current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d4i62a_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst IEAIKSKGKLVVALNPDFAPFEYQKVVDGKNQIVGSDIELAKAIATELGVELELSPMSFDNVLASVQSGKADLAISGVSKTDERSKVFDFSTPYYTAKNKLIVKKSDLATYQSVNDLAQKKVGAQKGSIQETMAKDLLQNSSLVSLPKNGNLITDLKSGQVDAVIFEEPVAKGFVENNPDLAIADLNFEKEQDDSYAVAMKKDSKELKEAVDKTIQKLKESGELDKLIEDAFKASIEKLast
1 -105.000d4i62a_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}  ali model 3D-neighbors  100  1IEAIKSKGKLVVALNPDFAPFEYQKVVDGKNQIVGSDIELAKAIATELGVELELSPMSFDNVLASVQSGKADLAISGVSKTDERSKVFDFSTPYYTAKNKLIVKKSDLATYQSVNDLAQKKVGAQKGSIQETMAKDLLQNSSLVSLPKNGNLITDLKSGQVDAVIFEEPVAKGFVENNPDLAIADLNFEKEQDDSYAVAMKKDSKELKEAVDKTIQKLKESGELDKLIEDAFKASIEK 238
2 -85.300d4prsa_ c.94.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}  ali model 3D-neighbors follow..  37  2IDEIKSRGYLLVGLSADFPPFEF---VDENGNIVGFDVDLAKEIARRLGVELKIVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGQVIVVRKDSDFRPKTYEDLVGKTVAVQIGTTGDIEVSK-YDGIKVVRFDKFTDAFLELKRGRADAVVLDSATARAFVAKNPDLVISS---GVLSSEQYGIAVRKEDTDLLEFINSVLRELK-KSPYDVLIEKWFS..... 226
3 -83.900d3delb1 c.94.1.0 (B:34-257) automated matches {Chlamydia trachomatis [TaxId: 813]}  ali model 3D-neighbors follow..  22  1.......EKFIVGTNATYPPFEF---VDKRGEVVGFDIDLAREISNKLGKTLDVREFSFDALILNLKQHRIDAVITGMSITPSRLKEILMIPYYGEEIKHLVLVFKG-ENKHPLPLTQYRSVAVQTGTYQEAYLQS-LSEVHIRSFDSTLEVLMEVMHGKSPVAVLEPSIAQVVLKDFPALSTATIDLPEDWVLGYGIGVASDRPALALKIEAAVQEIRKEGVLAELEQKWGLNN... 224
4 -76.900d3k4ua1 c.94.1.0 (A:2-233) automated matches {Wolinella succinogenes [TaxId: 844]}  ali model 3D-neighbors follow..  27  1......RGELRVGLEPGYLPFEMK---DKKGNVIGFDVDLAREMAKAMGVKLKLVPTSWDGLIPGLVTEKFDIIISGMTISQERNLRVNFVEPYIVVGQSLLVKKGLEKGVKSYKDLDKPELVTKFGVSAEYAAKRLFKNAKLKTYDTEAEAVQEVLNGKADMFIFDLPFNVAFMAQKGQGYLVHLD-TSLTYEPLGWAIKKGDPDFLNWLNHFLAQIKHDGSYDELYERWFVDTK.. 228
5 -76.800d4f3pa1 c.94.1.0 (A:26-247) automated matches {Burkholderia pseudomallei [TaxId: 320372]}  ali model 3D-neighbors follow..  27  1.......KELVVGTDTSFMPFEFKQ----GDKYVGFDLDLWAEIAKGAGWTYKIQPMDFAGLIPALQTQNIDVALSGMTIKEERRKAIDFSDPYYDSGLAAMVQANN-TTIKSIDDLNGKVIAAKTGTATIDWIKAHLKPKEIRQFPNIDQAYLALEAGRVDAAMHDTPNVLFFVNNEGKGRV-KVAGAPVSGDKYGIGFPKGS-PLVAKVNAELARMKADGRYAKIYKKWFGSEP.. 222
