current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2o14a2 c.23.10.8 (A:160-367) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst VTNRTIYVGGDSTVCNYYPLNSSKQAGWGQMLPHYIDKHTFQVRNMASGGQIARGFRNDGQLEAILKYIKPGDYFMLQLGINDTNPKHKESEAEFKEVMRDMIRQVKAKGADVILSTPQGRATDFTSEGIHSSVNRWYRASILALAEEEKTYLIDLNVLSSAYFTSIGPERTLGLYMDGDTLHPNRAGADALARLAVQELKRQGIAGFLast
1 -104.000d2o14a2 c.23.10.8 (A:160-367) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors  100  1VTNRTIYVGGDSTVCNYYPLNSSKQAGWGQMLPHYIDKHTFQVRNMASGGQIARGFRNDGQLEAILKYIKPGDYFMLQLGINDTNPKHKESEAEFKEVMRDMIRQVKAKGADVILSTPQGRATDFTSEGIHSSVNRWYRASILALAEEEKTYLIDLNVLSSAYFTSIGPERTLGLYMDGDTLHPNRAGADALARLAVQELKRQGIAGF 208
2 -80.900d1k7ca_ c.23.10.4 (A:) Rhamnogalacturonan acetylesterase {Fungus (Aspergillus aculeatus) [TaxId: 5053]}  ali model 3D-neighbors follow..  24  1...TTVYLAGDSTMAKNG--GGSGTNGWGEYLASYLS---ATVVNDAVAGRSARSYTREGRFENIADVVTAGDYVIVEFGHNDGGSLSTETILTFPAYLENAAKLFTAKGAKVILSSQTPNNPW--ETGTFVNSPTRFVEYAELAAEVAGVEYVDHWSYVDSIYETLGNATVNSYFP-IDHTHTSPAGAEVVAEAFLKAVVCTGTS.. 218
3 -31.200d1yzfa1 c.23.10.5 (A:1-195) Lipase/acylhydrolase {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  18  3....KIVLFGDSITAGYLDEAVSP--VLVDLVKRDIAAEEVAVINAGMPGDTTEDGLK--RLNKEVLIEKP-DEVVIFFGANDASLDRNITVATFRENLETMIHEIGSEKVILITPPYADSGRRPERPQTRIK---ELVKVAQEVGAAHNLPVIDL-------YKAMTVYPGTDEFLQADGLHFSQVGYELLGALIVREIKGR..... 189
4 -28.500d3rjta1 c.23.10.0 (A:1-213) automated matches {Alicyclobacillus acidocaldarius [TaxId: 521098]}  ali model 3D-neighbors follow..  15  7....KLVMVGDSITPVGEAPRGGLGNGYVALVDAHLQVLRIRVVNVGTSGNTVADVAR--RWEDDVMALQP-DYVSLMIGVNDLVVERHVGIDEYRDTLRHLVATTKPRVREMFLLSPFYLEP--NRSDPMRKTVDAYIEAMRDVAASEHVPFVDVQAEFDRLLAHLNTW-----VLAPDRVHPYLNGHLVIARAFLTAV........ 210
5 -28.000d4rw0a1 c.23.10.0 (A:1-182) automated matches {Veillonella parvula [TaxId: 479436]}  ali model 3D-neighbors follow..  20  2....EIICFGDSITRGY---DVPYGRGWVEICDASI--ENVNFTNYGEDGCSVQGMIYNIENWAVTAVSDPTRHIFLMCGTND----QGRDSTYVYKTLVKAIELASTKGMVIIGLETQIDSDM----DGLDLVVREVNEQLKAYAAEHNIKVID-------FYTTLFEADQIGQIVFAGEVHPNERGYRLMAYKALEVFTRL..... 182
6 -27.800d3bzwa1 c.23.10.9 (A:38-285) Uncharacterized protein BT2961 {Bacteroides thetaiotaomicron [TaxId: 818]}  ali model 3D-neighbors follow..  14  6WQGKKVGYIGDSITDPNCYGDNI-----KKYWDFLKEWLGITPFVYGISGRQWDDVPRQAE-KLKKEHGGEVDAILVFMGTNDKKRTPVMTQDTYRGRINIGITQLKKLDKQIVLLTPLHRQPDESYQNGCGEYIDAYVQAIKEAGNIWGIPVIDFNAVT-GMNPMVEEQLIYFYDAGYDRLHPDTKGQERMARTLMYQLLALPV... 246
7 -27.200d4rsha_ c.23.10.0 (A:) automated matches {Desulfitobacterium hafniense [TaxId: 272564]}  ali model 3D-neighbors follow..  16  2...TKVVAIGDSFTFGY---PGNTENSWPAVLGQTSQ---IEVVNKGLKSQTAQDLYS--RFDADVLAEKP-GRVIIFVGNGD----KEVPLETFQQHIKAMVEKAESNHIIPILALPLPYTG-------VQNTIKEFREWESSYAKEKNILVLDFATVLMD-----ADNVYLEGLLSKEANYPSKEGYKLMGEYASRVL........ 175
8 -27.200d3dc7a1 c.23.10.9 (A:18-224) Uncharacterized protein Lp3323 {Lactobacillus plantarum [TaxId: 1590]}  ali model 3D-neighbors follow..  14  2VSFKRPAWLGDSITANNGLATV----HYHDILAADW--DVERSDNLGISGSTIGS-RYDAMAVRYQAIPEDADFIAVFGGVNDYGRDGDCDMTTFYGALMMLLTGLQTNTVPKLFISAIHIGSFSAVTNGLGYRQSDYEAAIAQMTADYGVPHLSLYRDAG-------AIPAQAAIYSVDTLHPNNAGHRVIARKLQSFLDS...... 205
