current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d4io2a1 c.94.1.0 (A:3-248) automated matches {Adineta vaga [TaxId: 104782]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
# Score Template Links and tools%idFirst ARLKGITLRIGVIESVPFTIVANVIDTSGRNTTKLTGYVLDLIEYLRDKMGFVADVQLAPPNTSYTGLVLALANGDYDIAIGDITVTSARREIVAFSNSISDNSMRILMRKGTLIDGMDDLKNGKIPYNRIGIRIGTAGEDYYLREISGGSRNFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCNLTLVGEDFDKSTFGIVTPKEWLYAKDLDVNILSLRETGILDNLKKKWFQTKACPLast
1 -118.000d4io2a1 c.94.1.0 (A:3-248) automated matches {Adineta vaga [TaxId: 104782]}  ali model 3D-neighbors  100  1ARLKGITLRIGVIESVPFTIVANVIDTSGRNTTKLTGYVLDLIEYLRDKMGFVADVQLAPPNTSYTGLVLALANGDYDIAIGDITVTSARREIVAFSNSISDNSMRILMRKGTLIDGMDDLKNGKIPYNRIGIRIGTAGEDYYLREISGGSRNFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCNLTLVGEDFDKSTFGIVTPKEWLYAKDLDVNILSLRETGILDNLKKKWFQTKACP 246
2 -86.900d4f3pa1 c.94.1.0 (A:26-247) automated matches {Burkholderia pseudomallei [TaxId: 320372]}  ali model 3D-neighbors follow..  22  1.....KELVVGTDTSFMPFEFKQ--------GDKYVGFDLDLWAEIAKGAGWTYKIQ----PMDFAGLIPALQTQNIDVALSGMTIKEERRKAIDFSDPYYDSGLAAMVQANNTIKSIDDLNGKV-----IAAKTGTATIDWIKAHLK--PKEIRQFPNIDQAYLALEAGRVDAAMHDTPNVLFFVNNEGKRVKVAGAPVSGDKYGIGFPKGSPLVAKVNAELARMKADGRYAKIYKKWFGSEP.. 222
3 -85.500d4dz1a_ c.94.1.0 (A:) automated matches {Salmonella enterica [TaxId: 28901]}  ali model 3D-neighbors follow..  17  2..VEGRTLNVAVSPASPPMLFKS-------ADGKLQGIDLELFSSYCQSRHCKLNI----TEYAWDGMLGAVASGQADVAFSGISITDKRKKVIDFSEPYYINSFYLVSMANHTLNNLNELNKYS-----IGYPRGMAYSDLIKNDLEPKGSKVKLYPTYNETMADLKNGNLDLAFIEEPVYFTFKNKKKMPIESRYVFKNVDQLGIAFKKGSPVRDDFNLWLKE-QGPQKISGIVDSWMK..... 229
4 -84.900d2pvua_ c.94.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  19  1.GATKKKVVVGTDAAFAPFEYMQ--------KGKIVGFDVDLLDAVMKAAGLDYELK----NIGWDPLFASLQSKEVDMGISGITITDERKQSYDFSDPYFEATQVILVKQGSPVKNALDLKGKT-----IGVQNATTGQEAAEKLFG-KGPHIKKFETTVVAIMELLNGGVDAVITDNAVANEYVKNNPNKLQVIEDPFASEYYGMIFPKNSELKAKVDEALKNVINSGKYTEIYKKWFGKEP.. 228
5 -83.500d4kqpa_ c.94.1.0 (A:) automated matches {Lactococcus lactis [TaxId: 272623]}  ali model 3D-neighbors follow..  19  1ATPKKDVYTIASDNSFAPFEFQN-------DDKQFTGIDVDLLNAIAKNQGFKLKWN----FIGFQAAVDSVQSGHADGMMSGMSITDARKQVFDYGSPYYSSNLTIATSSTDDIKSWKDLKGKT-----LGAKNGTASFDYLNAHAKEYGYTVKTFTDATTMYSSLNNGSINALMDDEPVIKYAIKQGQ-KFATPIKPIPDGQYGFAVKKGSELIEMFNNGLANLRANGEYDKIIDKYLESDA.. 230
6 -83.400d3delb1 c.94.1.0 (B:34-257) automated matches {Chlamydia trachomatis [TaxId: 813]}  ali model 3D-neighbors follow..  17  1.....EKFIVGTNATYPPFEFVD-------KRGEVVGFDIDLAREISNKLGKTLDVR----EFSFDALILNLKQHRIDAVITGMSITPSRLKEILMIPYYGEEIKHLVLFKGENKHPLPLTQYRS-----VAVQTGTYQEAYLQSL---SEVHIRSFDSTLEVLMEVMHGKSPVAVLEPSIAQVVLKDFPAATIDLPEDQWVLGYGIGVASDRALALKIEAAVQEIRKEGVLAELEQKWGLNN... 224
