current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MDIPKITTFLMFNNQAEEAVKLYTSLFEDSEIITMAKYGENGPGDPGTVQHSIFTLNGQVFMAIDANSGTELPISLFVTVKDTIEMERLFNGLKDEGAILMPKTNMPPYREFAWVQDKFGVSFQLALPELast
1 -96.700d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors  100  1MDIPKITTFLMFNNQAEEAVKLYTSLFEDSEIITMAKYGENGPGDPGTVQHSIFTLNGQVFMAIDANSGTELPISLFVTVKDTIEMERLFNGLKDEGAILMPKTNMPPYREFAWVQDKFGVSFQLALPE 129
2 -84.800d1u7ia1 d.32.1.7 (A:1-132) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  40  3...ARVRPFLMFQGQAEAAMNFYLSLFDDAEILQIQRYGAEGPGPEGSVLKALFRLGDQSVHCIDSHVRFTPAFSFFVDCESNAQIERLAEALSDGGKALMPLGDYGFSQRFAWLADRFGVSWQLNLA. 132
3 -61.800d1u69a_ d.32.1.7 (A:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  26  1...SKNTICLWYDSAALEAATFYAETFPDSAVLAVHRAPGDYPGKEGDVLTVEFRVMGIPCLGLNGGPAFRHAFSFQVATDDQAETDRLWNAIVDNGGE---------ESACGWCRDKWGISWQITPR. 119
4 -42.300d1u6la1 d.32.1.7 (A:4-138) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  24  1....QIVPYLIFNGNCREAFSCYHQHL-GGTLEAMLPFGDSPECGKDKIMHARLVVGSFALMASDNHPAYPYECSISLNVDSKAEAERLFNALAEGGSVQMPLGPTFWAASFGMFTDRFGVAWMVNCEQ 134
5 -36.800d3l20a1 d.32.1.0 (A:4-151) automated matches {Staphylococcus aureus [TaxId: 367830]}  ali model 3D-neighbors follow..  21  1..MTALFPYIAFEN-SKEALAYYEEVF-GATDVKRLEVGEEQASHFGATMHAEFEVLGVKVLCSDRADKINNGISLLIDYEDADKVEAFYEQIKDHSEIELPFADQFWGGKMGVFTDKYGVRWMLHGQD 143
6 -30.400d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  16  2LVFTEFKQMLLVEQKVGDAVTFYKSAFGAIESGHSLYPKRKLDQELPHVLSSELNLAGSSFVVCDVSSLPGFSVTFLLGTKDAEAA--VAKAVDAGAVKVEVTEAEVELGFKGKVTDPFGVTWIF.... 133
7 -15.300d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]}  ali model 3D-neighbors follow..  13  2....RISLFAVVVEDMAKSMEFYRKMGVEIPAEADSAPHTEAVLDGGIRLAWDTVETVRSYDPEWQAPTGGHRFAIAFEFPDTASVDKKYAELVDAGYEHLKPWNAVWGQRYAIVKDPDGNVVDLFAP. 126
8 -12.100d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}  ali model 3D-neighbors follow..  10  2....NLNQLDIIVSNVPQVCADLEHILDKKADYANDGFAQFTIGSHCLMLSQNHLVPL-------ENFQSGIIIHIEV-----EDVDQNYKRLNELGKVLHGPTVTDWGTESLLVQGPAGLVLDFYRMK 115
9 -11.000d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  10  1..VRRVVANIATP-EPARAQAFYGDILGMPVAMDHGWIVTHASPLEAHAQVS--------FAREGGSGTDVPDLSIEV-----DNFDEVHARILKAGPIEYGPVTEAWGVQRLFLRDPFGKLINIL... 111
10 -10.300d2p7oa_ d.32.1.2 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]}  ali model 3D-neighbors follow..  12  2..ISGLSHITLIVKDLNKTTAFLQNIFNAEEIYS-------SGDKTFSLSKEKFFLIAGLWICIMEGDSLQERIAFQI---QSEEVDEYTERIKALGVEMKPERPRVQGERSIYFYDFDNHLFEL.... 119
11 -9.030d1xqaa1 d.32.1.2 (A:1-112) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  11  1MGIKHLN---LTVADVVAAREFLEKYFGLTCSGTRGNAFAVMRDNDGFILT----------LMKGKEVQYPKTFHVGFPQESEEQVDKINQRLKEDGFLVEPPKHAHAYT---YVEAPGGFTIEVM... 111

FFAS is supported by the NIH grant R01-GM087218-01
1 0 9 0 2 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.