current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d3ucsc1 a.2.3.0 (C:2-73) automated matches {Escherichia coli K-12 [TaxId: 83333]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
1 -50.600d3ucsc1 a.2.3.0 (C:2-73) automated matches {Escherichia coli K-12 [TaxId: 83333]}  ali model 3D-neighbors  100  1ELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKEPDAEARFKEVAEAWEVLSDEQRRAEYDQMWQHRN 72
2 -48.100d2cuga1 a.2.3.0 (A:8-82) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  42  8LDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDRFIQISKAYEILSNEEKRTNYDHYG.... 75
3 -43.500d2yuaa1 a.2.3.0 (A:8-93) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  8SRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSSAEAAERFTRISQAYVVLGSATLRRKYDRGLL... 77
4 -43.200d2o37a_ a.2.3.0 (A:) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  38  3KETKLYDLLGVSPSANEQELKKGYRKAALKYHPDKP--TGDTEKFKEISEAFEILNDPQKREIYDQYGL... 69
5 -41.700d1wjza1 a.2.3.1 (A:8-88) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  32  8.KKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSAEECMQKFIEIDQAWKILGNEETKKKYDL...... 79
6 -33.700d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]}  ali model 3D-neighbors follow..  14  9DKERLLELLKLPRQLDFGRMQQAYKQQSLLLHPDKGGS---HALMQELNSLWGTFKTEVYNLRMNLGGTGFQ 79
7 -30.700d1iura1 a.2.3.1 (A:14-88) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  26  2.LKEVTSVVEQAWKLPESERKKIIRRLYLKWHPDKNPEDIANEVFKHLQNEINRL---EKQAFLDQNAD... 68
8 -28.500d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]}  ali model 3D-neighbors follow..  15  6ESLQLMDLLGLERSAWGNLMRKAYLKKCKEFHPDKGGD---EEKMKKMNTLYKKMEDGVKYAHQPDFGGFWD 76
9 -18.100d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  27  2...DYFTLFGLPAQLDTQALSLRFQDLQRQYHPDKFASGSQAEQ-ATINQAWQTLRHPLMRAEY........ 70
10 -11.300d2qwob_ a.2.3.1 (B:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  20  36.....WKPVGMADLVTPEQVKKVYRKAVLVVHPCKATGQPAKMIFMELNDAWSEFENQ.............. 92
11 -11.000d3ag7a1 a.2.3.0 (A:551-650) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  20  38.....WKPVPLMDMIEGNAVRKSYQRALLILHPDKLQQKGAEKVFELLQEAWDHFNTL.............. 98

FFAS is supported by the NIH grant R01-GM087218-01
1 1 7 6 8 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.