7 -81.000d2pyya_ c.94.1.0 (A:) automated matches {Nostoc punctiforme [TaxId: 63737]}  ali model 3D-neighbors follow..  21  2.......LLVATR-VIPPFVLSN--------KGELSGFSIDLWRSIATQIGIESKL---IEYSSVPELISAIKDNKVNLGIAAISITAEREQNFDFSLPIFASGLQIMVRNTGDIRSIDDLPGKV-----VATTAGSTAATYLREH----HISVLEVPKIEEAYKALQTKKADAVVFDAPVLLFYAANEGKKVEIVGSILREESYGIILPNNSPYRKPINQALLNLKENGTYQSLYDKWFD..... 219
8 -80.300d4prsa_ c.94.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}  ali model 3D-neighbors follow..  20  6..KSRGYLLVGLSADFPPFEFVD-------ENGNIVGFDVDLAKEIARRLGVELKIV----DMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGQVIVVRKDSDPKTYEDLVGKT-----VAVQIGTTGDIEVSKY---DGIKVVRFDKFTDAFLELKRGRADAVVLDSATARAFVAKNP-DLVISSGVLSSEQYGIAVRKEDDLLEFINSVLRELK-KSPYDVLIEKWFS..... 226
9 -80.100d1ii5a1 c.94.1.1 (A:6-226) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]}  ali model 3D-neighbors follow..  19  1.......LKVGVVG-NPPFVFYG-----EGKNAAFTGISLDVWRAVAESQKWNSEY---VRQNSISAGITAVAEGELDILIGPISVTPERAEGITFTQPYFSSGIGLLIPGTATFRSVGDLKNKE-----VAVVRDTTAVDWANF----YQADVRETNNLTAAITLLQKKQVEAVMFDRPALIYYTRQNPNNLEVTEIRVSLEPYGFVLKENSPLQKTINVEMLNLLYSRVIAEFTERWLG..... 221
10 -78.700d3k4ua1 c.94.1.0 (A:2-233) automated matches {Wolinella succinogenes [TaxId: 844]}  ali model 3D-neighbors follow..  18  1....RGELRVGLEPGYLPFEMKD-------KKGNVIGFDVDLAREMAKAMGVKLKLV----PTSWDGLIPGLVTEKFDIIISGMTISQERNLRVNFVEPYIVVGQSLLVKKGKGVKSYKDLDKPEL---TLVTKFGVSAEYAAKRLFK--NAKLKTYDTEAEAVQEVLNGKADMFIFDLPFNVAFMAQKGQGLVHLDTSLTYEPLGWAIKKGDDFLNWLNHFLAQIKHDGSYDELYERWFVDTK.. 228
11 -77.200d4jwxa_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  19  26CVRNTVPCRKFVKINNSTNEGMN-------VKKCCKGFCIDILKKLSRTVKFTYDLYLKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRGTQVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGDEGCKLVTIGSGFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLTGIC.. 278
12 -77.100d3kzga_ c.94.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}  ali model 3D-neighbors follow..  21  1....SLNLTIGTSKFNPPFEVWS------GNNSSLYGFDIDLMQEICRRLHATCTF----EAYIFDDLFPALKNREVDLVIASMIITDERKKHFIFSLPYMESNSQYITTVDSKISTFDDLHGKK-----IGVRKGTPYARQVLSEN--RNNQVIFYELIQDMLLGLSNNQVDASLMDYEAAKYWMASEPYAYKLIGKKYKGEGYSIMANPDQVLIKKINKILLEMEADGTYLRLYSEYF...... 228
13 -77.100d3h7ma_ c.94.1.0 (A:) automated matches {Geobacter sulfurreducens [TaxId: 35554]}  ali model 3D-neighbors follow..  17  1.RDRHRTIVVGGDRDYPPYEFID-------QNGKPAGYNVELTRAIAEVMGMTVEFR----LGAWSEMFSALKSGRVDV-LQGISWSEKRARQIDFTPPHTIVYHAIFARRDSPAAGLEDLRGRK-----VALHRDGIMHEYLAER--GYGKDLVLTPTPADALRLLAAGGCDYAVVAMVPGMYIIRENRTNLVPVARSIAAQRYGYAVRQGDELLARFSEGLAILRKTGQYEAIRAKWLGVLE-P 228
