current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d4gvoa_ c.94.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst VQTITVGTGTQFPNVCFLDENGKLTGYDVELVKEIDKRLPGYKFKFKTMDFSNLLVSLGAGKVDIVAHQMEKSKEREKKFLFNDVAYNNFPLQLTVLDSNNSINSTKDLAGKRVITSATSNGALVLKKINEEQGNNFEIAYEGQGSNDTANQLKTGRADATISTPFAVDFQNKTSAIKEKVVGDVLSNAKVYFMLGKDETKLSKKVDEALQSIIDDGTLKKLSEKWLGADYSKEQYLast
1 -108.000d4gvoa_ c.94.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]}  ali model 3D-neighbors  100  1VQTITVGTGTQFPNVCFLDENGKLTGYDVELVKEIDKRLPGYKFKFKTMDFSNLLVSLGAGKVDIVAHQMEKSKEREKKFLFNDVAYNNFPLQLTVLDSNNSINSTKDLAGKRVITSATSNGALVLKKINEEQGNNFEIAYEGQGSNDTANQLKTGRADATISTPFAVDFQNKTSAIKEKVVGDVLSNAKVYFMLGKDETKLSKKVDEALQSIIDDGTLKKLSEKWLGADYSKEQY 236
2 -88.100d4eq9a_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}  ali model 3D-neighbors follow..  26  2.KEIIVATNGSPRPFIY-EENGELTGYEIEVVRAIFKDSDKYDVKFEKTEWSGVFAGLDADRYNMAVNNLSYTKERAEKYLYAAP-IAQNPNVLVVKKDDSSIKSLDDIGGKSTEVVQATTSAKQLEAYNAEHTDNTILNYTKADFQQIMVRLSDGQFDYKIFDKIGVETVIKNQGDNLKVIELPSDQQPVYPLLAQGQDELKSFVDKRIKELYKDGTLEKLSKQFFGDTYLPAE. 236
3 -84.400d2ylna_ c.94.1.0 (A:) automated matches {Neisseria gonorrhoeae [TaxId: 485]}  ali model 3D-neighbors follow..  28  14.GTVTVGTEGTYAPFTYHDKDGKLTGYDVEVTRAVAEKL-GVKVEFKETQWDSMMAGLKAGRFDVVANQVGLTPERQATFDKSEPYSWSGA--VLVAHNDSNIKSIADIKGVKTAQSLTSNYGEKAKAAGAQ-------LVPVDGLAQSLTLIEQKRADATLNDELAVLDYLKKNGVKIVWSAPADEKVGSGLIVNKGNDEAVAKFSTAINELKADGTLKKLGEQFFGKDISVQ.. 240
4 -81.500d3vvfa1 c.94.1.0 (A:1-236) automated matches {Thermus thermophilus [TaxId: 262724]}  ali model 3D-neighbors follow..  26  11SGEIRIGTEGAFPPFNYFDERNQLTGFEVDLGNAIAERL-GLKPRWIAQSFDTLLIQLNQGRFDFVIASHGITEERARAVDFTNPHYCTGGVIVS---RKGGPRTAKDLQGKVVGVQVGTTYMEAAQKIPGI-----KEVRTYQRDPDALQDLLAGRIDTWITDRFVAEAIKERKLENTLQVGELVFQERVAMAVAKGNKSLLDALNRALAELMQDGTYARISQKWFGEDVRCK.. 236
5 -79.500d2ieea_ c.94.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  27  10.GKIVVATSGTLYPTSYHDTDDKLTGYEVEVVREAAKRL-GLKVEFKEMGIDGMLTAVNSGQVDAAANDIDVTKDREEKFAFSTPYKYSYGTAIVRKDDLSGIKTLKDLKGKKAAGAATTVYMEVARKYGAKE-----VIYDNATNEQYLKDVANGRTDVILNDYYLTLALAAFPDLNITIHPDIYMPNKQALVMKKSNAALQKKMNEALKEMSKDGSLTKLSKQFFNKDVSKK.. 242
6 -77.100d3h7ma_ c.94.1.0 (A:) automated matches {Geobacter sulfurreducens [TaxId: 35554]}  ali model 3D-neighbors follow..  19  5.RTIVVGGDRDYPPYEFIDQNGKPAGYNVELTRAIAEVM-GMTVEFRLGAWSEMFSALKSGRVDVL-QGISWSEKRARQIDFTPPHTIVY-HAIFARRDSPPAAGLEDLRGRKVALHRDGIMHEYLAERGYG-----KDLVLTPTPADALRLLAAGGCDYAVVAMVPGMYIIRENRTNLVPVARSIAAQRYGYAVRQGDAELLARFSEGLAILRKTGQYEAIRAKWLGVL...... 226