6 -75.700d4dz1a_ c.94.1.0 (A:) automated matches {Salmonella enterica [TaxId: 28901]}  ali model 3D-neighbors follow..  25  1...IVEGRTLNVAVSPASPPMLF---KSADGKLQGIDLELFSSYCQSRHCKLNITEYAWDGMLGAVASGQADVAFSGISITDKRKKVIDFSEPYYINSFYLVSMANHKITLNNLNELNKYSIGYPRGMAYSDLIKNDLSLSKVKLYPTYNETMADLKNGNLDLAFIEEPVYFTFKNKKKM---IESRYVFKNVDQLGIAFKKGS-PVRDDFNLWLKE-QGPQKISGIVDSWMK..... 229
7 -74.600d3vvfa1 c.94.1.0 (A:1-236) automated matches {Thermus thermophilus [TaxId: 262724]}  ali model 3D-neighbors follow..  25  5FEEIKRSGEIRIGTEGAFPPFNYF---DERNQLTGFEVDLGNAIAERLGLKPRWIAQSFDTLLIQLNQGRFDFVIASHGITEERARAVDFTNPHYCTGGVIVSRKGG---PRTAKDLQGKVVGVQVGTTYMEAAQKIPGIKEVRTYQRDPDALQDLLAGRIDTWITDRFVAKEAIKERKL-ENTLQVGELVFQERVAMAVAKGNKSLLDALNRALAELMQDGTYARISQKWFGEDVRC 235
8 -73.600d3kzga_ c.94.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}  ali model 3D-neighbors follow..  21  1......SLNLTIGTSKFNPPFEVWSGNNS--SLYGFDIDLMQEICRRLHATCTFEAYIFDDLFPALKNREVDLVIASMIITDERKKHFIFSLPYMESNSQYITTVD--SKISTFDDLHGKKIGVRKGTPYARQVLSENRNNQVIFYELIQDMLLGLSNNQVDASLMDYEAAKYWMASEPY-KYKLIGKKISIGEGYSIMANPDQFVLIKKINKILLEMEADGTYLRLYSEYF...... 228
9 -73.400d3h7ma_ c.94.1.0 (A:) automated matches {Geobacter sulfurreducens [TaxId: 35554]}  ali model 3D-neighbors follow..  18  2....DRHRTIVVGGDRDYPPYEFI---DQNGKPAGYNVELTRAIAEVMGMTVEFRLGAWSEMFSALKSGRVD-VLQGISWSEKRARQIDFTPPHTIVYHAIFARR-DSPPAAGLEDLRGRKVALHRDGIMHEYLAERGYGKDLVLTPTPADALRLLAAGGCDYAVVAMVPGMYIIRENRLTNLVPVA-RSIAAQRYGYAVRQGDAELLARFSEGLAILRKTGQYEAIRAKWLGVLEP. 228
10 -73.100d2pvua_ c.94.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  32  2....ATKKKVVVGTDAAFAPFEYMQ----KGKIVGFDVDLLDAVMKAAGLDYELKNIGWDPLFASLQSKEVDMGISGITITDERKQSYDFSDPYFEATQVILVKQGS--PVKNALDLKGKTIGVQNATTGQEAAEKLFKGPHIKKFETTVVAIMELLNGGVDAVITDNAVANEYVKNNPNKKLQVIEDPKNASEYYGMIFPKNS-ELKAKVDEALKNVINSGKYTEIYKKWFGKEPKL 230
11 -73.000d4kqpa_ c.94.1.0 (A:) automated matches {Lactococcus lactis [TaxId: 272623]}  ali model 3D-neighbors follow..  28  3....PKKDVYTIASDNSFAPFEF---QNDDKQFTGIDVDLLNAIAKNQGFKLKWNFIGFQAAVDSVQSGHADGMMSGMSITDARKQVFDYGSPYYSSNLTIATSSTD-DSIKSWKDLKGKTLGAKNGTASFDYLNAHAKGYTVKTFTDATTMYSSLNNGSINALMDDEPVIKYAIKQGQKFATPI---KPIPDGQYGFAVKKGNPELIEMFNNGLANLRANGEYDKIIDKYLESDA.. 230
12 -72.000d2y7ia_ c.94.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  29  1..ASVSARTLHFGTSATYAPYEF---VDADNKIVGFDIDVANAVCKEMQAECSFTNQSFDSLIPSLRFKKFDAVIAGMDMTPKREQQVSFSQPYYEGLSAVVVTRK--GAYHTFADLKGKKVGLENGTTHQRYLQDKQQAITPVAYDSYLNAFTDLKNNRLEGVFGDVAAIGKWLKNNPDYAIMDERASDPDGKGLGIAVRKDNDALLQEINAALDKVKASPEYAQMQEKWFT..... 228
