current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
1 -64.200d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors  100  1PDGPTQLRALNLTEGFAVLHWKPPQNPVDTYDIQVTAPGAPPLQAETPGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPASITFTTGLEAPRDLEAKEVTP 102
2 -50.600d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  25  1.DNPKDLEVSDPTETTLSLRWRRPVAKFDRYRLTYVSPSGKKNEMEIPVDSTSFILRGLDAGTEYTISLVAEKGRHKSKPTTIKGST............... 86
3 -50.100d2cuma1 b.1.2.1 (A:8-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  2.EAPRDLEAKEVTPRTALLTWTEPPVRPAGYLLSFHTPGGQTQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGLR........... 91
4 -48.000d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  3.DRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPA........... 94
5 -47.700d4lxoa1 b.1.2.1 (A:1326-1417) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  2LDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPPLIGQQST............... 90
6 -47.000d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  22  2.DSPRDLMVTASSETSISLIWTKASGPIDHYRITFTPSSGISSEVTVPRDRTSYTLTDLEPGAEYIISITAERGRQQSLESTVDA................. 85
7 -46.800d2rb8a_ b.1.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  28  4.DAPSQIEVKDVTDTTALITWMPPSQPVDGFELTYGIKDGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGL............. 93
8 -46.500d4lxoa2 b.1.2.1 (A:1418-1509) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  1.DVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNVQEFTVPGSKSTATISGLKPGVDYTITVYACRARGDNPDCSKPISI............... 88
9 -46.400d3r8qa2 b.1.2.0 (A:93-182) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  3.SPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTA.............. 90
10 -45.600d3r8qa1 b.1.2.0 (A:1-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  23  3.PAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTT............... 90
11 -45.000d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  20  2.DAPKNLRVGSRTATSLDLEWDNSEAEAQEYKVVYSTLAGEQYHPKGIGPTTKTTLTDLVPGTEYGVGISAVMNSKQSIPATMNARTE.............. 92
12 -45.000d2cuia1 b.1.2.1 (A:8-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  27  4..RLSQLSVTDVTTSSLRLNWEAPPGAFDSFLLRFGVPSPSQRELMVPGTRHSAVLRDLRSGTLYSLTLYGLRGPHKADSIQGTART............... 98
13 -44.900d2ee3a1 b.1.2.0 (A:8-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  2.APPRHLGFSDVSHDAARVFWEGAPRPVRLVRVTYVSSGGHSGQTEAPGNATSAMLGPLSSSTTYTVRVTCLYPGGGSSTLTGRVTTKKAPS.......... 93
14 -43.000d4lpva1 b.1.2.0 (A:1-91) automated matches {Artificial gene [TaxId: 32630]}  ali model 3D-neighbors follow..  31  3.PAPKNLVVSEVTEDSLRLSWTAPDAAFDSFMIQYQESEGEAINLTVPGSERSYDLTGLKPGTEYTVSIYGVLVHKLTFPLSAEFTT............... 91
15 -42.600d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  2.PPPTDLRFTNIGPDTMRVTWAPPSIDLTNFLVRYSPVKNDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTG.............. 91
16 -41.500d2mnua_ b.1.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  4VPQLTDLSFVDITDSSIGLRWTPLNSSIIGYRITVVAAGEPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQT............... 93
17 -39.800d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  1PSPPTNLHLEANPDGVLTVSWERSTTDITGYRITTTPTNGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISDTIIPA.............. 94
18 -35.100d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  2LGAPQNPNAKAAGSRKIHFNWLPPSGKPMGYRVKYWIQGDSESEALLDSKVPSVELTNLYPYCDYEMKVCAYGAQGEGPYSSLVSCRTHQ............ 92
19 -34.300d2vkwa2 b.1.2.1 (A:601-691) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  1PSAPKLEGQMGEDGNSIKVNLIKQDSPIRHYLVRYRALSSEKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRT............... 91