7 -76.500d3delb1 c.94.1.0 (B:34-257) automated matches {Chlamydia trachomatis [TaxId: 813]}  ali model 3D-neighbors follow..  18  1.EKFIVGTNATYPPFEFVDKRGEVVGFDIDLAREISNKL-GKTLDVREFSFDALILNLKQHRIDAVITGMSITPSRLKEILMIPYYGE-EIKHLVLVFKGENKHPLPLTQYRSVAVQTGTYQEAYLQSLSEVH------IRSFDSTLEVLMEVMHGKSPVAVLEPSIAQVVLKDFPTATIDLPEDQWVLGYGIGVASDRPALALKIEAAVQEIRKEGVLAELEQKWGLNN...... 224
8 -76.200d4ohna_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}  ali model 3D-neighbors follow..  23  13.KSITIGFDSTFVPMGFAQKDGSYAGFDIDLATAVFEKY-GITVNWQPIDWDLKEAELTKGTIDLIWNGYSATDERREKVAFSNSYMKNE--QVLVTKKSSGITTAKDMTGKTLGAQAGSSGYADFEANPEKNIVANKEANQYQTFNEALIDLKNDRIDGLLIDRVYANYYLEAEGVDYNVFTVGLETEAFAVGSRKEDTTLVKKINEAFSSLYKDGKFQEISQKWFGEDVATK.. 246
9 -74.800d3k4ua1 c.94.1.0 (A:2-233) automated matches {Wolinella succinogenes [TaxId: 844]}  ali model 3D-neighbors follow..  20  2.GELRVGLEPGYLPFEMKDKKGNVIGFDVDLAREMAKAM-GVKLKLVPTSWDGLIPGLVTEKFDIIISGMTISQERNLRVNFVEPYIVVGQSLLVKKGLEKGVKSYKDLDKPELVTKFGVSAEYAAKRLFKN-----AKLKTYDTEAEAVQEVLNGKADMFIFDLFNVAFMAQKGQGYLVHLDTSLTYEPLGWAIKKGDPDFLNWLNHFLAQIKHDGSYDELYERWFVDTKWLEK. 232
10 -74.400d4prsa_ c.94.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}  ali model 3D-neighbors follow..  27  9.GYLLVGLSADFPPFEFVDENGNIVGFDVDLAKEIARRL-GVELKIVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGQVIVVRKDSDFRPKTYEDLVGKTVAVQIGTTGDIEVSKYDGIK------VVRFDKFTDAFLELKRGRADAVVLDSATARAFVAKNP-DLVISSGVLSSEQYGIAVRKEDTDLLEFINSVLRELK-KSPYDVLIEKWFS........ 226
11 -73.700d4dz1a_ c.94.1.0 (A:) automated matches {Salmonella enterica [TaxId: 28901]}  ali model 3D-neighbors follow..  14  5.RTLNVAVSPASPPMLFKSADGKLQGIDLELFSSYCQSR-HCKLNITEYAWDGMLGAVASGQADVAFSGISITDKRKKVIDFSEPYYINSFYLVSMANHKITLNNLNELNKYSIGYPRGMAYSDLIKNLEPKGYYSLSKVKLYPTYNETMADLKNGNLDLAFIEEPVYFTFKNKKKMPIESRYVFKNVDQLGIAFKKGS-PVRDDFNLWLKE-QGPQKISGIVDSWM......... 228
12 -69.800d1ii5a1 c.94.1.1 (A:6-226) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]}  ali model 3D-neighbors follow..  15  1...LKVGVV-GNPPFVFYGENAAFTGISLDVWRAVAESQ-KWNSEYRQNSISAGITAVAEGELDILIGPISVTPERAEGITFTQPYFSSGIGLLIPGTATPLFRSVGDLKNKEVAVVRDTTAVDWANFYQAD-------VRETNNLTAAITLLQKKQVEAVMFDRPALIYYTRQPNLNLEVTEIRVSLEPYGFVLKENS-PLQKTINVEMLNLLYSRVIAEFTERWLG........ 221
