current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2j3xa1 d.166.1.0 (A:2-217) automated matches {Clostridium botulinum [TaxId: 1491]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst PIIKEPIDFINKPESEAKEWGKEEEKRWFTKLNNLEEVAVNQLKNKEYKTKIDNFSTDILFSSLTAIEIMKEDENQNLFDVERIREALLKNTLDRDAIGYVNFTPKELGINFSIRDVELDRDISDETLDKVRQQIINQEYTKFSFISLGLNDNSINESVPVIVKTRVPTTFDYGVLNDKETVSLLLNQGFSIIPESAIITTIKGKDYILIEGSLSQLast
1 -106.000d2j3xa1 d.166.1.0 (A:2-217) automated matches {Clostridium botulinum [TaxId: 1491]}  ali model 3D-neighbors  100  1PIIKEPIDFINKPESEAKEWGKEEEKRWFTKLNNLEEVAVNQLKNKEYKTKIDNFSTDILFSSLTAIEIMKEDENQNLFDVERIREALLKNTLDRDAIGYVNFTPKELGINFSIRDVELDRDISDETLDKVRQQIINQEYTKFSFISLGLNDNSINESVPVIVKTRVPTTFDYGVLNDKETVSLLLNQGFSIIPESAIITTIKGKDYILIEGSLSQ 216
2 -82.500d4h03a1 d.166.1.1 (A:1-209) automated matches {Clostridium perfringens [TaxId: 1502]}  ali model 3D-neighbors follow..  23  3..IERPEDFL-KDKENAIQWEKKEAERVEKNLDTLEKEALELYKKDSE--QISNYSQTRQYFYDY-----QIESNPREKEYKNLRNAISKNKIDKPINVYYFESPEKFAFNKEIRTEN-QNEISLEKFNELKETIQDKLFKQDGFKDVSLYEPGNEKPTPLLIHLKLPKNTGMLPYINSNDVKTLIEQDYSIKIDKIVRIVIEGKQYIKAEASIVN 209
3 -80.000d1qs1a1 d.166.1.1 (A:60-264) Vegetative insecticidal protein 2 (VIP2) {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  22  2...DKVEDFK-EDKEKAKEWGKEKEKEW--KLTATEKGKMNNFLDNKND-IKTNYKEITFSM--------AGSFEDEIKDLKEIDKMFDKTNLSNSIITYKNVEPTTIGFNKS---LTEGNTINSDAMAQFKEQFLDRDIKFDSYLDTHLTAQQVSSKERVILKVTVPSGKGSTTPTNNSEYKMLIDNGYMVHVDKVSKVVKKGVECLQIEGTLKK 205
4 -72.700d4h0ya2 d.166.1.1 (A:210-413) automated matches {Clostridium perfringens [TaxId: 1502]}  ali model 3D-neighbors follow..  19  3.......DFK-DDVSKGDLWGKENYSDWSNKLTPNELADVNDYMRGGYT-AINNYLISNG--------PLNNPNPELDSKVNNIENALKLTPIPSNLIVYRRSGPQEFGLTLTSPEYDFN---KIENIDAFKEKWEGKVITYPNFISTSIGSVNMFAKRKIILRINIPKDSPGAYLSYAGEYSVLLNHGSKFKINKVDSYKDGTVTKLILDATLIN 204
5 -72.400d1qs1a2 d.166.1.1 (A:265-461) Vegetative insecticidal protein 2 (VIP2) {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  19  3.......DFKNDINAEAHSWGMKNYEEWAKDLTDSQREALDGYARQDYK-EINNYLRNQG----------GSGNEKLDAQIKNISDALGKKPIPENITVYRWCGMPEFGYQISD---------PLPSLKDFEEQFLNTIKEDKGYMSTSLSSERLFGSRKIILRLQVPKGSTGAYLSFASEKEILLDKDSKYHIDKVTEVIIKGVKRYVVDATLLT 197
6 -70.500d1r45a_ d.166.1.1 (A:) Exoenzyme c3 {Clostridium botulinum C bacteriophage [TaxId: 12336]}  ali model 3D-neighbors follow..  18  1...DTFTEF--TNVEEAKKWGNAQYKKY--GLSKPEQEAIKFYTRD--ASKINGPLRANQGNE-------NGLPADILQKVKLIDQSFSKMKMPQNIILFRGDDPAYLGPEFQDKILNKDGTINKTVFEQVKAKFLKKDRTEYGYISTSLMSAQF-GGRPIVTKFKVTNGSKGGYIDFPGQLEVLLPRNNSYYISDMQI--SPNNRQIMITAMIFK 201
7 -68.600d1ojqa_ d.166.1.1 (A:) Exoenzyme c3 {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  13  1...AETKNF--TDLVEATKWGNSLIKSA--KYSSKDKMAIYNYTKN--SSPINTPLRSANGDV-------NKLSENIQEQVRQLDSTISKSVTPDSVYVYRLLNLDYLSSITGFTREDNNGQYNEALVSKLNNLMNSRIYRENGYSSTQLVSGAALAGRPIELKLELPKGTKAAYIDYPGQQEVLLPRGTEYAVGSVK--LSDNKRKIIITAVVFK 211
8 -68.600d4dv8a1 d.166.1.1 (A:265-550) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}  ali model 3D-neighbors follow..  15  76...KLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYDINQRLQDTGGLIDS-PSINLDVRKQYKRDIQNIDALLHQSTLYNKIYLYENMNINNLTATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSPDTRAGYLE---NGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVV. 286
9 -67.300d2j3xa2 d.166.1.0 (A:218-431) automated matches {Clostridium botulinum [TaxId: 1491]}  ali model 3D-neighbors follow..  13  5............YNKGSEAWGAENYGDYISKLSHEQLGALEGYLHSDYK-AINSYLRNNR----------VPNNDELNKKIELISSALSVKPIPQTLIAYRRVDGIPFDLPSDFSFDKKENGADKQKLNEFIDKWTGKEIENLSFSSTSLKSTPSFSKRRFIFRLRLSEGAIGAFIYFQDEQEILLNKNSTFKIFRITPITSIINRVTKMTQVVID 205
10 -62.500d4xsgb_ d.166.1.0 (B:) automated matches {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  14  4.........LCTNKEEADAWGKKQFNK----WSKEEKSAIRDYTKN--ARPYNEFLRMHAGKL--------DSDPTMKKKIESLDKALNRKKVNDNIKVYRGDDAWIFGKEYDNSIIK-NGKVDREKFKEIQKKFQGKTTTEFGYISTSILIDAGYATRPVMTEFKVGSGTHGAYMNYPGQYELLLPRNTVYKIEKIYIAIDNNTQKEQIKVEAT. 203
11 -32.700d1gxya_ d.166.1.3 (A:) Eukaryotic mono-ADP-ribosyltransferase ART2.2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  45............EEAKKRWNNIKPSRSYPKGFNDFHGTALVAYTGSIAV-DFNRAVREFK---------ENPGQFHYKAFHYYLTRALQLLSNGDCHSVYRGTKTR-------------------------FHYTGAGSVRFGQFTSSSLSKKVAQSDHGTLFIIKTCLGVYIKEFSRPDQEEVLIPGYEVYQKVRTQ.................. 201

FFAS is supported by the NIH grant R01-GM087218-01
9 9 0 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35