13 -69.600d1ii5a1 c.94.1.1 (A:6-226) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]}  ali model 3D-neighbors follow..  21  1.........LKVGVVG-NPPFVFYGE-GKNAAFTGISLDVWRAVAESQKWNSEVRQNSISAGITAVAEGELDILIGPISVTPERAEGITFTQPYFSSGIGLLIPGTATPLFRSVGDLKNKEVAVVRDTTAVDWANFY--QADVRETNNLTAAITLLQKKQVEAVMFDRPALIYYTRQNPNLNL-EVTEIRVSLEPYGFVLKENS-PLQKTINVEMLNLLYSRVIAEFTERWLG..... 221
14 -69.600d2pyya_ c.94.1.0 (A:) automated matches {Nostoc punctiforme [TaxId: 63737]}  ali model 3D-neighbors follow..  25  2.........LLVATRV-IPPFVLSN----KGELSGFSIDLWRSIATQIGIESKIEYSSVPELISAIKDNKVNLGIAAISITAEREQNFDFSLPIFASGLQIMVRNLGTGDIRSIDDLPGKVVATTAGSTAATYLRE--HHISVLEVPKIEEAYKALQTKKADAVVFDAPVLLFYAANEGKGKV-EIVGSILREESYGIILPNNS-PYRKPINQALLNLKENGTYQSLYDKWFD..... 219
15 -69.200d4io2a1 c.94.1.0 (A:3-248) automated matches {Adineta vaga [TaxId: 104782]}  ali model 3D-neighbors follow..  17  3....LKGITLRIGVIESVPFTIVANVIDNTTKLTGYVLDLIEYLRDKMGFVADVQNTSYTGLVLALANGDYDIAIGDITVTSARREIVAFSNSISDNSMRILMRKG--TLIDGMDDLKNGKIGIRIGTAGEDYYLREISSRNFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYC---LTLVGEDFDKSTFGIVTPKEW-LYAKDLDVNILSLRETGILDNLKKKWFQTKA.. 244
16 -67.500d2ieea_ c.94.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  27  3WEQIKDKGKIVVATSGTLYPTSYHDTDSGSDKLTGYEVEVVREAAKRLGLKVEFKEMGIDGMLTAVNSGQVDAAANDIDVTKDREEKFAFSTPYKYSYGTAIVRKDDLSGIKTLKDLKGKKAAGAATTVYMEVARKYGAKEVIYDNATNEQYLKDVANGRTDVILNDYYLQTLALAAFPDLNITIHPDIKYMPNKQALVMKKSNAALQKKMNEALKEMSKDGSLTKLSKQFFN..... 235
17 -63.700d2ylna_ c.94.1.0 (A:) automated matches {Neisseria gonorrhoeae [TaxId: 485]}  ali model 3D-neighbors follow..  25  7IERINNKGTVTVGTEGTYAPFTYH---DKDGKLTGYDVEVTRAVAEKLGVKVEFKETQWDSMMAGLKAGRFDVVANQVGLTPERQATFDKSEPYSWSGAVLVAHNDS--NIKSIADIKGVKTAQSLTSNYGEKAKAA--GAQLVPVDGLAQSLTLIEQKRADATLNDELAVLDYLKKNPNAGVIVWSAPADEKVGSGLIVNKGNDEAVAKFSTAINELKADGTLKKLGEQFFGKDISV 239
18 -63.700d3kbra_ c.94.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  23  4LDRILESGVLRVATTGDYKPFSYR---TEEGGYAGFDVDMAQRLAESLGAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDGKTPITLCSEEARFQTLEQIPGVTAIVNPGGTNEKFARANLKKARILVHPDNVTIFQQIVDGKADLMMTDAIEARLQSRLHPELCAVHPQ-QPFDFAEKAYLLPR-DEAFKRYVDQWLHIAEQSGLLRQRMEHWL...... 232