14 -73.600d4kcda_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  22  42SMLDRLFSSLHSSNDTVPIKFKK----------CCYGYCIDLLEQLAEDMNFDFDLYIAWKNGHWTGLVGDLLSGTANMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRGTLSGIHDPK-HPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATQYLKNDPEKLDAFIMDKALLDYEVSDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFMDVLHDKWYKVVPC. 290
15 -73.100d3vvfa1 c.94.1.0 (A:1-236) automated matches {Thermus thermophilus [TaxId: 262724]}  ali model 3D-neighbors follow..  21  9..KRSGEIRIGTEGAFPPFNYFD-------ERNQLTGFEVDLGNAIAERLGLKPRW----IAQSFDTLLIQLNQGRFDFVIASHGITEERARAVDFTNPHYCTGGVIVSRKGG-PRTAKDLQGKV-----VGVQVGTTYMEAAQKI--PGIKEVRTYQRDPDALQDLLAGRIDTWITDRFVAKEAIKERKLETLQVGELVFQERVAMAVAKGNSLLDALNRALAELMQDGTYARISQKWFGED... 232
16 -72.400d2y7ia_ c.94.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  17  1ASVSARTLHFGTSATYAPYEFVDA-------DNKIVGFDIDVANAVCKEMQAECSF----TNQSFDSLIPSLRFKKFDAVIAGMDMTPKREQQVSFSQPYYEGLSAVVVTRKGAYHTFADLKGKK-----VGLENGTTHQRYLQDKQQ--AITPVAYDSYLNAFTDLKNNRLEGVFGDVAAIGKWLKN-NPDYAIMDERASDPDYGIAVRKDNALLQEINAALDKVKASPEYAQMQEKWFT..... 228
17 -72.400d4wxja1 c.94.1.0 (A:9-263) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  23  2......RYTVATRVGKPYFSWREEPEGVHEGNERFEGYAVDLIYMLAQECKFDFNFEPDANTDEWDGIIRQLIDNNAQIGICDLTITQARRSVVDFTVPFMQLGISILSYKGTDIGSLHDLV-DQNKVQFGTIRGGATSVYFSESNDTSFKPDAFTKNNEEGVDRVKLSKGTYAFLMETTNLQYYVQRN-CELTQIGESFGEKHYGIAVPLNADFRSNLSVGILRLSERGELFKLRNKWFNS.... 255
18 -70.500d3i6va_ c.94.1.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 89184]}  ali model 3D-neighbors follow..  19  1......TVRMGTEGAYPPYNFIN-------DAGEVDGFERELGDELCKRAGLTCEW----VKNDWDSIIPNLVSGNYDTIIAGMSITDERDEVIDFTQNYIPPTASSYVATSDG----ADLSGI------VAAQTATIQAGYIAE----SGATLVEFATPEETIAAVRNGEADAVFADRDYLVPIVAESGGELMFVGDDPLGGGVGMGLRESDELRGKFDAAITSMKEDGTLNTMIKKWFGED... 214
19 -69.200d4i62a_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}  ali model 3D-neighbors follow..  17  5..KSKGKLVVALNPDFAPFEYQKVVD----GKNQIVGSDIELAKAIATELGVELELS----PMSFDNVLASVQSGKADLAISGVSKTDERSKVFDFSTPYYTAKNKLIVKKSATYQSVNDLAQKK-----VGAQKGSIQETMAKDLLQ--NSSLVSLPKNGNLITDLKSGQVDAVIFEEPVAKGFVENNPD-ADLNFEKEQDDSYAVAMKKDSELKEAVDKTIQKLKESGELDKLIEDAFKASI.. 236
20 -68.600d4ohna_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}  ali model 3D-neighbors follow..  19  10..QSNKSITIGFDSTFVPMGFAQ-------KDGSYAGFDIDLATAVFEKYGITVNWQ----PIDWDLKEAELTKGTIDLIWNGYSATDERREKVAFSNSYMKNEQVLVTKKSSGITTAKDMTGK-----TLGAQAGSSGYADFEANPEVANKEANQYQTFNEALIDLKNDRIDGLLIDRVYANYYLEAEGNDYNVFTVGLETEAFAVGSRKEDTLVKKINEAFSSLYKDGKFQEISQKWFGED... 242
