current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2fyia1 c.94.1.1 (A:88-307) LysR-type regulatory protein Cbl {Escherichia coli [TaxId: 562]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst TNDTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPHDHPLTQISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKRQVMESLast
1 -111.000d2fyia1 c.94.1.1 (A:88-307) LysR-type regulatory protein Cbl {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors  100  1TNDTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPHDHPLTQISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKRQVMES 220
2 -106.000d1al3a_ c.94.1.1 (A:) Cofactor-binding fragment of LysR-type protein CysB {Klebsiella aerogenes [TaxId: 28451]}  ali model 3D-neighbors follow..  40  1TWPDKGSLYVATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPEHPLATKGSVSIEELAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPVSDPDLVKLDANGIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALR 220
3 -51.400d1i6aa_ c.94.1.1 (A:) Hydrogen peroxide-inducible genes LysR-type activator OxyR, regulatory domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  20  1.ETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDAVILA-LVKESEAFIEVPLFDEPMLLAIYEDHPWANREAVPMADLAGEKLLMLEDGHCLRDQAMGFCFEAGADEDTHFRATSLETLRNMVAAGSGITLLPALAVPERKRDGVVYLPAIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRARMDG.......... 209
4 -50.800d3jv9a_ c.94.1.0 (A:) automated matches {Neisseria meningitidis [TaxId: 122586]}  ali model 3D-neighbors follow..  16  1....EGAFKLGLIFTVAPYLLPKLIVSLRRTAPKMPLMLEENYTHTLTESLKRGDVDAIIVA-EPFQEPGIVTEPLYDEPFFVIVPKGHSFEELDAVSPRMLGEEQVLLLTEGNCMRDQVLSSCSELAAKQRNTLQGSSINTIRHMVASGLAISVLPATALTENDHMLFSIIPFEGTPPSRRVVLAYRRNFVRPKALSAMKAAIMQ.............. 206
5 -50.500d1ixca2 c.94.1.1 (A:90-294) LysR-type regulatory protein CbnR {Ralstonia eutropha [TaxId: 106590]}  ali model 3D-neighbors follow..  15  2.....GELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFPR-HPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRG-SFADEVIGLFKHAGIEPRIARVVEDATAALALTMAGAASSIVPA-SVAAIRWPDIAFARIVGTRVKVPISCIFRKEK--PPILARFVEHVRRSAKD.......... 205
6 -48.100d3ho7a1 c.94.1.0 (A:90-308) automated matches {Porphyromonas gingivalis [TaxId: 837]}  ali model 3D-neighbors follow..  16  1....TGRLNIAVLPTIAPYLLPRVFPIWKKELAGLEIHVSEMQTSRCLASLLSGEIDMAIIA-SKAETEGLEDDLLYYEEFLGYVSRCEPLFEQDVIRTTEVNPHRLWLLDEGHCFRDQLVRFCQMKGLHEQTAYSGGSMEAFMRLVESGQGITFIPQLTVEQLSPSQKELVPFGMPRPVREVRLAVRQDYSRRKLREQLIGLLRSAVPSDMHK...... 211