20 -33.200d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  11PGQPLNFKAEPESETSILLSWTPPSDTIANYELVYKDGEHGEEQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEISARTMQS........... 102
21 -33.100d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1.SGPVEVFITETPPNSHPIQWNAPQSHISKYILRWRPKNSVGKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTT.............. 92
22 -31.900d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  21PEVPSSLHV-RPLVTSIVVSWTPPNIVVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHT........... 113
23 -31.500d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  21PGPPMGILFPEVRTTSVRLIWQPPNGIILAYQITHRLNTTTANTEVLAPSARQYTATGLKPESVYLFRITAQTRKGWGEAAEALVVTTEK............ 116
24 -31.200d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  11PGPAPNLRAYAASPTSITVTWETPNGEIQNYKLYYMEKGTD-KEQDVDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTPDVAVRTLS............ 102
25 -31.100d2yrza1 b.1.2.1 (A:8-112) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  11PDTPTRLVFSALGPTSLRVSWQEPERPLQGYSVEYQLLNGGERLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQ............ 104
26 -31.100d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  3PSEPGRLAFNVVSSTVTQLSWAEPNGEITAYEVCYGLVNDDNRPLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQP........... 103
27 -30.800d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  11PSAPRDVVASLVSTRFIKLTWRTPAGDNLTYSVFYTKEGIARERVTSHPGEMQVTIQNLMPATVYIFRVMAQNKHGSGESSAPLRVETQP............ 106
28 -30.700d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  1PDQCKPPQVTCRSATCAQVNWEVPLTDVTEYRLEWGGVEGSMQIC-YCGPGLSYEIKGLSPATTYYCRVQALSVVGAGPFSEVVACVTPPS........... 93
29 -30.700d4n5ua1 b.1.2.0 (A:602-705) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  5PSPPQKVMCVSMGSTTVRVSWVPPNGVITQYSVAYEAVDGEDVVDGISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDE............ 104
30 -30.600d2e7ha1 b.1.2.0 (A:8-103) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  1PPAVSDIRVTRSSPSSLSLAWAVPRGAVLDYEVKYHEKGAEGPSSFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPGQEHHSQTQLD............ 96
31 -30.400d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  1PSMPASPVLTKAGITWLSLQWSKPSDEGISYILEMEEETSGYFKPKYDGEDLAYTVKNLRRSTKYKFKVIAYNSEGKSNPSEVVEFTTCP............ 95
32 -30.300d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  11PGPVGHLSFSEILDTSLKVSWQEPNGILTGYRISWEEYNRTNVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSASTISSGVPP........... 106
33 -30.300d3n1fc_ b.1.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  1PTGPHIAYTEAVSDTQIMLKWTYINTPIQGFYIYYRPTDSDNKRDVVEGSKQWHMIGHLQPETSYDIKMQCFNEGGESEFSNVMICET.............. 98
34 -30.200d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  11PGPPTNLGISNIGPRSVTLQFRPGKTSISRWLVEAQVGVLLIHQLSNEPDARSMEVPDLNPFTCYSFRMRQVNIVGTSPPSQPS.................. 104
35 -30.100d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  8PDPPMDVTLQPVTSQSIQVTWKAPNGVIRGYQIGYRENSPGSVEMKATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLE............ 109
36 -30.100d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  2MMPPVGVQASILSHDTIRITWADNSTDSRYYTVRWKTNIPANTKKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFE............ 99
37 -30.100d2kbga_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  2EPSPPSIHGQPSSGKSFKLSITKQDAPILEYIVKYRSKDKEDLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPN.......... 98
38 -30.000d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  1PSTVPIMHQVSATMRSITLSWPQPEGIILDYEIRYYEKEHNENSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKSGKMCFQTLTD............ 95