21 -67.800d4powa_ c.94.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}  ali model 3D-neighbors follow..  19  2.....KSITIATEGSYAPYNFKDA-------GGKLIGFDIDLGNDLCKRM----NIECKFVEQAWDGIIPSLTAGRYDAIMAAMGIQPAREKVIAFSRPYLLTPMTFLTTADSPLLKTQDKFTKIFEGVKFGVQAGTSHEAFMKQMMP--SVQISTYDTIDNVVMDLKAGRIDASLASVSFLKPLTDKDNKDLKMFGPRMTGGLFGVGIRKEDDLKALFDKAIDAAIADGTVQKLSQQWFGYDASP 254
22 -67.100d4gvoa_ c.94.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]}  ali model 3D-neighbors follow..  16  2.....QTITVGTGTQFPNVCFLD-------ENGKLTGYDVELVKEIDKRLGYKFKFK----TMDFSNLLVSLGAGKVDIVAHQMEKSKEREKKFLFNDVAYNNFQLTVLDSNNSINSTKDLAGKR-----VITSATSNGALVLKKINEEQGNNAYEGQGSNDTANQLKTGRADATISTPFAVDFQNKTSAIKEKVVGDVLSNAKVYFMLGKDEKLSKKVDEALQSIIDDGTLKKLSEKWLGAD... 230
23 -67.000d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  19  1..ALPQTVRIGTDTTYAPFSSKDA-------KGEFIGFDIDLGNEMCKRM----QVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQTLESLKGKH-----VGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASFLKQPAGKEYAFAGPSVKDKKYGVGLRKDDELKAAFDKALTELRQDGTYDKMAKKYFD..... 232
24 -63.000d2ylna_ c.94.1.0 (A:) automated matches {Neisseria gonorrhoeae [TaxId: 485]}  ali model 3D-neighbors follow..  15  11..NNKGTVTVGTEGTYAPFTYHD-------KDGKLTGYDVEVTRAVAEKLGVKVEF----KETQWDSMMAGLKAGRFDVVANQVGLTSERQATFDKSEPYSWSGAVLVAHNDSNIKSIADIKGVK-----TAQSLTSNYGEKAKAA----GAQLVPVDGLAQSLTLIEQKRADATLNDELAVLDYLKKNPNKIVWSAPADEKVGSGLIVNKGNEAVAKFSTAINELKADGTLKKLGEQFFGKD... 236
25 -62.500d4eq9a_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}  ali model 3D-neighbors follow..  18  1....KKEIIVATNGSPRPFIY--------EENGELTGYEIEVVRAIFKDSD---KYDVKFEKTEWSGVFAGLDADRYNMAVNNLSYTKERAEKYLYAAPIAQNPNVLVVKKDDSIKSLDDIGGKSTE-VVQATTSAKQLEAYNAEHTDNPTILNYTKADFQQIMVRLSDGQFDYKIFDKIGVETVIKNQGDNLKVIELPSDQQPYVYPLQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYLP 234
26 -60.900d3kbra_ c.94.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  14  8..LESGVLRVATTGDYKPFSYRT-------EEGGYAGFDVDMAQRLAESLGAKLVV----VPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDGKTPITLCSERFQTLEQIDQPGV---TAIVNPGGTNEKFARANL--KKARILVHPDNVTIFQQIVDGKADLMMTDAIEARLQSRLPELCAVHPQQPFDFAEKAYLLPRDEAFKRYVDQWLHIAEQSGLLRQRMEHWL...... 232
27 -59.100d5eyfa_ c.94.1.0 (A:) automated matches {Enterococcus faecium [TaxId: 333849]}  ali model 3D-neighbors follow..  18  8..KSTNEIIWGVKYDTRLFGMMDI------ESRTVQGFDVDIAKAITKKILGDNG-KTEFVEVTSKTRIPLLKNGNIDAIIATMTITDERKKQVDFSDVYFDAGQALLVKKGSQIKSVDDLNAST----TVLAVKGSTSAANIRQH--APDAKILELENYAEAFTALQSGQGDAMTTDNAILLGIADENP-EYELVGGTFTNEPYGIAINKGQNFLKAVNQALEEMHADGTYDKIYQKWFPNEKVE 241
28 -58.300d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  15  8..KQNGVVRIGVFGDKPPFGYVD-------EKGNNQGYDIALAKRIAKELFGD-ENKVQFVLVEAANRVEFLKSNKVDIILANFTQTPQRAEQVDFCSPYMKVALGVAVPKDSNITSVEDLKDKT-----LLLNKGTTADAYFTQNY--PNIKTLKYDQNTETFAALMDKRGDALSHDNTLLFAWVKDHPDFKMGIKELGNKDVIAPAVKKGDELKEFIDNLIIKLGQEQFFHKAYDETLKA.... 233