19 -62.100d4ohna_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}  ali model 3D-neighbors follow..  22  7.SKYQSNKSITIGFDSTFVPMGFA---QKDGSYAGFDIDLATAVFEKYGITVNWQPIDWDLKEAELTKGTIDLIWNGYSATDERREKVAFSNSYMKNEQVLVTKKS--SGITTAKDMTGKTLGAQAGSSNPEILKNIVANKEANQYQTFNEALIDLKNDRIDGLLIDRVYANYYLEAEGVLNDYNVFTVGLETEAFAVGSRKEDTTLVKKINEAFSSLYKDGKFQEISQKWFG..... 240
20 -61.800d4powa_ c.94.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}  ali model 3D-neighbors follow..  19  2.......KSITIATEGSYAPYNF---KDAGGKLIGFDIDLGNDLCKRMNIECKFVEQAWDGIIPSLTAGRYDAIMAAMGIQPAREKVIAFSRPYLLTPMTFLTTADSAELDKFTKIFEGVKFGVQAGTSHEAFMKQMMPSVQISTYDTIDNVVMDLKAGRIDASLASVSFLKPLTDKPDNKDLKMFGPRMTGGKGVGVGIRKEDADLKALFDKAIDAAIADGTVQKLSQQWFG..... 249
21 -61.300d3i6va_ c.94.1.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 89184]}  ali model 3D-neighbors follow..  22  1........TVRMGTEGAYPPYNF---INDAGEVDGFERELGDELCKRAGLTCEWVKNDWDSIIPNLVSGNYDTIIAGMSITDERDEVIDFTQNYIPPTASSYVATSDGADLSG-------IVAAQTATIQAGYIAE--SGATLVEFATPEETIAAVRNGEADAVFADRDYLVPIVAESGG-ELMFVGDDVPLGGGVGMGLRESDGELRGKFDAAITSMKEDGTLNTMIKKWFGEDAA. 216
22 -60.800d4gvoa_ c.94.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]}  ali model 3D-neighbors follow..  22  2.......QTITVGTGTQFPNVCFL---DENGKLTGYDVELVKEIDKRLGYKFKFKTMDFSNLLVSLGAGKVDIVAHQMEKSKEREKKFLFNDVAYNNFPLQLTVLDSNNSINSTKDLAGKRVITSATSNGALVLKKINEEQGAYEGQGSNDTANQLKTGRADATISTPFAVDFQNKTSA--IKEKVVGDVLSNAKVYFMLGKDETKLSKKVDEALQSIIDDGTLKKLSEKWLGADYSK 233
23 -60.800d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  27  4LDKIKQNGVVRIGVFGDKPPFGY---VDEKGNNQGYDIALAKRIAKELENKVQFVLVEAANRVEFLKSNKVDIILANFTQTPQRAEQVDFCSPYMKVALGVAVPKD--SNITSVEDLKDKTLLLNKGTTADAYFTQNYPNIKTLKYDQNTETFAALMDKRGDALSHDNTLLFAWVKDHPDFKMG----ELGNKDVIAPAVKKGDKELKEFIDNLIIKLGQEQFFHKAYDETLK..... 232
24 -60.200d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  27  2.....LPQTVRIGTDTTYAPFSS---KDAKGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQ-PTLESLKGKHVGVLQGSTQEAYANDNWKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFD..... 232
25 -58.700d2q88a1 c.94.1.0 (A:1-256) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}  ali model 3D-neighbors follow..  23  5LEELKEQGFARIAI-ANEPPFTA---VGADGKVSGAAPDVAREIFKRLGVAVVASISEYGAMIPGLQAGRHDAITAGLFMKPERCAAVAYSQPILCDAEAFALKKGNPLGLKSYKDIPDAKIGAPGGGTEEKLALEAVPRDRVIVVPDGQSGLKMLQDGRIDVYSLPVLSINDLVSKANDPNVVLAPVEGAPVYCDGAAFRKGDEALRDAFDVELAKLKESGEFAKIIEPY....... 237