39 -30.000d4n68a1 b.1.2.0 (A:874-971) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  2PSAPTDVKATSVSVSEILVAWKHILGRPQGFEVGYWKDMEQEETVKTRGNESFVILTGLEGNTLYHFTVRAYNGAGYGPPSSEVSATTKK............ 98
40 -29.700d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  14  7MPVPELLEIEEYSETAVVLHWSLAEHLITGYYAYYRPSSSAGEATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSA.................... 95
41 -29.700d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  11PDIPNPPRIANRTKNSLTLQWKAPSSKIQNFVLEWDEGKGNGEFCQCMGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGC........... 105
42 -29.500d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  1PGRP-TMMISTTAMNTALLQWHPPKGELLGYRLQYCRADEARNTIDFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGLGEEFEKEIRTPED............ 93
43 -29.200d1wk0a1 b.1.2.1 (A:8-131) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  21  11LSNIVKPVASDIQARTVVLTWSPPSPELYGYEVLISSTGKDGKKSVYVGEETNITLNDLKPAMDYHAKVQAEYNSIKGTPSEEIFTTLSCEPD......... 117
44 -29.200d2ee2a1 b.1.2.0 (A:8-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  11PSAPTEVGVKVLSSSEISVHWEHVEKIVESYQIRYWAAHDKENRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPPSDMIEAFTKKA........... 106
45 -29.100d1uena1 b.1.2.1 (A:8-119) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  7PMAPGNVRVNVVNSTLAEVHWDPVRGHLQGYRIYYWKTQSEKKILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEG........... 112
46 -28.700d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  15  11PEAPDRPTISTASETSVYVTWIPRGFPIQSFRVEYKKLKKVGDTSAIPPSRLSVEITGLEKGISYKFRVRALNMLGESEPSAPSRPYVVSG........... 108
47 -28.500d1wfua1 b.1.2.1 (A:8-114) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  13  9LSKPHPPVVGKVTHHSIELYWDLEQKEWLRFSIEEEDPKMHSYGVIYTGYATRHVVEGLEPRTLYKFRLKVTSPSGEYEYSPVVSVATTR............ 106
48 -28.200d2edya1 b.1.2.0 (A:8-103) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  1PSFPQNLHVTGLTTSTTELAWDPPNGRIISYTVVFRDINSQ-QELQNITTDTRFTLTGLKPDTTYDIKVRAWTSKGSGPLSPSIQSRTMPV........... 96
49 -28.100d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  11PSAPQNLSLEVRNSKSIMIHWQPPNGQITGYKIRYRKASRKSTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDLSAETFESDLDETRVPEV.. 119
50 -28.100d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  11PHAPEHATLSTVERRAINLTWTKPNSPLIRYILEMSENNAPVLLASVDPKATSVTVKGLVPARSYQFRLCAVNDVGKGQFSKDTERVSLP............ 107
51 -28.000d2dm4a1 b.1.2.0 (A:8-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  1PDAPRNLQLSREAEGVIVGHWAPPIGLIREYIVEYSRSGSKMWA-SQRAASNFTEIKNLLVNTLYTVRVAAVTSRGIGNWSDSKSITTIKG........... 95
52 -28.000d2db8a1 b.1.2.0 (A:8-104) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  3PATPIQLEECCTHNNSATLSWKQPPVPADGYILELDDGNGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEG........... 97
53 -27.900d2dmka1 b.1.2.0 (A:8-121) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  9PNPPSREELCTASHDTITVHWISDDEFISSYELQYTIFTGQANFISLYNSQNHYTVHGLQSGTRYIFIVKAINQAGSRNSEPTRLKTNSQPFK......... 114
54 -27.900d1ueya1 b.1.2.1 (A:8-121) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  10PNPPFDLELTDQLDKSVQLSWTPGNSPITKFIIEYEDAMHKPHHQTEVSGTQTTAQLNLSPYVNYSFRVMAVNSIGKSLPSSEQYLTKASEP------DKNP 113
55 -27.900d2dlha1 b.1.2.1 (A:8-115) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  11PSAPRDVQARMLSSTTILVQWKEPNGQIQGYRVYYTMDPTNNWMKHNVADSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTG........... 108
56 -27.800d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  13  3SLSGLSLKLVKKEPRQLELTWAGSRGGNLSYELHVLNQD---EEWHQMVLEPRVLLTKLQPDTTYIVRVRTLTPLGPGPFSPDHEFRTSPP........... 94
57 -27.200d1ujta1 b.1.2.1 (A:8-114) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  9DVLVRLHNPVVLTPTTVQVTWTVDPQFIQGYRVMYRQTSGLQATSSKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQGMDSESKTVRTTE............ 106
