current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d3iq0a_ c.72.1.0 (A:) automated matches {Escherichia coli [TaxId: 217992]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310
# Score Template Links and tools%idFirst SKVFTIGEILVEIMASKIGQPFDQPGIWNGPYPSGAPAIFIDQVTRLGVPCGIISCVGNDGFGDINIHRLAADGVDIRGISVLPLEATGSAFVTYHNSGDRDFIFNIKNAACGKLSAQHVDENILKDCTHFHIMGSSLFSFHMVDAVKKAVTIVKANGGVISFDPNIRKEMLDIPEMRDALHFVLELTDIYMPSEGEVLLLSPHSTPERAIAGFLEEGVKEVIVKRGNQGASYYSANEQFHVESYPVEEVDPTGAGDCFGGAWIACRQLGFDAHRALQYANACGALAVTRRGPMEGTSRLMEIETFIQRHLast
1 -118.000d3iq0a_ c.72.1.0 (A:) automated matches {Escherichia coli [TaxId: 217992]}  ali model 3D-neighbors  100  1SKVFTIGEILVEIMASKIGQPFDQPGIWNGPYPSGAPAIFIDQVTRLGVPCGIISCVGNDGFGDINIHRLAADGVDIRGISVLPLEATGSAFVTYHNSGDRDFIFNIKNAACGKLSAQHVDENILKDCTHFHIMGSSLFSFHMVDAVKKAVTIVKANGGVISFDPNIRKEMLDIPEMRDALHFVLELTDIYMPSEGEVLLLSPHSTPERAIAGFLEEGVKEVIVKRGNQGASYYSANEQFHVESYPVEEVDPTGAGDCFGGAWIACRQLGFDAHRALQYANACGALAVTRRGPMEGTSRLMEIETFIQRH 310
2 -99.400d3ljsa1 c.72.1.0 (A:12-338) automated matches {Xylella fastidiosa [TaxId: 183190]}  ali model 3D-neighbors follow..  24  2KTILCFGEALIDMLAQPLVK--KGMPRAFLQCAGGAPANVAVAVARLGGAVQFVGMLGSDMFGDFLFDSFAEAGVVTDGIVRTSTAKTALAFVALDAHGERSFSFYRPPAADLLFRVEHFQDASFSDALIFHACSNSMTDADIAEVTFEGMRRAQAAGAIVSFDLNFRPMLWPNENPASRLWKGLSLADVVKLSSEELDYLANTLDANAVIQQLWQGRAQLLLVTDAAGPVHWYTRTAGGEVPTFRVQVQDSNAAGDAFVGGMLYTFAQPESIVSTLRFAAAVGALAVTRQGAFTAMPMLSEVLSLIQEQ 326
3 -98.900d1tyya_ c.72.1.1 (A:) Aminoimidazole riboside kinase {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  26  1NKVWVIGDASVDLVPEKQNS--------YLKCPGGASANVGVCVARLGGECGFIGCLGDDDAGRFLRQVFQDNGVDVTFLRLDADLTSAVLIVNLTADGERSFTYLVHPGADTYVSPQDLP--PFRQYEWFYFSSIGLTDRPAREACLEGARRMREAGGYVLFDVNLRSKMWGNDEIPELIARSAALASICKVSADELCQLSGASHWQDARYYLRDLGCDTTIISLGADGALLITAEGEFHFPAPRVDVVDTTGAGDAFVGGLLFTLSRHALLAEAISNANACGAMAVTAKGAMTALPFPDQLNTFLS.. 304
4 -91.800d3pl2a_ c.72.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}  ali model 3D-neighbors follow..  22  4.EVLAIGRLGVDIYPLQSGVGLADVQSF-GKYLGGSAANVSVAAARHGHNSALLSRVGNDPFGEYLLAELERLGVDNQYVATDQTFKTPVTFCEIFPPDDFPLYFYREPKADLNIESADVSLDDVREADILWFTLTGFSEEPSRGTHR-EILTTRANRRHTIFDLDYRPMFWESEEATKQAEWALQHSTVAVGNKEECEIAVGETEPERAGRALLERGVELAIVKQGPKGVMAMTKDETVEVPPFFVDVINGLGAGDAFGGALCHGLLSEWPLEKVLRFANTAGALVASRLECSTAMPTTDEVEASLN.. 310