7 -27.700d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  19  9......TFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALDEEHERLPEGIQAHDWFADRYVVVARRDHPRLA-GAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPR.............................................................. 161
8 -27.500d3oxna_ c.94.1.0 (A:) automated matches {Vibrio parahaemolyticus [TaxId: 670]}  ali model 3D-neighbors follow..  17  7......TFTIATTDYAMQTILPFALPRIYQEAPNVSFNFLPLQHDRLSDQLTYEGADLAI-CRPTGPVEPLRSEILGRVGVLCLLSKQHPLAN-QEMSLDDYLSHPHAMIAISDGVKALIEQALIDKP-QRKMVLRAYHLEAALAIVDTLPIIITVPALAYLVAERYDLVVKPLPFQFTPFDYSMIWHARCEHSPAQEWLRSVVREECSRLIAKR..... 213
9 -27.500d2y7pa1 c.94.1.1 (A:90-301) automated matches {Burkholderia sp. [TaxId: 233098]}  ali model 3D-neighbors follow..  14  9......TFNLAMTDIGEMYFMPPLMEALAQRAPHIQISTLRPNAGNLKEDMESGAVDLAL-GLLPELQTGFFQRRLFRHRYVCMFRKDHPSAK-SPMSLKQFTELEHVGVVALNTGHGEVDGLLERAGIKRRMRLVVPHFIAIGPILHSTDLIATVPQFAVRCEVPFGLTTSPHPAKLPDIAINLFWHAKYNRDPGNMWLRQLFVELFSEA......... 212
10 -25.800d4rpoa_ c.94.1.0 (A:) automated matches {Sphingobium chlorophenolicum [TaxId: 46429]}  ali model 3D-neighbors follow..  11  7...SNRNFRIAASDFGQALMLPRLYATLEETAPQVRVTGVNLRHGPLVEELESGSIDIAF-GGFPTLSAGIKTQTLFREEYVCVMRQSHPALT-HGLDLEAFCRHIIVTAHEFNHVHEQVEARLLELLPPESIRFTTENFLVSAVIAEETDVILTIPSLARWFANRGGLTIFPVPIELPSIEVKQYWHERYDKDPGNIWLRRVIAKIGFQNPPAE..... 219
11 -14.100d4kd5a_ c.94.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}  ali model 3D-neighbors follow..  11  3......ELNISAAASL-KEAMAKIEEEYKKVDSNVKLTVNYGASGSLQQQIEQGPCDLFISAGQKQMKVSDTMKDLVKNDLVLISSADSSVSGMKDLTTDKVKKIAV-SVPAGKYADEVLTNLNLKDKLKDKLVF-AKDVKEVLAWVQSGADVGFVYFSDTVNNDKIKVVEKTDEKTHSPITYPVSVIKASKNVDAAKKFEEFLLSESGQKIFEE..... 222
12 -14.000d4n13a_ c.94.1.0 (A:) automated matches {Borrelia burgdorferi [TaxId: 224326]}  ali model 3D-neighbors follow..  15  1....EKIVSIGGSTTVSP-ILDEMILRYDKINNNTKVTYDAQGSSVGINGLFNKIYKIAISSRDLTKEEIEQGAKETVFAYDALIFITSPEIKITNITEENLAK--FINRDSSSGSYSSIKDLLEEAQFRQDGIVVKSNGEVIEKTSLTPHSIGYIGLGYAKNSIEKGLNILSVNSTYPTKET-IIVTNNKYEDKSVTQFIDFMTSSTGQDIVEEQ.... 248
13 -11.600d1twya_ c.94.1.1 (A:) ABC transporter, periplasmic substrate-binding protein VCA0807 {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  15  1.....SEITISGSTSVAR-IMDVLAEKYNQQHPETYVAVQGVGSTAGISLLKKGVADIAMTSRYLTESETLHTFTLAFDGLAIVVNQANPVTNLTREQLYGIYKGQITNWKQVGGNDQKIAVVTREASSGTRYSFESNSNSMMKTLVNHNTQVGFISIGSVDKS----VKAIQFEKADPTSDN-LILHYSDNADEQTKEFIAFLKSESAKKLIVEY.... 244
14 -11.000d4io2a1 c.94.1.0 (A:3-248) automated matches {Adineta vaga [TaxId: 104782]}  ali model 3D-neighbors follow..  12  1ARLKGITLRIGVIESVPFT-LIEYLRDKMGFVADVQLAPPNTSYTGLVLALANGDYDIAIGDITVTSARREISNSISDNSMRILMRKGTLIDGMDDLKNGKIP-YNRIGIRIGTAGEDYYLREISGGS--RNFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCNLTVGEDFDKSTFGIVTPKEWLYAKDLDVNILSLRETGILDNLKK..... 237