9 -25.100d4q9aa_ c.23.10.0 (A:) automated matches {Parabacteroides merdae [TaxId: 411477]}  ali model 3D-neighbors follow..  19  8.KDCVILFQGDSITRNSNRCNTMEQFGSGTQLLEGKAALQPKIYNRGISGNKVYQLRE--RWEIDCLAFQP-DVLSILIGVND-THGYKGTVETYENDLRALLKYTKEKNTQIVLCEPTLRDGAAIEDSKWYPMFDEFRKSARKLSEEFNTIFVPFQSGFDAAVKLAPAR-----YWSNDGVHPDLPGRQLMANMWMEAT........ 216
10 -23.700d1z8ha_ c.23.10.6 (A:) Hypothetical protein alr1529 {Nostoc sp. PCC 7120 [TaxId: 103690]}  ali model 3D-neighbors follow..  18  3.TQIRICFVGDSFVNGTGDPECL---GWTGRVCVNANKKDVTYYNLGIRRDTSSDIAKRWLQEVSLRLHKEYSLVVFSFGLNDENGKPRVSIAETIKNTREILTQAKKL--YPVLMISPA-----QQDPGRRRRTIDLSQQLALVCQDLDVPYLDVFPLLEK------PSVWLHEAKANDGVHPQAGGYTEFARIVEN.......... 193
11 -21.700d3hp4a_ c.23.10.0 (A:) automated matches {Pseudoalteromonas sp. [TaxId: 336179]}  ali model 3D-neighbors follow..  18  3....TILILGDXLSAAY---GLQQEEGWVKLLQDKYDAEDIVLINASISGETSGGALR--RLDALLEQYEP-THVLIELGANDG---RGFPVKKMQTNLTALVKKSQAANAMTALMEIYIPPNYGPR------YSKMFTSSFTQISEDTNAHLMNF----------MLDIAGKSDLMQNDSLHPNKKAQPLIRDEMYDSIKKW..... 180
12 -21.300d4iyja_ c.23.10.0 (A:) automated matches {Bacteroides uniformis [TaxId: 411479]}  ali model 3D-neighbors follow..  17  26KQKDRVVFMGNSITE-----------GWVANDAAFFEDNGYV--GRGIGGQTSSHFLL--RFREDVIKLAP-ALVVINAGTNDAENAGAYNEEYTFGNIVSMVELARANKIKVILVLPAAAFGWNPSVKDAPQKIMQLNARIRKYAQENKIPYVDYYSEMVE-----GDNKALNSSYTRDGVHPTLEGYKVMEALIKKAIDKV..... 210
13 -16.700d1es9a_ c.23.10.3 (A:) Platelet-activating factor acetylhydrolase {Cow (Bos taurus), alpha1 [TaxId: 9913]}  ali model 3D-neighbors follow..  16  33.KEPEVVFIGDSLVQLMHQCEI-----WRELFS------PLHALNFGIGGDSTQHVLWR---NGELEHIRP-KIVVVWVGTNNHG----HTAEQVTGGIKAIVQLVNERQARVVVLGLLPRGQHPNPLREKNRRVNELVRA--ALAGHPRAHFLDADPGF------VHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRL..... 211
14 -15.500d2hsja1 c.23.10.3 (A:1-211) Uncharacterized protein SP1450 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}  ali model 3D-neighbors follow..  18  29VVEPNILFIGDSIVEYYPLQELFG--------------TSKTIVNRGIRGYQTGLLLE--NLDAHLYGGAV-DKIFLLIGTND---GKDVPVNEALNNLEAIIQSVARD-LLSILPVNEREEYQQAVYIRSNEKIQNWNQAYQELASAYQVEFVPVFDCLTDQAGQLKKEYTT------DGLHLSIAGYQALSKSLKDYL........ 210
15 -13.300d1zmba1 c.23.10.7 (A:1-282) Acetylxylan esterase related enzyme {Clostridium acetobutylicum [TaxId: 1488]}  ali model 3D-neighbors follow..  4.....SFLLGQSNMADRPVSGISLAGSFADAWSQKNQEDIIGLIPCAEGGSSIDEWALDGVLTEAKFAMESSELTGILW-HQGESDSLNGNYKVYYKKLLLIIEALRKEPDIPIIIGGLGDFLGKERFGKGCTEYNFINKELQKFAFE---------------QDNCYFVTASGLTCNPDGIHIDAISQRKFGLRYFEAFFNR..... 227
16 -10.200d2apja1 c.23.10.7 (A:17-260) Putative acetylxylan esterase At4g34215 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  12  77......................GPGMAFANAVKNRLETDSIGLVPCASGGTAIKEWERGSHYERMVKRTEES--VLWYQGESDVLDI--HDAESYGNNMDRLIKNLRHDPSLPIIQVAIA-------------SGGGYIDKVREAQLGLKLS-------------NVVCVDAKGLPLKSDNLHLTTEAQVQLGLSLAQAYLSN..... 242

FFAS is supported by the NIH grant R01-GM087218-01
1 1 7 8 7 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Alonso A, Sasin J, Bottini N, Friedberg I, Friedberg I, Osterman A, Godzik A., Hunter T, Dixon J, Mustelin T. Protein tyrosine phosphatases in the human genome. Cell. 2004 Jun 11;117(6):699-711. Review.