5 -91.500d3ewma1 c.72.1.0 (A:4-305) automated matches {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  28  1..IASIGELLIDLISVEEGD---KDVRLFEKHPGGAPANVAVGVSRLGVKSSLISKVGNDPFGEYLIEELSKENVDTRGIVKDEKKHTGIVFVQL-KGASPSFLLYD-DVAYFNMTLNDINWDIVEEAKIVNFGSVILARNPSRETVMKVIKKIKG-SSLIAFDVNLRLDLWRGEEMIKVLEESIKLADIVKASEEEVLYLENQGVEVK--------GSMLTAITLGPKGCRLIKNETVVDVPSYNVNPLDTTGAGDAFMAALLVGILKGLDLLKLGKFANLVAALSTQKRGAW-STPRKDELLKYKEAR 298
6 -88.000d3h49a_ c.72.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}  ali model 3D-neighbors follow..  21  3.DVICIGAAIVDIPLQPVSKNIFDVDSYIAMTTGGDAINEATIISRLGHRTALMSRIGKDAAGQFILDHCRKENIDIQSLKQDVSIDTSINVGLVTEDGERTF-VTNRNGSLWKLNIDDVDFARFSQAKLLSLASIFNSPLLDGKALTEIFTQAKARQMIICADM-IKPRLN---ETLDDICEALSYVDYLFPNFAEAKLLTGKETLDEIADCFLACGVKTVVIKTGKDGCFIKRGDMTMKVPAVAITAIDTIGAGDNFASGFIAALLEGKNLRECARFANATAAISVLSVGATTGVKNRKLVEQL.... 307
7 -87.800d2v78a_ c.72.1.1 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  27  2.DVIALGEPLIQFNSFNPG-PLRFVNYF-EKHVAGSELNFCIAVVRNHLSCSLIARVGNDEFGKNIIEYSRAQGIDTSHIKVDNESFTGIYFIQYPIPMKSELVYYRKGSAGSRLSPEDINENYVRNSRLVHSTGITAISDNAKEAVIKAFELAKS----RSLDTNIRPKLWSSEKAKETILSILKKYDILITDPDDTKILLDVTDPDEAYRKYKELGVKVLLYKLGSKGAIAYKDNVKAFKDAYKVPVEDPTGAGDAMAGTFVSLYLQGKDIEYSLAHGIAASTLVITVRGDNELTPTLEDAERFLNEF 310
8 -84.000d2qcva_ c.72.1.0 (A:) automated matches {Bacillus halodurans [TaxId: 272558]}  ali model 3D-neighbors follow..  21  11.DLIAIGRACIDLNAVEYNRPMEETMTF-SKYVGGSPANIVIGSSKLGLKAGFIGKIADDQHGRFIESYMRGVGVDTSNLVVDQEHKTGLAFTEIKSPEECSILMYRQDVADLYLSPEEVNEAYIRRSKLLLVSGTALSKSPSREAVLKAIRLAKRNDVKVVFELDYRPYSWETEETAVYYSLVAEQSDIVIGTREEFDVLENRTDNDETIRYLFKHSPELIVIKHGVEGSFAYTKAGEARGYAYKTKVLKTFGAGDSYASAFLYALISGKGIETALKYGSASASIVVSKHSSSDAMPSVEEIEALIEKD 324
9 -82.400d4du5a_ c.72.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}  ali model 3D-neighbors follow..  28  3.DVITFGEAMMLLVADRPG-PLEHAEAF-HKRTAGAETNVAIGLARLGLKVGWASRLGTDSMGRYLLAAMAAEGIDCSHVVCDATQKTGFQFKGKVTDGDPPVEYHRKGSAASHMGVADIDEAWLLSARHLHATGVPAISATTLPAARKTMDLMRAAGRSVSFDPNLRPTLWATELMRDAINDLATRADWVLPGMEEGRFLTGETTPEGVARFYRQLGAKLVVVKLGAEGAYFDGEAGSGRVAGFPVEVVDTVGAGDGFAVGVISALLDGLGVPEAVKRGAWIGARAVQVLGDSEGLPTRAELNA..... 308
10 -81.500d1v19a_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  28  3.EVVTAGEPLVALVPQEPG-HLRGKRLL-EVYVGGAEVNVAVALARLGVKVGFVGRVGEDELGAMVEERLRAEGVDLTHFRRAP-GFTGLYLREYLPLGQGRVFYYRKGSAGSALAPGAFDPDYLEGVRFLHLSGIPALSPEARAFSLWAMEEAKRRGVRVSLDVNYRQTLWSPEEARGFLERALPGVDLLFLSEEEAELLFG-----RVEEALRALSAPEVVLKRGAKGAWAFVDGRRVEGSAFAVEAVDPVGAGDAFAAGYLAGAVWGLPVEERLRLANLLGASVAASRGDHEGAPYREDLEVLLK.. 302