29 -58.200d2v25a_ c.94.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  20  7..KSKGQLIVGVKNDVPHYALLDQ------ATGEIKGFEVDVAKLLAKSILGD-DKKIKLVAVNAKTRGPLLDNGSVDAVIATFTITPERKRIYNFSEPYYQDAIGLLVLKEKKYKSLADMKGAN-----IGVAQAATTKKAIGEAAKKIDVKFSEFPDYPSIKAALDAKRVDAFSVDKSILLGYVDD---KSEILPDSFEPQSYGIVTKKDDAFAKYVDDFVKEH--KNEIDALAKKWG...... 230
30 -56.700d2ieea_ c.94.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  19  7..KDKGKIVVATSGTLYPTSYHD----TDSGSDKLTGYEVEVVREAAKRLGLKVEFK----EMGIDGMLTAVNSGQVDAAANDIDVTKDREEKFAFSTPYKYSYGTAIVRKDSGIKTLKDLKGKK-----AAGAATTVYMEVARKY--GAKEVIYDNATNEQYLKDVANGRTDVILNDYYLQTLALAAPDLNITIHPDKYMPNKQALVMKKSNALQKKMNEALKEMSKDGSLTKLSKQFFNKA... 237
31 -53.800d2q88a1 c.94.1.0 (A:1-256) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}  ali model 3D-neighbors follow..  17  9..KEQGFARIAI-ANEPPFTAVG-------ADGKVSGAAPDVAREIFKRLGVA---DVVASISEYGAMIPGLQAGRHDAITAGLFMKPERCAAVAYSQPILCDAEAFALKKGNPLKSYKDIADNP--DAKIGAPGGGTEEKLALEA-GVPRDRVIVVPDGQSGLKMLQDGRIDVYSLPVLSINDLVSKANDPNVEVLAPVEGAP-GAAFRKGDALRDAFDVELAKLKESGEFAKIIEPYFSAKAAM 245
32 -52.800d2v3ua_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  23  1...GGVVLRVVTVLEEP---FVMVSENVLGKPKKYQGFSIDVLDALSNYLGFNYEIYVAPEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRRGTSIQSLQDLSKQTVRMKGLNPFERDSMYSQMWRMINRSNGSENNVLESQAGIQKVKYGN--AFVWDAAVLEYVAIDPDCSFYTVGNTVADRGYGIALQHGSPYRDVFSQRILELQQSGDMDILKHKWWPKN... 260
33 -52.400d3g3ga_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  26  1....NRSLIVTTILE-EPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLA-KQTKIEYGAVEDGATMTFFKRSKISSSRRQSVLVKSNEEGIQRVLTSDY-AFLMESTTIEFVTQR-NCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCP 256
34 -50.300d4ykia_ c.94.1.0 (A:) automated matches {Mnemiopsis leidyi [TaxId: 27923]}  ali model 3D-neighbors follow..  21  2...IGRHLRLGSVEE-QPFMFFATEGCEGND--CWSGMVNDMVVKLSEDLGFTYEYIQPKTTNEWNGMIRDLLDDKTDMIAIDLSTNSARKSAIDYSFPFMDAGIKAVVKGGTTLNQVLELLDQDKYGVIGSRHPETLLKTHRDSRYSRLVDEGVELKDLNHAIETLRGGL--FVFIDEGPVLAHNLISDCDVFSVGEEFQSFEYAFGLPKDSPYKSLIDSHLLKFREEGFIDILWEKWSS..... 246
35 -50.100d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  21  3.......LKIVTIHQ-EPFVYVKPTMSDGTVPQCCYGFCIDLLIKLARTMNFTYEVHLVANKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPR-NPSDKFIYATVKQSSVDIYFRRQVELSTMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQ-KCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQEC. 287
36 -45.900d3mpka_ c.94.1.0 (A:) automated matches {Bordetella pertussis [TaxId: 257313]}  ali model 3D-neighbors follow..  16  13..ADHPVVKVAVLNLFAPFTLFR-------TDEQFGGISAAVLQLLQLRTGLDFEII---GVDTVEELIAKLRSGEADM-AGALFVNSARESFLSFSRPYVRNGMVIVTRQDPDPVDADHLDGRT-----VALVRNSAAIPLLQRRY--PQAKVVTADNPSEAMLMVANGQADAVVQTQISASYYVNRYFGKLRIASADLPPAEIALATTRGQTLMSILNKALYSISND-ELASIISRW....... 234