13 -67.800d4f3pa1 c.94.1.0 (A:26-247) automated matches {Burkholderia pseudomallei [TaxId: 320372]}  ali model 3D-neighbors follow..  27  1.KELVVGTDTSFMPFEFKQ-GDKYVGFDLDLWAEIAKGA-GWTYKIQPMDFAGLIPALQTQNIDVALSGMTIKEERRKAIDFSDPYYD-SGLAAMVQANNTTIKSIDDLNGKVIAAKTGTATIDWIKAHLKPKE-----IRQFPNIDQAYLALEAGRVDAAMHDTPNVLFFVNNEGGRVKVAGAPVSGDKYGIGFPKGS-PLVAKVNAELARMKADGRYAKIYKKWFGSE...... 221
14 -67.500d4kqpa_ c.94.1.0 (A:) automated matches {Lactococcus lactis [TaxId: 272623]}  ali model 3D-neighbors follow..  20  6.DVYTIASDNSFAPFEFQNDDKQFTGIDVDLLNAIAKN-QGFKLKWNFIGFQAAVDSVQSGHADGMMSGMSITDARKQVFDYGSPYY-SSNLTIATSSTDDSIKSWKDLKGKTLGAKNGTASFDYLNAHAKEYGYTVK---TFTDATTMYSSLNNGSINALMDDEPVIKYAIKQGQ-KFATPIKPIPDGQYGFAVKKGNPELIEMFNNGLANLRANGEYDKIIDKYLESDA..... 230
15 -67.500d3kzga_ c.94.1.0 (A:) automated matches {Legionella pneumophila [TaxId: 272624]}  ali model 3D-neighbors follow..  22  1SLNLTIGTSKFNPPFEVWSNNSSLYGFDIDLMQEICRRL-HATCTFEAYIFDDLFPALKNREVDLVIASMIITDERKKHFIFSLPYMESNSQYIT--TVDSKISTFDDLHGKKIGVRKGTPYARQVLSENRNNQ-----VIFYELIQDMLLGLSNNQVDASLMDYEAAKYWMASEPYAYKLIGKKYKGEGYSIMANPDQFVLIKKINKILLEMEADGTYLRLYSEYF......... 228
16 -67.100d4io2a1 c.94.1.0 (A:3-248) automated matches {Adineta vaga [TaxId: 104782]}  ali model 3D-neighbors follow..  16  6.ITLRIGVIESVPFTIVANNTTKLTGYVLDLIEYLRDKM-GFVADVQNTSYTGLVLALANGDYDIAIGDITVTSARREIVAFSNSISDNS--MRILMRKGTLIDGMDDLKNGKIGIRIGTAGEDYYLREISGGSRN---FYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCNLTLVGEDFDKSTFGIVTPKEW-LYAKDLDVNILSLRETGILDNLKKKWFQTK...... 243
17 -67.000d3i6va_ c.94.1.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 89184]}  ali model 3D-neighbors follow..  22  1..TVRMGTEGAYPPYNFINDAGEVDGFERELGDELCKRA-GLTCEWVKNDWDSIIPNLVSGNYDTIIAGMSITDERDEVIDFTQNYIPPTASSYVATSDGADLSG-------IVAAQTATIQAGYIAESGAT-------LVEFATPEETIAAVRNGEADAVFADRDYLVPIVAESGGELMFVGDDVPGGGVGMGLRESDGELRGKFDAAITSMKEDGTLNTMIKKWFGEDAA.... 216
18 -65.100d2y7ia_ c.94.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  18  5ARTLHFGTSATYAPYEFVDADNKIVGFDIDVANAVCKEM-QAECSFTNQSFDSLIPSLRFKKFDAVIAGMDMTPKREQQVSFSQPYYEGLSAVVV--TRKGAYHTFADLKGKKVGLENGTTHQRYLQDKQQAIT-----PVAYDSYLNAFTDLKNNRLEGVFGDVAAIGKWLKNNPMDERASDPDYYGKGLGIAVRKDNDALLQEINAALDKVKASPEYAQMQEKWF......... 227
19 -62.600d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  23  3PQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRM-QVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAA-DSRLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVD---VVAYANQDLIYSDLTAGRLDAALQDEVAASFLKQPAGKEYAFAGPSVKDKKTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNV..... 235