11 -74.900d2qhpa_ c.72.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}  ali model 3D-neighbors follow..  19  2NIIVGMGEALWDVLPE-------------GKKIGGAPANFAYHVSQFGFDSRVVSAVGNDELGDEIMEVFKEKQLKNQIERVD--YPTGTVQVTLDDEGVPCYEIKEGVAWDNIPFTDEL-KRLALNTRAVCFGSLAQRNEVSRATINRFLDTMPDIGQLKIFDINLRQDFYT----KEVLRESFKRCNILKINDEELVTISPGIDLQDKCWILLAKNLKMLILTCGINGSYVFTPGVVSFQETPKVPVADTVGAGDSFTAAFCASILNGKSVPEAHKLAVEVSAYVCTQSGAMPELPVILKDRLL.... 294
12 -61.700d3kd6a1 c.72.1.0 (A:2-300) automated matches {Chlorobaculum tepidum [TaxId: 1097]}  ali model 3D-neighbors follow..  21  1.SLLVIGSLAFDDIETPFGR--------SDNTLGGSSTYIALSASYFTDEIRMVGVVGSD-FGKEHFDLLHAKNIDTRGIQVIEDGKTFRWAGRYHYDMNTRDTLD--TQLNVFAEFDPHVPQYYRDSKFVCLGNID-------ELQLKVLDQIDDPKLVVCDTMNFWI-----EGKPEELKKVLARVDVFIVNDSEARLLSGDPNLVKTARIIREMGPKTLIIKKGEHGALLFTDNGIFAAPAFPLESIDPTGAGDTFAGGFIGHLARCAEMRKAVLYGSAMASFCVEQFGPYRYNDDLLEVDDRYQS. 294
13 -59.800d2rbca_ c.72.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}  ali model 3D-neighbors follow..  17  3KHVLCVGAAVLDTLFRVADMPKGEGKVLPYEVAEGMASSAAYAVHRMGGRASLWGAVGDDETGTRILRDLSESGIDTSGMTVAPGARSALSTIIIDNRGERLIVPFYDHRLHE--KKRACTPEDIALFDAV------LVDVRWPELALDVLTVARALGKPAILDG--------DVAPVETLEGLAPAATHIVFSEPAATRLTGLETVKDMLPVLHARYPQFIAVTAGPAGCWWTEADDPTFQTTMQVEAVDTLAAGDIFHGTFALAMAEGMQSRAAVRLSSVAAALKCTVFGGRIGAPTREETEEAMRQW 302
14 -59.600d1rkda_ c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  24  2GSLVVLGSINADHILNLQSFPTPGETVTGNHYFGGKGANQAVAAGRSGANIAFIACTGDDSIGESVRQQLATDNIDITPVSVIKGESTGVALIFVNGEGENVIGIH--AGANAALSPALVERERIANASAL------MQLESPLESVMAAAKIAHQNKTIVALNP---------APARELPDELLALVDIITPNETEAEKLTGDEDAAKAAQVLHEKGIRTVLITLGSRGVWASVNGEGQRVPGFRVQAVDTIAAGDTFNGALITALLEEKPLPEAIRFAHAAAAIAVTRKGAQPSVPWREEIDAFLDRQ 305
15 -57.200d2fv7a1 c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  2AAVVVVGSCMTDLVSLKTGETIHGHK--FFIGFGGKGANQCVQAARLGAMTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTASIIVNNEGQNIIVIV--AGANLLLNTEDLRANVISRAKVM------CQLEITPATSLEALTMARRSGVKTLFNP--------APAIADLDPQFYTLSDVFCCNESEAEILTGAADAGEAALVLLKRGCQVVIITLGAEGCVVLSQTEPKHIPTEKVKAVDTTGAGDSFVGALAFYLYPNLSLEDMLNRSNFIAAVSVQAAGTQSSYPYKKDLPLTL... 307
16 -57.100d3ry7a_ c.72.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93062]}  ali model 3D-neighbors follow..  22  2NKVVILGSTNVDQFLTQPGETLH-VEEAQKAFGGGKGANQAIATARMQADTTFITKIGTDGVADFILEDFKVAHIDTSYIIKTAEAKTGQAFITVNAEGQNTIYVY--GGANMTMTPEDVIKDAIINADFV------AQLEVPIPAIISAFEIAKAHGVTTVLNP---------APAKALPNELLSLIDIIVPNETEAELLSGEQSMKDNANYFLSIGIKTVLITLGKQGTYFATKNQSQHIEAYKVNAIDTTAAGDTFIGAFVSRLNKSQDLADAIDFGNKASSLTVQKHGAQASIPLLEEVNQV.... 303