26 -57.700d5eyfa_ c.94.1.0 (A:) automated matches {Enterococcus faecium [TaxId: 333849]}  ali model 3D-neighbors follow..  26  4LERSKSTNEIIWGVKYDTRLFGMMDIESR--TVQGFDVDIAKAITKKIL-KTEFVEVTSKTRIPLLKNGNIDAIIATMTITDERKKQVDFSDVYFDAGQALLVKKG--SQIKSVDDLASTTVLAVKGSTSAANIRQHAPDAKILELENYAEAFTALQSGQGDAMTTDNAILLGIADENPEYELVGGTF---TNEPYGIAINKGQENFLKAVNQALEEMHADGTYDKIYQKWFP..... 233
27 -57.600d4eq9a_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}  ali model 3D-neighbors follow..  21  1......KKEIIVATNGSPRPFIYEE----NGELTGYEIEVVRAIFKDSDYDVKFEKTEWSGVFAGLDADRYNMAVNNLSYTKERAEKYLYAAPIAQNPNVLVVKKDD-SSIKSLDDIGGKSTEVVQATTSAKQLEADNPTILNYTKADFQQIMVRLSDGQFDYKIFDKIGVETVIKNQGLDNLKVIELPSDQQPYVYPLLAQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYLP 234
28 -56.600d2v25a_ c.94.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  22  3LESIKSKGQLIVGVKNDVPHYALLDQATG--EIKGFEVDVAKLLAKSIL-KIKLVAVNAKTRGPLLDNGSVDAVIATFTITPERKRIYNFSEPYYQDAIGLLVLKE--KKYKSLADMKGANIGVAQAATTKKAIGEAAKDVKFSEFPDYPSIKAALDAKRVDAFSVDKSILLGYVDDKSEIL------DSFEPQSYGIVTKKDDPAFAKYVDDFVKEH--KNEIDALAKKWG...... 230
29 -52.800d4jwxa_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  16  27...VRNTVPCRKFVKINNSTNEGM---NVKKCCKGFCIDILKKLSRTVKFTYDLYNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRGTQVT-KKFQRPHDYSPPFRFGTVPNGSTERNIRNMTRFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIG-YIFATTGYGIALQKGSP-WKRQIDLALLQFVGDGEMEELETLWLT..... 275
30 -49.600d4kcda_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  16  41.SSMLDRLFSSLHSSNDTVPIKF------KKCCYGYCIDLLEQLAEDMNFDFDLKNGHWTGLVGDLLSGTANMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTRGTHDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMH-VPATPDGVQYLKNDPEKLDAFIMDKALLDYEVSIDADCKLLTVG-KPFAIEGYGIGLPPNSP-LTSNISELISQYKSHGFMDVLHDKWYKVVP.. 289
31 -45.300d3mpka_ c.94.1.0 (A:) automated matches {Bordetella pertussis [TaxId: 257313]}  ali model 3D-neighbors follow..  18  12...MADHPVVKVAVLNLFAPFTL---FRTDEQFGGISAAVLQLLQLRTGLDFEIIGVTVEELIAKLRSGEADM-AGALFVNSARESFLSFSRPYVRN-GMVIVTRQDPDAPVDADHLDGRTVALVRNSAAIPLLQRRYPQAKVVTADNPSEAMLMVANGQADAVVQTQISASYYVNRYFAGKLRIASALDLPPAEIALATTRGQTELMSILNKALYSISND-ELASIISRW....... 234