20 -62.500d2pyya_ c.94.1.0 (A:) automated matches {Nostoc punctiforme [TaxId: 63737]}  ali model 3D-neighbors follow..  22  2...LLVATR-VIPPFVLSN-KGELSGFSIDLWRSIATQI-GIESKLEYSSVPELISAIKDNKVNLGIAAISITAEREQNFDFSLPIFASGLQIMVRNLGTGDIRSIDDLPGKVVATTAGSTAATYLREHHIS-------VLEVPKIEEAYKALQTKKADAVVFDAVLLFYAANEGKGKVEIVGSILREESYGIILPNNS-PYRKPINQALLNLKENGTYQSLYDKWFD........ 219
21 -62.200d2pvua_ c.94.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  22  5.KKVVVGTDAAFAPFEYMQ-KGKIVGFDVDLLDAVMKAA-GLDYELKNIGWDPLFASLQSKEVDMGISGITITDERKQSYDFSDPYFEAT--QVILVKQGSPVKNALDLKGKTIGVQNATTGQEAAEKLFGKGPH----IKKFETTVVAIMELLNGGVDAVITDNVANEYVKNNPNKKLQVIEDPFASEYYGMIFPKNS-ELKAKVDEALKNVINSGKYTEIYKKWFGKE...... 227
22 -62.100d3kbra_ c.94.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  15  11.GVLRVATTGDYKPFSYRTEEGGYAGFDVDMAQRLAESL-GAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQAYFSIPYLRDGKTPITLCSEEARFQTLEQIPGVTAIVNPGGTNEKFARANLKK-----ARILVHPDNVTIFQQIVDGKADLMMTDAIEARLQSRLPELCAVHPQQPFDFAEKAYLLPR-DEAFKRYVDQWLHIAEQSGLLRQRMEHWL......... 232
23 -61.600d4powa_ c.94.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}  ali model 3D-neighbors follow..  25  2.KSITIATEGSYAPYNFKDAGGKLIGFDIDLGNDLCKRM-NIECKFVEQAWDGIIPSLTAGRYDAIMAAMGIQPAREKVIAFSRPYLLTPMTFLTTADSPLL-KFTKIFEGVKFGVQAGTSHEAFMKQMMPSVQ-----ISTYDTIDNVVMDLKAGRIDASLASVSFLKLTDKPDNKDLKMFGPRMTGKGVGVGIRKEDADLKALFDKAIDAAIADGTVQKLSQQWFGYDAS.... 253
24 -61.200d2q88a1 c.94.1.0 (A:1-256) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}  ali model 3D-neighbors follow..  14  12.GFARIAI-ANEPPFTAVGADGKVSGAAPDVAREIFKRLGVADVVASISEYGAMIPGLQAGRHDAITAGLFMKPERCAAVAYSQPILCDAEAFALKKGNPLGLKSYKDIPDAKIGAPGGGTEEKLALEAGVPRDR----VIVVPDGQSGLKMLQDGRIDVYSLPVLSINDLVSKANDPNVEVLAPVEGAPVGAAFRKGDEALRDAFDVELAKLKESGEFAKIIEPYFSAKAAMS.. 246
25 -60.800d4i62a_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}  ali model 3D-neighbors follow..  22  8.GKLVVALNPDFAPFEYQDGKNQIVGSDIELAKAIATEL-GVELELSPMSFDNVLASVQSGKADLAISGVSKTDERSKVFDFSTPYYTAKNKLIVKKSDLATYQSVNDLAQKKVGAQKGSIQETMAKDLLQNSS-----LVSLPKNGNLITDLKSGQVDAVIFEEPVAKGFVENNPAIADLNFEKEQDDSYAVAMKKDSKELKEAVDKTIQKLKESGELDKLIEDAFKASIEK... 238