17 -54.500d3kzha_ c.72.1.0 (A:) automated matches {Clostridium perfringens [TaxId: 1502]}  ali model 3D-neighbors follow..  13  4PYLLVFGASVVDVFGFSKASYRPYNST-VKISFGGVCRNIAENMARVGVNTNFMSILGNDEHGKSIVEHSKKIGYHMDDSMVIEGGSTPTYLAILDENGEMVS------AIADMKSIGAMNTDFIDSKREIFENAEYTVLDSDNPEIMEYLLKNFKDKTNFILDP--------SAEKASWVKHLIKDFHTIKPNRHEAEILAGTDDLIKASNYFLGLGIKKVFISLDADGIFYNDGVSCGKIKATEVDVKNVTGAGDSFVAGLGYGYMNKMPIEDIVKFAMTMSNITISHEETIHPDMALDTVLAKLEKT 307
18 -53.500d2c4ea_ c.72.1.0 (A:) automated matches {Methanococcus jannaschii [TaxId: 2190]}  ali model 3D-neighbors follow..  18  5EKITCVGHTALDYIFNVEKFPEPNTSIQARKYYGGAAANTAVGIKKLGVNSELLSCVGYDFKNSGYERYLKNLDINISKLYYSEEEETPKAWIFTDKDNNQITFFL--WGAAKHYKELNPPNF----------TEIVHIATGDPEFNLKCAKKAYGNN-LVSFDPGQDLPQYSKEMLLE----IIEHTNFLFMNKHEFERASNLLNFEID----YLERVDALIVTKGSKGSVIYTKDKKIEIPCIKAKVIDPTGAGDSYRAGFLSAYVKGYDLEKCGLIGAATASFVVEAKGCQTNLPTWDKVVERLEKH 299
19 -52.400d1vm7a_ c.72.1.1 (A:) Ribokinase {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  25  3LVISVVGSSNIDIVLKVDHFTKPGETQKMNVFPGGKGANQAVTVAKIGEKCRFVTCIGNDDYSDLLIENYEKLGITGYIR---VSLPTGRAFIEVDKTGQNRIIIF--PGANAELKKELIDWNTLSESDILLL--------QNEIPFETTLECAKRFNGIVIFDP---------APAQGINEEIFQYLDYLTPNEKEIEALSKFLTVEKAAEKFLELGVKNVIVKLGDKGVLLVNKNEKKHFPTFKVKAVDTTAAGDVFNGAFAVALSEGKNPEEAVIFGTAAAAISVTRLGAQSSIPAREEVEAFLKN. 298
20 -51.200d3ikha1 c.72.1.0 (A:2-285) automated matches {Klebsiella pneumoniae [TaxId: 272620]}  ali model 3D-neighbors follow..  21  1.RVYVTGNITVDETWSKKGASIHGVK--VSQDIGGKGANQAIILSRCGIETRLIAATGNDSNGAWIRQQIKNEPLMLLPDGHFNQ-HSDTSIILNSADGDNAIITT--TAAADTFSLDEMIPADAVAGDIL------QQGNFSLDKTRALFQYARSRGMTTVFNP---------SPVNPDFCHLWPLIDIAVVNESEAELLQP-------------YGVKTLVITQGAAGAWLVQEGQRQFCPAVPAEALDTTGAGDTFLAVMLASALLRAPDALALAHASRAAAITVSRRGTLSAFPGSRELAALLT.. 284
21 -50.300d2afba2 c.72.1.1 (A:1-331) 2-keto-3-deoxygluconate kinase {Thermotoga maritima, TM0067 [TaxId: 2336]}  ali model 3D-neighbors follow..  19  2.KVVTFGEIMLRLSPPD-HKRIFQTDSFDVTY-GGAEANVAAFLAQMGLDAYFVTKLPNNPLGDAAAGHLRKFGVKTDYIARGGNRIGIYFLEIGASQRPSKVVYDRAHSAISEAKREDFDEKILDGARWFHFSGIPPLGKELPLILEDALKVANEKGVTVSCDLNYRARLWTKEEAQKVMIPFMEYVDVLIANEEDIEKVLGREAYAKIAEEVTRKNFKTVGITLRESSVMVFENGQPHFSNRYEIHIVDRVGAGDSFAGALIYGSLMGFDSQKKAEFAAAASCLKHTIPGDFV-VLSIEEIEKLAS.. 330
