current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2jlia_ d.367.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
1 -75.200d2jlia_ d.367.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}  ali model 3D-neighbors  100  1QFHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLR 100
2 -66.700d3t7ya_ d.367.1.0 (A:) automated matches {Chlamydia trachomatis [TaxId: 813]}  ali model 3D-neighbors follow..  29  2...........SSQIKHASAVVSAPKDIAVAIGYMPEKYKAPWIIAMGVNLRAKRIIAEAEKYGVPIMRNVPLAHQLLDEGKELKFIPETTYEAVGEIL. 89
3 -66.100g3bzy.1 d.367.1.1 (A:246-262,B:263-345) Type III secretion proteins EscU {Escherichia coli [TaxId: 562]}  ali 3D-neighbors follow..  41  1.......SGSLANNIKKSTVIVKXPTHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLDKNIHKGQYITEDFFEPVAQLIR 94
4 -63.500g2vt1.1 d.367.1.1 (A:237-257,B:258-338) Surface presentation of antigens protein SpaS {Shigella flexneri [TaxId: 623]}  ali 3D-neighbors follow..  31  1...IEILSEQTKSDIRNSKLVVMXPTHIAIGIYFNPEIAPAPFISLIETNQCALAVRKYANEVGIPTVRDVKLARKLYKTHTKYSFVDFEHLDEVLRLI. 97
5 -7.560d3bzwa1 c.23.10.9 (A:38-285) Uncharacterized protein BT2961 {Bacteroides thetaiotaomicron [TaxId: 818]}  ali model 3D-neighbors follow..  14  130....NIGITQLKKLFPDKQIVLLTPLHRSLANFGDKNVQPDESYCGEYIDAYVQAIKEAGNIWGIPVIDYDAGYDRLHPDTKGQERMARTLMYQLLAL.. 244
6 -7.550d1vcda_ d.113.1.1 (A:) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  22  4................GAGGVVFNAKREVLLLRDRMGFWVFPK-PEPGESLEEAAVREVWEETGVRAEVLLPLYPTRY...................... 66
7 -7.500d5cula_ d.367.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}  ali model 3D-neighbors follow..  70  5QFHQELQSSNLRADVRRSSVIVAN............................................................................ 28
8 -6.970d4kg3a_ d.113.1.0 (A:) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 559292]}  ali model 3D-neighbors follow..  11  1.............SIPVRGAAIFNENLSKILLGTESDSWSFPR-ISKDENDIDCCIREVKEQIGFDLTDYIDDNQFIERNIQ.................. 72
9 -6.960d1bdfa2 d.181.1.1 (A:53-178) RNA polymerase alpha subunit {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  66................DGDVEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPI................................. 116
10 -6.370d1iioa1 a.39.4.1 (A:1-81) Hypothetical protein MTH865 {Methanobacterium thermoautotrophicum [TaxId: 145262]}  ali model 3D-neighbors follow..  6...KEDIRGQIIGALAGADFPINSPEELMAALPNGPDTT----CKSGDVELKASDAGQVLTADDFPFKSAEEVADTIVNKAGL................. 81

FFAS is supported by the NIH grant R01-GM087218-01
1 0 1 6 1 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.