26 -55.800d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  17  11.GVVRIGVFGDKPPFGYVDEKGNNQGYDIALAKRIAKELDENKVQFVLVEAANRVEFLKSNKVDIILANFTQTPQRAEQVDFCSPYMKVALGVAV--PKDSNITSVEDLKDKTLLLNKGTTADAYFTQNYPNIK-----TLKYDQNTETFAALMDKRGDALSHDNTLLFAWVKDHPDFKMGIKELGNKDVIAPAVKKGDKELKEFIDNLIIKLGQEQFFHKAYDETLKA....... 233
27 -53.300d2v25a_ c.94.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  19  10.GQLIVGVKNDVPHYALLDATGEIKGFEVDVAKLLAKSILG-KIKLVAVNAKTRGPLLDNGSVDAVIATFTITPERKRIYNFSEPYYQDAIGLLV--LKEKKYKSLADMKGANIGVAQAATTKKAIGEAAKKIGIDVKFS-EFPDYPSIKAALDAKRVDAFSVDKSILLGYVDD---KSEILPDSFEPQSYGIVTKKDDPAFAKYVDDFVKEH--KNEIDALAKKWG......... 230
28 -51.100d5eyfa_ c.94.1.0 (A:) automated matches {Enterococcus faecium [TaxId: 333849]}  ali model 3D-neighbors follow..  22  11.NEIIWGVKYDTRLFGMMDESRTVQGFDVDIAKAITKKILG-KTEFVEVTSKTRIPLLKNGNIDAIIATMTITDERKKQVDFSDVYFDAGQALLV--KKGSQIKSVDDLASTTVLAVKGSTSAANIRQHAPD-----AKILELENYAEAFTALQSGQGDAMTTDNAILLGIADENP-EYELVGGTFTNEPYGIAINKGQENFLKAVNQALEEMHADGTYDKIYQKWFPNETEGKV. 240
29 -47.400d4jwxa_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  11  32..PCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTV-KFTYDLYLVTWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRGTQVSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQRFNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGDEGCKLVTIGSIFATTGYGIALQKGS-PWKRQIDLALLQFVGDGEMEELETLWLTGI...... 277
30 -46.300d4kcda_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  14  46RLFSSLHSSNDTVPIKF---KKCCYGYCIDLLEQLAEDM-NFDFDWKNGHWTGLVGDLLSGTANMAVTSFSINTARSQVIDFTSPFFS-TSLGILVRTRGTELSGIHDPKGFRFGTVRESSAEDYVRQSFPEMHEYMRRNVPATPDGVQYLKNDPEKLDAFIMDKALLDYEVIDADCKLLTVGKPFAIEGYGIGLPPNS-PLTSNISELISQYKSHGFMDVLHDKWYKVV...... 288
31 -43.300d3mpka_ c.94.1.0 (A:) automated matches {Bordetella pertussis [TaxId: 257313]}  ali model 3D-neighbors follow..  15  16.PVVKVAVLNLFAPFTLFRTDEQFGGISAAVLQLLQLRT-GLDFEIIGVTVEELIAKLRSGEADMAGA-LFVNSARESFLSFSRPYVRN-GMVIVTRQDPDAPVDADHLDGRTVALVRNSAAIPLLQRRYPQAK-----VVTADNPSEAMLMVANGQADAVVQTQISASYYVNRYFAGKLRIASALDPAEIALATTRGQTELMSILNKALYSISND-ELASIISRW.......... 234
32 -40.100d4wxja1 c.94.1.0 (A:9-263) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  13  2..RYTVATRVGKPYFSWREENERFEGYAVDLIYMLAQEC-KFDFNFETDEWDGIIRQLIDNNAQIGICDLTITQARRSVVDFTVPFMQLG--ISILSYKGTDIGSLHDLV-QFGTIRGGATSVYFSESNDTDNRSFKPDAFTKNNEEGVDRVKLSKGTYAFLMETTNLQYYVQR-NCELTQIGESFGEKHYGIAVPLNAD-FRSNLSVGILRLSERGELFKLRNKWFNS....... 255
