRVDLNLHPIGNYKYSG---SNSLDMCFGYSTNSDSMVIKFQDDN--SSEYNLYKIGGTEKLPYAVSLLMGGKIFYP---VNGQSFTINDSSVLETNWNRVTAVAMPE-VNVPVLCWPARLLLNADVNAPDAGQYSGQIYITFTP................................. 358
5 -5.850 VFG042509(gi:46369887) (csbD) CS17 fimbriae minor subunit [coli surface antigen CS17 (AI030)] [Escherichia coli O8:H9 str. WS6788A]  ali follow..  19  191...GNYTVNITVDLTDKGNIVWLPGF-----HSNPRVDLNLHPIGNYKYSG---SNSLDMCFGYSTNSDSMVIKFQDDN--SSEYNLYKIGGTEKLPYAVSLLM---GEKIFYPVNGQSFTINDSSVLETNWNRVTAVAMPE-VNVPVLCWPARLLLNADVNAPDAGQYSGQIYITFTP................................. 358
6 -5.640 VFG042458(gi:145511) (cfaE) colonisation factor antigen e [Colonization factor antigen I fimbriae (CFA/I) (AI018)] [Escherichia coli str. E7473]  ali follow..  17  188...GTYTINITVNLTDKGNIIWLPQF-----KSNARVDLNLRPTGGGTYIG---RNSVDMCFGYSTNSSSLEIRFQDDNSKSDGKFYLKKINDD--SKELVYTLSLLLAGKNLTPTNGQALNINTASLETNWNRITAVTMPE-ISVPVLCWPGRLQLDAKVKNPEAGQYMGNIKITFTP................................. 355
7 -5.550 VFG045340(gi:17987019) (ricA) Rab2 interacting conserved protein A [RicA (VF0414)] [Brucella melitensis bv. 1 str. 16M]  ali follow..  14  3..........................IYAYNGHKPQFA-NWIAPDATLIGKVVVGENAGFWFGAVLRGDNEPITIGADTNVQEQTIMHTDIGFPLTIGAGCTIGHRAILHGCTIGENTLIGMGAIVLNGAKVGKNCLIGAGTLVKEGMEIPDNSLVVGSPARVLRQLDDA.......................................... 149
8 -5.380 VFG042474(gi:15419715) (csaE) minor pilin protein CsaE [coli surface antigen CS4 (AI022)] [Escherichia coli O25:H42 str. E11881A]  ali follow..  18  188...GTYTINITIKLTDKGNIIWLPQF-----KSDARVDLNLRPTGGGTYIG---RNSVDMCFGYSTNSSSLEIRFQDNNPKSDGKFYLRKINDDTKEIAYTLSLLLAGKSLTPT-NGTSLNIADAASLETNWNRITAVTMPE-ISVPVLCWPGRLQLDAKVENPEAGQYMGNINVTFTP................................. 356
9 -5.100 VFG000368(gi:16122164) (ybtS) salicylate synthase Irp9 [Yersiniabactin (VF0136)] [Yersinia pestis CO92]  ali follow..  12  220....TPVRSFMFRQEGREALGFSPELVMSVTGN----KVVTEPLAGTRDRMGNPEHNKAKEAELLHDSKEVLEHILSVKEAIAELEAVCQPGSVVVEDLMSVRQRGSVQHLGSGVSGQLAENKDASITASGIPKNAALNA--YSGAILLLDDTRFDAALVLRSVFQIQAGAGIIAQSTP................................. 414
10 -4.920 VFG009561(gi:57116981) (mbtI) Isochorismate synthase MbtI [mycobactin (IA031)] [Mycobacterium tuberculosis H37Rv]  ali follow..  13  232....TPVRSFLLQLGGIRALGYSPELVTAVRADG---VVITEPLAGTRALGRGPAIDRLARDDLESNSKEIVEHAISVRSSLEEITDIAEPGSAAVIDFMTVRERGSVQHLGSTIRARLDPSSDRAVTASGIPKAAGVEA--YSGAVVMLSADDAALTLRAAYQVGLRAGAGIIEESEP................................. 428

FFAS is supported by the NIH grant R01-GM087218-01
1 1 7 8 9 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zhang B, Jaroszewski L, Rychlewski L, Godzik A. Similarities and differences between nonhomologous proteins with similar folds: evaluation of threading strategies. Fold Des. 1997;2(5):307-17.