22 -50.100d3ktna1 c.72.1.0 (A:2-336) automated matches {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  17  1.KIAAFGEVMLRFTPPE-YLMLEQTEQLRMNF-VGTGVNLLANLAHFQLETALITKLPANRLGEAGKAALRKLGISDQWVGEKGD-HIGSFFAEMGYGIRPTQVTYRHQSAFGISEAKDYDEAFLAEVDMVHICGISSLTEKTRDAALILAQKAHAYQKKVCFDFNYRPSLNTANSMRQQYERILPYCDIVFGSRRDLVELLGEAQETELIQRFMSQNLEWFAGTTRSHSQYLYTQNEYQQSEKRPLLNLDRIGAGDAYAAGILYGYSQNWSLEKAVTFATVNGVLAHTIQGDIP-LTTVKQVNHVLEHP 329
23 -48.800d2nwha_ c.72.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}  ali model 3D-neighbors follow..  16  2KKILVLGGAHIDRRGMIETETAPGASN-WMEEAGGGGFNAARNLSRLGFEVRIIAPRGGDVTGEVVAEAARQAGVEDTPFTFLDR-RTPSYTAILERDGNLVIAL-ADMDLYKLFTPRRLKVRAVRE--AIIASDFLLCDANLEDTLTALGLIARACEKPLAAIA--------SPAKAVKLKAALGDIDILFMNEAEARALTGEENVRDWPNILRKAGLSGGVVTRGASEVVAFNGTEKAIHPPLIREVKDVTGAGDAMASGYLAAIAEGKTIREALRQGAAAAAITVQSSFATSQDLSKDSVEAMLGL. 305
24 -48.200d1vk4a1 c.72.1.1 (A:1-281) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  14  2..ITFIGHVSKDVNVVDGK---------REIAYGGGVVMGAITSSLLGVKTKVITKCTREDVSKF--SFLRDNGVEVVFL---KSPRTTSIENRYGSDPDTRESFLI--SAADPFTESDLAF---IEGEAVHINPLW-----YGEFPEDLIPVLRRKVMFLSADAQGFVRVPENEKDWEMKEKYLKYLDLFKVDSREAETLTGTNDLRESCRIIRSFGAKIILAT-HASGVIVF-DGNFYEASFRSWSLEGRTGRGDTCTAAFLVGFVKKMSIEKATKFAAAVTSVKMRHPGP----LRREDLEAI.... 280
25 -47.600d4kala_ c.72.1.0 (A:) automated matches {Rhizobium etli [TaxId: 347834]}  ali model 3D-neighbors follow..  19  5.DVLTVGNAIVDLIDAERAELLYSRMGPALEASGGSAGNTAAGVANLGGKAAYFGNVAADQLGDIFTHDIRAQGVHYQTKPKGAFPPTARSMIFVTEDGERSMNTYL--GACVELGPEDVEADVVADAKVTYFEGYLWDPPRAKEAILDCARIAHQHGREMSMDSFC-------DRYRGEFLDLMGKVDIVFANRQEALSLYQTDDFEEALNRIAAD-CKIAAVTMSENGAVILKGRERYYVNAIRIEVVDTTGAGDLFASGFLYGYTQGRSLEDCGKLGCLAAGIVIQQIGPRPMTSLSEAAKQ..... 326
26 -45.400d3b1na_ c.72.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]}  ali model 3D-neighbors follow..  18  1.ATLICGSIAYDNIMTFEGRNLSFLVPTMRREFGGCAGNIAYALNLLGGDARMMGTLGAVDAQPY-LDRMDALGLSREYVRVLPDTYSAQAMITTDLDNNQITAFH--PGAMMQSHVNHAGE--------AKDIKLAIVGPDGFQGMVQHTEELAQAGVPFIFDPGQGLPLFDGATLRR----SIELATYIAVNDYEAKLVCDKTGWSED----IASRVQALIITRGEHGATIRHRDGTEQIPAVRAEVIDPTGCGDAFRGGLLYGIEHGFDWATAGRLASLMGALKIAHQGPQTYAPTRAEIDARFETA 305
27 -42.300d2pkfa1 c.72.1.0 (A:1-324) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  13  2.TIAVTGSIATDHLMRFPGRSLSFLVDDLVMHRGGVAGNMAFAIGVLGGEVALVGAAGADFAD--YRDWLKARGVNCDHVLISETAHTARFTCTTDVDMAQIASFY--PGAMSEARNIKLADV----VSAIGKPELVIIGANDPEAMFLHTEECRKLGLAFAADPSQQLARLSGEEIRR----LVNGAAYLFTNDYEWDLLLSKTGWSEA----VMAQIDLRVTTLGPKGVDLVEPDGTTIHVVPETSQTDPTGVGDAFRAGFLTGRSAGLGLERSAQLGSLVAVLVLESTGTQEWQWDYEAAASRLAGA 310
