current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d1dzka_ b.60.1.1 (A:) Odorant-binding protein {Pig (Sus scrofa) [TaxId: 9823]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst FELSGKWITSYIGSSDLEKIGENAPFQVFMRSIEFDDKESKVYLNFFSKENGICEEFSLIGTKQEGNTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGKGTDIEDQDLEKFKEVTRENGIPEENIVNIIERDDCPALast
1 -88.500d1dzka_ b.60.1.1 (A:) Odorant-binding protein {Pig (Sus scrofa) [TaxId: 9823]}  ali model 3D-neighbors  100  1FELSGKWITSYIGSSDLEKIGENAPFQVFMRSIEFDDKESKVYLNFFSKENGICEEFSLIGTKQEGNTYDVNYAGNNKFVVSYASETALIISNINVDEEGDKTIMTGLLGKGTDIEDQDLEKFKEVTRENGIPEENIVNIIERDDCPA 148
2 -85.300d4odda_ b.60.1.0 (A:) automated matches {Canis lupus [TaxId: 9615]}  ali model 3D-neighbors follow..  38  2.QVSGPWKTLYVSSNNLDKIGENGPFRIYLRGINVDIPRLKMLFNFYVKVDGECVENSVGASIGRDNLIKGEYNGGNYFRIIDMTPNALIGYDVNVDSKGKITKVALLMGRGAHVNEEDIAKFKKLSREKGIPEENIIYLGDTDNCPN 148
3 -81.000d3fiqa_ b.60.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  27  8.EVNGDWRTLYIVADNVEKVAEGGSLRAYFQHMECGDECQELKIIFNVKLDSECQTHTVVGQKHEDGRYTTDYSGRNYFHVLKKTDDIIFFHNVNVDESGKETNVILVAGKREDLNKAQKQELRKLAEEYNIPNENTQHLVPTDTCN. 153
4 -80.300d4wfva_ b.60.1.1 (A:) Lipocalin allergen {Cow (Bos taurus), bos d 2 [TaxId: 9913]}  ali model 3D-neighbors follow..  30  8.KIPGEWRIIYAAADNKDKIVEGGPLRNYYRRIECINDCESLSITFYLKDQGTCLLLTEVAKRQEGYVYVLEFYGTNTLEVIHVSEN-MLVTYVENYDGERITKMTEGLAKGTSFTPEELEKYQQLNSERGVPNENIENLIKTDNCPP 153
5 -74.300d3kffa_ b.60.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  26  5.KINGEWFSILLASDKREKIEEHGSMRVFVEHIHVLE--NSLAFKFHTVIDGECSEIFLVADKTEKAGYSVMYDGFNTFTILKTDYDNYIMFHLINEKDGKTFQLMELYGRKADLNSDIKEKFVKLCEEHGIIKENIIDLTKTNRCLK 150
6 -73.500d3saoa1 b.60.1.1 (A:6-156) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  13  2.EVAGKWYIVALASNTDFFLAEKGKMKMVMARISFLGE-DELEVSYAAPSPKGCRKWETTFKKTSDDGVYYSEEAEKTVEVLDTDYKSYAVIFATRVKDGRTLHMMRLYSRSREVSPTAMAIFRKLARERNYTDEMVAVLPSQAACSV 148
7 -73.400d2ra6a_ b.60.1.0 (A:) automated matches {Trichosurus vulpecula [TaxId: 9337]}  ali model 3D-neighbors follow..  25  2.....HWHTVVLASSDRSLIEEEGPFRNFIQNITV--ESGNLNGFFLTRKNGQCIPLYLTAFKTEEARFKLNYYGTNDVYYESSKPNEYAKFIFYNYHDGKVNVVANLFGRTPNLSNEIKKRFEEDFMNRGFRRENILDISEVDHC.. 141
8 -72.800d3l4ra_ b.60.1.0 (A:) automated matches {Dog (Canis familiaris) [TaxId: 9615]}  ali model 3D-neighbors follow..  22  8.ELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSA--KDGNLHGDILIPQDGQCEKVSLTAFKTATSNFDLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRC.. 151
9 -70.200d4tlja_ b.60.1.1 (A:) beta-Lactoglobulin {Goat (Capra hircus) [TaxId: 9925]}  ali model 3D-neighbors follow..  15  14.KVAGTWYSLAMAASDISLLAQSAPLRVYVEELKPTPE-GNLEILLQKWENGECAQKKIIAEKTKIPAFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDKEALEKFDKALKALPMHIRLAFNPTQLEGQCH 161
10 -70.000d1xkia_ b.60.1.1 (A:) Von Ebner`s gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  1.DVSGTWYLKAMTVDRE--FPEMNLESVTPMTLTTL-EGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYSEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQS..... 139
11 -69.900d4es7a_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  20  12.RIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLKWNITMESYVVHTNYDEYAIFLTKKSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVP 163
12 -69.300d2xsta_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  13.KFSGLWYVVSMASDCRVFLGKKDHLSMSTRAIRPTEE-GGLHVHMEFPGADGCNQVDAEYLKVGSEGFRVPALGYLDVRIVDTDYSSFAVLYIYKELEGALSTMVQLYSRTQDVSPQALKSFQDFYPTLGLPKDMMVMLPQS..... 154
13 -69.300d1epba_ b.60.1.1 (A:) Retinoic acid-binding protein {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  16  8.KFLGFWYEIAFASKMGTPGLAHKEEKMGAMVVEL--KENLLALTTTYYSEDHCVLEKVTATEGDGPAKFQRLSGKKEVVVEATDYLTYAIIDITSLVAGAVHRTMKLYSRSLDDNGEALYNFRKITSDHGFSETDLYILKHDLTCVK 154
14 -67.300d3o22a_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  10.KFLGRWFSAGLASNSSWLREKKAALSMAKSVVAPA-TDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSHWGSTYSVSVVETDYDQYALLYSQGSKPGEDFRMATLYSRTQTPRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMT 160