37 -15.000d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]}  ali model 3D-neighbors follow..  12  30.........................................LASGLKAQFGIPFYYAHM------DIRVECLLNGVYDMAVVSYLSQNNLCIALELGPHTYVGEHQLICRKGESGNV-----------KRVGLDSRSADQKIMTDVFGDSDVERVDLS-YHESLQRIVKGDVDAVIWNVVAEN--LTMLGLEATPLTDDPRFLQATEAVVLTRVDDYPMQQLLRAVVDKHALLAHQQRVVSGEQEP 226
38 -13.200d1i6aa_ c.94.1.1 (A:) Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  11  4....SGPLHIGLIPTVGPYLL-------------------HIIPMLHQTF----KLEMYLHEAQTHQLLAQLDSGKLDAVILALVKESEAFIEV----PLFDEPMLLAIYEDHPWANREAVPMADLAGEKL-LEDGHCLRDQAMGFCFEAGADEDT-ATSLETLRNMVAAGSGITLLPALAVPPERKRDGVVYLPAIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRA.................. 205
39 -12.700d3ho7a1 c.94.1.0 (A:90-308) automated matches {Porphyromonas gingivalis [TaxId: 837]}  ali model 3D-neighbors follow..  12  1....TGRLNIAVLPTIAPY----------------------LPRVFPIWKKELAGLEIHVSEMQTSRCLASLLSGEIDMAIIASKAETEGLE----DDLLYYEEFLGYVSRCEPLFEQDVIRTTEVNPHRL-LDEGHCFRDQLVRFCQMKGLHERQTAGSMEAFMRLVESGQGITFIPQLTVEQLSPSQKELVRPFGMPRPVREVRLAVRQDYSRRKLREQLIGLLRS.................. 203
40 -11.000d2fyia1 c.94.1.1 (A:88-307) LysR-type regulatory protein Cbl {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  12  1TNDTSGVLTIATTHTQARY----------------------LPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLV---AFPWFRWHHSLLVPHDHPLTQISPLTLESIAWPLITYRQGITGRSRIDDAFARKGADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGEQEEENLIRLD-TRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKR......... 215
41 -10.500d3jv9a_ c.94.1.0 (A:) automated matches {Neisseria meningitidis [TaxId: 122586]}  ali model 3D-neighbors follow..  11  1....EGAFKLGLIFTVAPY----------------------LPKLIVSLRRTAPKMPLMLEENYTHTLTESLKRGDVDAIIVAEPFQEPGIV----TEPLYDEPFFVIVPKGHSFEELDAVSPRMLGEEQV-LTEGNCMRDQVLSSCSELAAKQRI-GSSINTIRHMVASGLAISVLPATALTE-NDHMLFSIIPFEGTPPSRRVVLAYRRNFVRPKALSAMKAAIMQ.................. 206
42 -9.790d1al3a_ c.94.1.1 (A:) Cofactor-binding fragment of LysR-type protein CysB {Klebsiella aerogenes [TaxId: 28451]}  ali model 3D-neighbors follow..  11  1TWPDKGSLYVATTHTQARY----------------------LPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLV---MLPCYHWNRSIVVTPEHPLATKGSVSIEELAYPLVTYTFGFTGRSELDTAFNRAGPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPVSDPDLVKLD-ANGIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDT......... 215

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 2 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.