32 -44.400d4wxja1 c.94.1.0 (A:9-263) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  16  2........RYTVATRVGKPYFSWREEPEGNERFEGYAVDLIYMLAQECKFDFNFETDEWDGIIRQLIDNNAQIGICDLTITQARRSVVDFTVPFMQLGISILSYKGTDIGSLHVDQNKVQFGTIRGGATSVYFSESNDTKPDAFTKNNEEGVDRVKLSKGTYAFLMETTNLQYYVQRNCELTQIG---ESFGEKHYGIAVPLNAD-FRSNLSVGILRLSERGELFKLRNKWFN..... 254
33 -30.200d4ykia_ c.94.1.0 (A:) automated matches {Mnemiopsis leidyi [TaxId: 27923]}  ali model 3D-neighbors follow..  21  2.....IGRHLRLGSVEE-QPFMFFATEEGNDCWSGMVNDMVVKLSEDLGFTYEYIQPDWNGMIRDLLDDKTDMIAIDLSTNSARKSAIDYSFPFMDAGIKAVVKGEG-TTLNQVLELLDQD--YKWGVIGSRHPETLLKTHRDSRYSRLVDEGVELKDGGLFVFIDEGPVLAHNLISDCDVFSVG---EEFQSFEYAFGLPKDSP-YKSLIDSHLLKFREEGFIDILWEKWSS..... 246
34 -28.400d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  18  3.........LKIVTIHQ-EPFVYVKPTMVPQCCYGFCIDLLIKLARTMNFTYEVNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVEHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTG---ELFFRSGFGIGMRKDSP-WKQNVSLSILKSHENGFMEDLDKTWVR..... 283
35 -28.300d2v3ua_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  20  1.....GGVVLRVVTVLE-EPFVMENVLGKPKKYQGFSIDVLDALSNYLGFNYEIEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRRGT--SIQSLQDLS-KQTDIPYGTVLDSAVYQHVRMKGLNPFEESQAGIQKVKYGNY-AFVWDAAVLEYVAINDPDCSFYTVG-NTVADRGYGIALQHGSP-YRDVFSQRILELQQSGDMDILKHKWWP..... 258
36 -25.900d3g3ga_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  21  1......NRSLIVTTILE-EPYKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKG--TPIDSADDLA-KQTKIEYGAVEDGATMTFFKRSKISTYDKMQSVLVKSNEEGIQAFLMESTTIEFVTQRNCNLTQIG---GLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKWWR..... 251
37 -19.200d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]}  ali model 3D-neighbors follow..  15  30.......................................LASGLKAQFGIPFYYAHMR-DIRVECLLNGVYDMAVVSRLAAESYLSQLELGPHTYVGEHQLICRKG--------ESGNVKRVGLDSRSADQKMTDVFFGDSDVERVDSYHESLQRIVKGDVDAVIWNVVAENELTMLGLEATPLTDDPRFLQATEAVVLTRVDDYPMQQLLRAVVD...................... 208
38 -9.090d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  13  1.................FVPGQFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFAL-GYDEEHERLPEGIQAHDWFADRYVVVARRDTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARA--LAEAAGLALYPAPFDIPPYVLRLYSHVQHVGRDAHAMIGQLKGLD................... 212

FFAS is supported by the NIH grant R01-GM087218-01
1 1 0 2 4 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.