15 -10.100d2pvua_ c.94.1.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  14  3...TKKKVVVGTDAAFAPFEY-DLLDAVMKA--GLDYELKNIGWDPLFASLQSKEVDMGISGITITDERKQSSDPYFEATQVILVKQGSPVKNALDLKGKTIG------VQNATTGQEAAEKLFGKPHIKKFETTVVAIMELLNGGVDAVITDNAVANEYVKNNPNKKLQVIEDPKNFASEYYGMIFPKNSELKAKVDEALKNVINSGKYTEIYK..... 221
16 -10.100d4ecfa_ c.94.1.0 (A:) automated matches {Lactobacillus brevis [TaxId: 387344]}  ali model 3D-neighbors follow..  12  1...AGESITAV-GSTALQPLVEAAGEQYTGEHLGTFINVQGGGTGTGLSQIQEGAVQIGNSDLFAGEQKGINARQLVDHRVAVITPIVNKKVGVKNLSTNQLIK--LINRAQGSGTRATFEQFGLANHRSKTAQEQDSSGMVRSIVATTPGAISYVAFSYVNKT........................................................ 180
17 -9.880d2v25a_ c.94.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  13  7..KSKGQLIVGVKNDVPHYALLDQATGEIKGFDDKKIKLVAVNAKTRGPLLDNGSVDAVIATFTITPERK--SEPYYQDAIGLLVLKEKKYKSLADMKGAN------IGVAQAATTKKAIGEAAKKIGIDVKFSEFPDYPSIKAA-LDAKRVDAFSVDKSILLGYVDDKSEI-LPDSFEPQSYGIVTKKDD-FAKYVDDFVKEHKNEIDA.......... 224
18 -9.730d1atga_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Azotobacter vinelandii [TaxId: 354]}  ali model 3D-neighbors follow..  12  1......ELKVVTATNF-LGTLEQLAGQFAKQ-TGHAVVISSGSSGPVYAQIVNGAPYNVFFSADEKSPEKLDNQGFYAIGKLVLWSAKPGLVDNQGKVLAGNGWRHIISNPQIAPYGLAGTQVLTHLGLLDKLTAQANSVGQAHSQTASGLGFVALAQIIQAAAKIPGSHWFPPANYYEPIVQQAVITKSTAEKANAEQFMSWMKGPKAVAIIKA..... 224
19 -9.540d3kbra_ c.94.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  14  9...ESGVLRVATTGDYKPFSYRT-MAQRLAESLGAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQSIPYLRDGKTPITLCSE---EARFQTLEQIDQPGVAIVNPGGTNEKFARANLKKARILVHPDNVTIFQQIVDG--KADLMMTDAIEARLQSRLHPELCAVHPQQPFDFAEKAYLLPRDEAFKRYVDQWLHIAEQSGLLRQRME..... 229
20 -9.400d4dz1a_ c.94.1.0 (A:) automated matches {Salmonella enterica [TaxId: 28901]}  ali model 3D-neighbors follow..  11  2..VEGRTLNVAVSPASPPMLFKSALFSSYCQSRHCKLNITEYAWDGMLGAVASGQADVAFSGISITDKRKKVSEPYYINSFYLVSMANHKITLNNLNELNKYS----IGYPRGMAYSDLIKNDLEPKGYYSLSKVKLYPTETMADLKNGNLDLAFIEEPVYFTFKNKKKMPIESYVFKNVDQLGIAFKKGSPVRDDFNLWLKEQGPQKISGIVDS..... 226
21 -9.250d3k4ua1 c.94.1.0 (A:2-233) automated matches {Wolinella succinogenes [TaxId: 844]}  ali model 3D-neighbors follow..  14  1....RGELRVGLEPGYLPFEMKD-LAREMAKAMGVKLKLVPTSWDGLIPGLVTEKFDIIISGMTISQERNLRVEPYIVVGQSLLVKKGL---EKGVKSYKDLDKPELLVTKFGVSAEYAAKRLFKNAKLKTYDTEAEAVQEVLNGKADMFIFDLPFNVAFMAQKGQGYLVHLD--TSLTYEPLGWAIKKGPDFLNWLNHFLAQIKHDGSYDELYE..... 221

FFAS is supported by the NIH grant R01-GM087218-01
9 9 0 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35