33 -30.100d4ykia_ c.94.1.0 (A:) automated matches {Mnemiopsis leidyi [TaxId: 27923]}  ali model 3D-neighbors follow..  15  4.RHLRLGS----QPFMFFATNDCWSGMVNDMVVKLSEDL-GFTYEYIQPDWNGMIRDLLDDKTDMIAIDLSTNSARKSAIDYSFPFMDAG-IKAVVKGEGTTLNQVLELLDQDKVIGSRHPETLLKTHRDSRYSRLVDEGVELKDLNHAIETLRGGLF-VFIDEGPVLAHNLIS-DCDVFSVGEEFQSFEYAFGLPKDSP-YKSLIDSHLLKFREEGFIDILWEKWS......... 245
34 -27.100d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  10  57....................PQCCYGFCIDLLIKLARTM-NFTYEVHLVAWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRTGINDPRLRNPSDATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQ-KCDLVTTGELFFRSGFGIGMRKDSP-WKQNVSLSILKSHENGFMEDLDKTWV......... 282
35 -27.100d2v3ua_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  13  3.VVLRVVTVLE-EPFVMVSEPKKYQGFSIDVLDALSNYL-GFNYEIYVAPWNGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLL--RRGTSIQSLQDLSKQRMKGLNPFERDSMYSQMWRMINRSNGSENNVLESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTVGNTVADRGYGIALQHGSP-YRDVFSQRILELQQSGDMDILKHKWWPKN...... 260
36 -23.400d3g3ga_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  15  2.RSLIVTT----EPYVLFKKNDRFEGYCIDLLRELSTIL-GFTYEIRLVQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTL--GISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKRSKISTYDKMWAFMSSRRQSVLVKSNEEGAFLMESTTIEFVTQR-NCNLTQIGGLIDSKGYGVGTPMGSP-YRDKITIAILQLQEEGKLHMMKEKWW......... 250
37 -15.700d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]}  ali model 3D-neighbors follow..  11  30..............................LASGLKAQFDGIPFYYAHMR-DIRVECLLNGVYDMAVVSSYLSQNNLCIALELGPHTYVGEHQLICRKG-------ESGNVKRVGLDSRSADQKIMTDVFFGDS---DVERVDLSYHESLQRIVKGDVDAVIWNVVAENELTMLG-TPLTDDPRFLQATEAVVLTRVDDYPMQQLLRAVVDAHQQRVVSGEQEPSY.......... 228
38 -14.200d3ho7a1 c.94.1.0 (A:90-308) automated matches {Porphyromonas gingivalis [TaxId: 837]}  ali model 3D-neighbors follow..  13  1TGRLNIAVLPTIAPYLL------------RVFPIWKKELAGLEIHVSEMQTSRCLASLLSGEIDMAIIASKAETEGEDDLLYYEEFLGYVSRCEPLFEQDV---RTTEVNPHRL-LDEGHCFRDQLVRFCQMKGLHERQTAYSGGSMEAFMRLVESGQGITFIPQLTVEQLSPSQKELVRPFGMPRPVREVRLAVRQDRRKLREQLIGLLRSAVPSDMHKLQTGQ........... 216
39 -13.100d1i6aa_ c.94.1.1 (A:) Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  11  4SGPLHIGLIPTVGPYLL------------HIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDAVILALVKESEAFIEVPLFDEPMLLAIYEDHPWANREAVPMADLAGEKLLMLEDGHCLRDQAMGFCFEAGADEDTHFRATSLETLRNMVAAG-SGITLLPALAVPPERKRDGVVYLPAIKPEPRRTIGLVYRPGSEQLAEAIRARMDGHFD..................... 212