28 -41.100d2absa1 c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma gondii [TaxId: 5811]}  ali model 3D-neighbors follow..  20  5.RVFAIGNPILDLVAEVPSSFLDEFFLKRGDAPGGSALNSVRVVQKLPGSAGYMGAIGDDPRGQVLKELCDKEGLATR-FMVAPGQSTGVCAV-LINEKERTLCTHL--GACGSFRLPEDWTTFASGALIFYATAY-TLTATPKNALEVAGYAHGIPNAIFTL--NLSAPF--VELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAAEKTALSSATKLVVMTRGHNPVIAAEQTADGTVVVHEVKIVDTNGAGDAFVGGFLYALSQGKTVKQCIMCGNACAQDVIQHVGF................. 345
29 -41.000d1bx4a_ c.72.1.1 (A:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  5.ILFGMGNPLLDISAVVDKDFLDKYS--VEYHAGGSTQNSIKVIQQPHKAATFFGCIGIDKFGEILKRKAAEAHVDAH-YYEQNEQPTGTCAACITGDNRSLIANLA--AANCYKKEKHLDLELVEKARVCYIAGFFLTVSP--ESVLKVAHHASENNRIFTLNLS---APFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFEQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQEIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGC--TFPEKPDFH...... 342
30 -39.800d3otxa_ c.72.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}  ali model 3D-neighbors follow..  15  4.RVYVQCNPLLDVSAHVSDEFLVKYG--VRYVPGGSGLNVARVAAYKGKFVTYVGCIADDRYGKVLKEAAEHEGIVMA-VEHTTKAGSGACAV-CITGKERTLVADL--GAANHLSSEHMRSPAMDESRIFYFSGFTLTVDV--NHVLQACRKAREVDGLFMINLS---APFIMQFFSAQLGEVLPYTDIIVANRHEAKEFANMMKWDTSEVPYTGTKGRVVVFTRDIESTVLATKDGVETVPVPQLKVIDMNGAGDAFMGGFLSAYAVGKDLRRCCETGHYTAQEVIQRDGC................. 332
31 -39.500d3vasa_ c.72.1.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}  ali model 3D-neighbors follow..  17  6.YVFGMGNPLLDIIVDADDFMYRKYN--LNYIAGGATLNTVKMIQWIIQKCSYVGCIGADIQGKYIKNDCSALDLVTEFQIAEEPLMTGKVAV-LVSEKLRSMVTYL--GAACDLSLAHIEQSLVEKAQVYYIAGFVI--NTCYEGMLKIAKHSLENEKLFCF--NLSAPF--SQFNTKEVDEMISYSNIVFGNESEAEAYGEVHGLLEDTVHATARYIRLVIITRGKNPLLYTDSSDS-EIHQFMVQIIDTNGAGDAFAAGFIADYIRGKPMITSLHAAVKAAAYIICRSGF................. 336
32 -30.100d3umoa_ c.72.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  37................................PGGGGINVARAIAHLGGSATAIFPAGGAT-GEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEEQVLEIESGAILVISG-SLPPGVKLEKLTQLISAAQKQGIRCIVDSS------------EALSAALAIGNLVKPNQKELSALVNRDDVRKAAQEIVNSGAKRVVVSLGPQGALGVDSENCIQVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQG--TRLCSHDDTQKIYAY. 306