15 -62.500d1lf7a_ b.60.1.1 (A:) Complement protein C8gamma {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  17.QFAGTWLLVAVGSAGRFLQEQGHRAEATTLHVA--PQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLGARGAVHVVVAETDYQSFAVLYLE----RAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEA 161
16 -62.200d3s26a1 b.60.1.1 (A:6-180) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  13  21.QFRGRWYVVGLAGNAVQKKTEGS-FTMYSTIYELQENNSNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCID 174
17 -61.700d2l5pa_ b.60.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  11  20.KFQGEWFVLGLADNT-YKREHRPLLHSFITLFKLR-DNSEFQVTNSMTRGKHCSTWSYTLIPTNKPGQFTPGADKENIQVIETDYVKFALVLSLRQASNQNITRVSLLGRDWKITHKTIDRFIALTKTQNLTKNNLLFPDLTDWLLD 171
18 -30.100d1gkab_ b.60.1.1 (B:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]}  ali model 3D-neighbors follow..  12  25.RYAGRWYQTH-IHSNYEYSTNDYGFKVTTAGFNPNDEYLKIDFKVYPTKEFPAAHMLIDAPSVFAAPYE----------VIETDYETYSCVYSCITTDNYKSEFAFVFSRTPQTSGPAVEKTAAVFNKNGVEFSKFVPVSHTAECV. 171
19 -25.900d4ge1a_ b.60.1.0 (A:) automated matches {Rhodnius prolixus [TaxId: 13249]}  ali model 3D-neighbors follow..  18..FTGSWYITHYKLGDSTLEVGDKNCTKFLHQKT---ADGKIKEVFSNYNPNA--FAKVSDFDGNNGKYTAKNVITLQVSYIDTDYSKYSVVHV--DPAAPDYYLYAVQSRTENVKEDVKSKVEAALGKVGLKLSGLFDATTLGKCQ. 176
20 -24.800d1i4ua_ b.60.1.1 (A:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]}  ali model 3D-neighbors follow..  11  30.SYAGVWYQFALTNNPYQLIEK-------VRNEYSFDGKQFVIESTGIAYDGNLLKRKLYPNPFGEPHLSIDYENAAPLVILETDYSNYACLYSIDYNFGYHSDFSFIFSRSANLADQYVKKCEAAFKNINVDTTRFVKTVQGSSCP. 174
21 -24.100d1kt7a_ b.60.1.1 (A:) Retinol binding protein {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  19.RFAGTWYAMA-NIVAEFSVDENGHMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDD--HWIIDTDYETFAVQYSCRLLNTCADSYSFVFARDPSGFSPEVQKIVRQRQEELCLARQYRLIPHNGYC.. 174
22 -22.600d2hzqa_ b.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19.KYPGRWYEIGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSA---------PYHILATDYENYALVYSTSISQSFHVDFAWILARNVALPPETVDSLKNILTSNNIDVKKMTVTDQVN-CP. 164
23 -20.700d1z24a1 b.60.1.1 (A:1-189) Insecticyanin {Tobacco hornworm (Manduca sexta) [TaxId: 7130]}  ali model 3D-neighbors follow..  13  22.AFAGAWHEIAKLPLENENQGK--------TIAEYKYDGKKASVYNSFVSNGVKEYMEGDLEIAPDAKKFGQRVVNLVPWVLATDYKNYAINYNYHPDKKAHSIHAWILSKSKVLEGNTKEVVDNVLKTFLIDASKFISNDFSEACQ. 176
24 -19.000d1kxoa_ b.60.1.1 (A:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]}  ali model 3D-neighbors follow..  21.QYHGKWWQVA-------AYPDHITKYGKCGWAEYTPEGKSVKVSRYSVIHGKEYFSEGTAYPVGDSKTIGGVTQEGVFNVLSTDNKNYIIGYFYDEDKKGHMDLVWVLSRSMVLTGEAKTAVENLIGSPVVDSQKLVYSDFSEAC.. 170
25 -18.900d1x8pa_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}  ali model 3D-neighbors follow..  12  20...GDVWYVTDYLDLEPDDVAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDLGDLYAVLNRNKDA--AAGDKVKSAVSAATLEFSKFISTKENN-CA. 172
26 -18.300d1avgi_ b.60.1.3 (I:) Thrombin inhibitor {Triatomine bug (Triatoma pallidipennis) [TaxId: 30077]}  ali model 3D-neighbors follow..  21..FNGTWYLAHGPGVTSPAVCQKFTTSG--------SKGFTQIVEIGYNKFESNVKFQCNQVDNKNGESSDNTEFEADFTFISVSYDNFALVCSITFTSQPKEDRYLVFERTKSDTDPDAKEI......................... 141
27 -18.000d1qwda1 b.60.1.1 (A:23-176) Outer membrane lipoprotein Blc {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  10  16.RYLGTWYEIARFDHRFERGLEKVTATYSLRGLNVINKGYNPDRGMWQQSEGKAYFTGAPTRAALKVSFFGPFYGGYNVIALDREYRHALV-------CGPDRDYLWILSRTPTISDEVKQEMLAVATREGFDVSKFIWVQQPG.... 154

FFAS is supported by the NIH grant R01-GM087218-01
1 1 7 8 7 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Alonso A, Sasin J, Bottini N, Friedberg I, Friedberg I, Osterman A, Godzik A., Hunter T, Dixon J, Mustelin T. Protein tyrosine phosphatases in the human genome. Cell. 2004 Jun 11;117(6):699-711. Review.