40 -12.000d3jv9a_ c.94.1.0 (A:) automated matches {Neisseria meningitidis [TaxId: 122586]}  ali model 3D-neighbors follow..  10  2.GAFKLGLIFTVAPYLL------------KLIVSLRRTAPKMPLMLEENYTHTLTESLKRGDVDAIIVAEPFQEPGVTEPLYDEPFFVIVPKGHSFEELDA---SPRMLGEEQVGNCMRDQVLSSCSELAAKQRIQGLTNTLQGSSINTIRHMVASGLAISVLPATALT-ENDHMLFSIIPFEGTPPSRRVVLAYRRNRPKALSAMKAAIMQSQLHGV.................. 212
41 -11.700d4rpoa_ c.94.1.0 (A:) automated matches {Sphingobium chlorophenolicum [TaxId: 46429]}  ali model 3D-neighbors follow..  10  26.............................RLYATLEETAPQVRVTGVNLRHGPLVEELESGSIDIAFGGFTLSAGIKTQTLFREEYVCVMRQSHPALTHGLDLEAFRQCRHIIVTAHEFNHVHEQVEARLLELLPPESIRFTTENFLVSAVIAEETDVILTIPSRLARWF---ANRGGLTIFPVPIELPSIEVKQRYDKDPGNIWLRRVIAKIGFQNPPAE............... 219
42 -10.800d1ixca2 c.94.1.1 (A:90-294) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]}  ali model 3D-neighbors follow..  10  1VGELSVAYFGT-----------PIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFPRHPGIEIVNIAQEDLYLAVHRSQSGKFGKTC-KLADLRAVELTLGGRPSFADEVIGLFKHAGIEPRIARVVEDATAALALTMAGAASSIVPASVA---AIRWPDIAFARIVGTRVKVPISCIFRKEKQPILARFVEHVRRSAKD.................... 205
43 -10.600d2y7pa1 c.94.1.1 (A:90-301) automated matches {Burkholderia sp. [TaxId: 233098]}  ali model 3D-neighbors follow..  14  25.............................PLMEALAQRAPHIQISTLRPNAGNLKEDMESGAVDLALGLLELQTGFFQRRLFRHRYVCMFRKDHPSAKSPMSLKQFTEL--EHVGVVALNTGHGEVDGLLERAGIKRRMRLVVPHFIAIGPILHSTDLIATVPQRFAVRC---EVPFGLTTSPHPAKLPDIAINLKYNRDPGNMWLRQLFVELFSEA................... 212
44 -9.880d3oxna_ c.94.1.0 (A:) automated matches {Vibrio parahaemolyticus [TaxId: 670]}  ali model 3D-neighbors follow..  23.............................FALPRIYQEAPNVSFNFLPLQHDRLSDQLTYEGADLAICRPTGPVEPRSEILGRVGVLCLLSKQHPLANQEMSLDDY--LSHPHAMIAISDGVKALIEQALIDKPQR-KMVLRAYHLEAALAIVDTLPIIITVPADLAYLV---AERYDLVVKPLPFQFTPFDYSMIWHARCEHSPAQEWLRSVVREECSRLIAKR........... 213
45 -9.500d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  10  25.............................PLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDRLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGY--LAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARAL---AEAAGLALYPAPFDIPPYVLRLYSHVQHVGRDAHAWMIGQLKG.................... 210

FFAS is supported by the NIH grant R01-GM087218-01
1 1 0 2 4 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.