58 -27.000d3lpwa2 b.1.2.0 (A:103-197) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  1PLPPGKITLMDVTRNSVSLSWEKPESRILGYIVEMQTKGSDKWATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLS.................. 88
59 -26.700d3lpwa1 b.1.2.0 (A:4-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  3PGPPQDLKVKEVTKTSVTLTWDPPLSKIKNYIVEKRESTRKASTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKAS............ 97
60 -26.700d2doca1 b.1.2.0 (A:8-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  11PSSPYGVKIIELSQTTAKVSFNKPDVPIHHYQVDVKEVASEIKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLP............ 105
61 -25.600d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  13  1PDNPDNVVGQGTEPNNLVISWTPMNAPNFHYYVSWKRDIPAENNNIFDWRQNNIVIADQPTFVKYLIKVVAINDRGESNVAAEEVV................ 98
62 -25.500d1wfta1 b.1.2.1 (A:8-117) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  12  1PGAPSTVRISK-NVDGIHLSWEPPTGNILEYSAYLAIRTGLKTSCTVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQIRWLQGNS............ 109
63 -25.300d1v5ja1 b.1.2.1 (A:8-102) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  2.SPPRGLVA-VRTPRGVLLHWDPPEKRLDGYVLEGRQGSQGVLDPAVAGTETELLVPGLIKDVLYEFRLVAFAGSFVSDPSNTANVSTSG............ 94
64 -25.300d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  3.NELLKFSYIRTSFDKILLRWEPYWRDLLGFMLFYKEAPYQNSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDER....................... 109
65 -25.200d3wiha_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  1.APPQGVTVSDGNGTAILVSWQPPNGMVQEYKVWCLGNETRHINKTVDGSTFSVVIPFLVPGIRYSVEVAASTGAGSGVKSEPQFIQ............... 94
66 -25.100d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  5PNPPHNLSVINSLSSILKLTWTNPSVIILKYNIQYRTKDASTPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYSEEASGITYEDRPSK........ 111
67 -25.100d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  11PGIPVKSVKGKIHSHSFKITWDPPKATINKYVVEMAEGSNGNKWEMISGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQTPA............ 106
68 -24.900d1wj3a1 b.1.2.1 (A:8-111) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  11PSQPPGNVVWNATDTKVLLNWEQVESEVTGYKVFYRTSSQN--NVQVLNTNKTSAELVLPIKEDYIIEVKATTDGGDGTSSEQIRIPRITS........... 104
69 -24.900d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  11PSPPKDVTVKEGKPKTIIVNWQPPNGKITGYIIYYSTDVNAEVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPKA........... 111
70 -24.900d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  2PGPCLPPRLGRPKAKEIQLRWGPPLSPISCYSVEMSPIEKDEPREVYQGSEVECTVSSLLPGKTYSFRLRAANKMGFGPFSEKCDITTAPG........... 97
71 -24.800d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  5DDIVGPVTHEIFENNVVHLMWQEPNGLIVLYEVSYRRYGDEELHRKHFALERGCRLRGLSPGN-YSVRIRATSLAGNGSWTEPTYFYVTD............ 100
72 -24.500d2yuxa1 b.1.2.0 (A:8-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  11PGPPQIVKIEDVWGENVALTWTPPKAAITGYTIQKADKKSMEFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDG........ 109
73 -24.500d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  3PSSPSIDQV-EPYSSTAQVQFDEPEVPILKYKAEWRAVGEEVYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAASEFKTQP............ 100
74 -24.100d4gs7c2 b.1.2.1 (C:130-227) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  18  3PWAPENLTLHKLSESQLELNWNNRFLN--EHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRS............................... 74
75 -23.200d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  2PRAPGNLTVHTNVSDTLLLTWSNPYPPDNTYAVNIWSENDPADNVTYLEPSLRIAASTLKSGISYRARVRAWAQAYNT........................ 89

FFAS is supported by the NIH grant R01-GM087218-01
1 1 3 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.