current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
1 -28.500d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1NCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKT 40
2 -17.000d2vj3a1 g.3.11.0 (A:411-452) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  30  10ANPCEHAGKCINTL---GSFECQCLQGYTGPRCEID.... 42
3 -16.300d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  11KTFCVNGGECVKDLSNPSRYLCKCQPGFTGARCTENVPMK 52
4 -16.000d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  43  8SNPCLNGGSCKDDI---NSYECWCPFGFEGKNCEL..... 39
5 -15.300d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  35  6NTSCSGHGECVETI---NNYTCKCDPGFSGLKCEQIV... 39
6 -14.500d1egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  28  11DGYCLNGGVCMH-IESLDSYTCNCVIGYSGDRCQTRDLRW 49
7 -11.900d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  26  13SLCCGHG-TCIDGI---GSFSCDCRSGWEGRFCQREVS.. 46
8 -11.700d2ayla2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]}  ali model 3D-neighbors follow..  25  7YYPCQHQGICVR--FGLDRYQCDCTRGYSGPNCTIP.... 41
9 -10.500d5e8da_ g.3.11.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  9NGYCLHGQCIY--LVDMSQNYCRCEVGYTGVRCE...... 40
10 -9.900d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  15...CFHGTCRF--LVQEDKPACVCHSGYVGARCE...... 43

FFAS is supported by the NIH grant R01-GM087218-01
1 0 7 2 9 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.