33 -29.400d3ie7a1 c.72.1.0 (A:2-308) automated matches {Listeria innocua [TaxId: 1642]}  ali model 3D-neighbors follow..  17  3..TITLNPAIDRLLFIRGELEKRKTNRVIKFDCGGKGLHVSGVLSKFGIKNEALGIAGSDN-LDKLYAILKEKHINHDFLVEAGT-STRECFVVLSDDTNGSTMIPEAGFTVSQTNKDNL-AKKVKKEDMVVIAG-SPPPHYTLSDFKELLRTVKATGAFLGCDNS------------EYLNLAVEMGDFIKPNEDEVIAILDEKNSLEENIRTLAEKIPYLVVSLGAKGSICAHNGKLYQVIPPKVQERNDTGAGDVFVGAFIAGLAMNMPITETLKVATGCSASKVMQQDS--SSFDLEAAGKLKNQ. 300
34 -26.800d2f02a2 c.72.1.0 (A:2-315) automated matches {Enterococcus faecalis [TaxId: 226185]}  ali model 3D-neighbors follow..  14  32..............................KTPGGKGLNVTRVIHDLGGDVIATGVLGGFH-GAFIANELKKANIPQAFTSIKEETRDSIAILHEGNQTE--------LEAGPTVSPEEISDQLIKQAEIVTISG-SLAKGLPSDFYQELVQKAHAQEVKVLLD--------TSGDSLRQVLQGPWKPYLIKPNLEELEGLLGQAAVQTALTKPMFAGIEWIVISLGKDGAIAKHHDQFYRVKIPTIQAKNPVGSGDATIAGLAYGLAKDAPAAELLKWGMAAGMANAQERMT--GHVDVENVKKHLMN. 304
35 -23.400d2jg5a_ c.72.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  16  11..........IDYVIFTNDFKIDGLNRATATFAGGKGINVSRVLKTLDVESTALGFAGG---GKFIIDTLNNSAIQSNFIEVDEDTRIN---VKLKTGQETEINAPGPHITSTQFEQLLQQIKNTTSEDIVIVAG-SVPSSIPSDAYAQIAQITAQTGAKLVVDAE-----------KELAESVLPYHPFIKPNKDELEVMFNTADVIKYGRLLVDKGAQSVIVSLGGDGAIYIDKEISIKAVNPQGKVVNTVGSGDSTVAGMVAGIASGLSIEKAFQQAVACGTATAFD----EDLATRDAIEKIKSQ. 297
36 -21.400d2ajra2 c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  14  38................................PGGKGINVSIALSKLGVPSVATGFVGGYM-GKILVEELRKKLITTNFVYVEGETRENIEIIDEKNKTITAI-----NFPGPDVTDMDVNKMTLSKVDCVVISG-SIPPGVNEGICNELVRLARERGVFVFVE--------QTPRLLERIYEGPEFPNVVKPDLRG---LKTFDDYVKLAEKLAEKSQVSV-VSYEVKNDIVATREGVWLIRS-EIDTSHLLGAGDAYVAGMVYYFIKGANFLEMAKFGFASALAATRRKE--KYMPDLEAIKKEYDH. 312
37 -14.000d4c5ka1 c.72.1.0 (A:2-276) automated matches {Staphylococcus aureus [TaxId: 158878]}  ali model 3D-neighbors follow..  16  6.....................................................LTIAGSDTSA--------GAGMQADLKTFQELDTYGMVALTAIVTMDKDTWSHDVTPLPMDVFEKQLETALSIGPDAIKTGMLG--TEEIIKRAGEVYEASNAQYFVV--DPVMEDEVLNPGNTEAMIKYLLPKATVVTPNLFEAGQLSGIEDMKKAATIIFDKGAQHVIIKGGKA--LYYDGQTFYQLTTDMFQQSYNHGAGCTFAAATTAYLANGKSPKEAVISAKAFVASAIK..................... 245
38 -13.900d1ub0a_ c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  15  5.....................................................LTIAGSDSGGQADLKVFFRFGVYGTSALTLVTAQNTLGVQRVHL--PPEVVYAQIESVAQDFPLHAAKTGALGDAAIVEAVAEAVRRFGVRPLVVDPVMVAKSGD-----------PLLAKEAAAALKERLFPLADLVTPNRLEAEALLGLKEAEEAAKALLALGPKAVLLKGGEAVDLLATRGGVLRFSAPRVHTRNTHGTGCTLSAAIAALLAKGRPLAEAVAEAKA............................ 235
39 -13.100d4s1ha1 c.72.1.0 (A:1-279) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}  ali model 3D-neighbors follow..  15  15......................................................GFVGN----RCGMIILDSFQIQSIFV-------LTTHLAN--HTGYPVVGGSGVLLNDFISIMDSLEVNHLDKDIEFLVTGYFPSSDLVYETINRVKRIKDNKKVYFLCDPILNGKMYTKSEVQDSMKELIKYADIITPNATELSFLTGLSEAIKACHILHEQGIPVILVTSIKEGSFKDTLNNKNFTIKIPRIEGDFTGVGDTLTYILLSWIIKGIPLEHAVNRAISTLQTILRNTVGTAEINIINCIPYLKG.. 269
40 -12.300d3pzsa_ c.72.1.5 (A:) automated matches {Yersinia pestis [TaxId: 214092]}  ali model 3D-neighbors follow..  17  13......................................................GHAGN----SAAEFPMRRMGVNVWPL-------NTVQFSNHTQYGH----------TGCVMPASHLTDIVIADIDRLKDCDAVLSSPEQGSHILAAVAQVKQANPDAWYDPHPEKGCIVAPGVAEFFCNALPASDMIAPNLLELEQLSGEEQAVQVARSLCARGPKVVLVKHDCFEMLLVTADDAWHICRPLVDFGKRVGVGDLTSGLLLVNLLKGEPLDKALEHVTAAEVMLKTQEMGEYELQVVAAQETIVTPI 277
41 -9.940d3zs7a_ c.72.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 185431]}  ali model 3D-neighbors follow..  19  16......................................................GYVGN----KAATFPLQLHGFDVDGI-------NTVCLSNHSGYPVIRGHRMSLQEYDELMEGVRANNFLSNYRYIL-YINNVDIIGRIRDTLKEVRELREKEDKKLTFDPVMDGIMYCKKEVLDAYRELVPLADIVTPNYFEASLLSGVSSAILAADWFHNCGVAHVIIKS----SVKEGSEAAVRRFSGVVPYHEGTGTGDVF-AACLLAFSHSHPMDVAIGKSMAVELIIATRKEGGDGKSSLKSRELRV... 280
42 -9.170d1lhpa_ c.72.1.5 (A:) Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940]}  ali model 3D-neighbors follow..  14  14......................................................GYVGN----RAATFPLQVLGFEVDAV-------NSVQFSN--HTGYSHWKGQVLNSDELQELYDGLKLNHVNQYDYVLTGYTR--DKSFLAMVVDIVQELKQQNPRLVYDPVMEGAMYVPDDLLPVYREVVPVADIITPNQFEAELLTGREEALEVMDMLHSMGPDTVVITLGSQRTRAPDGSVVTQRIRMEMHKVDAVGTGDLFAAMLLAWTHKHNNLKVACEKTVSA........................... 259
43 -9.070d1ua4a_ c.72.1.3 (A:) ADP-dependent glucokinase {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  11  80...IRRGKAAELFVESCPVRFYMKRWGWNELRMGGQAGIMANLLGGVYGVPVIVHVPQLSRLQANLFLPKEFSGDEENCIHYIYEFPRGFRVFEFEAPRENRFIGSADDYNTTLFIREEFREEVIKNVQLAILSGLQALTKEPFEIVKSNLEVLNEREIPVHLE----FAFTPDEKVREEILNVLGMFYSVGLNEVELASIMEILGEKKLAKELLAHDPV-----------------DPIAVTEAMLKLAKKTGVKRIHFHTYGYYLALTEYKGEHVRDALLFAALAAAAKAMKGNITSLEEIREATS.. 388

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.