current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d1atga_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Azotobacter vinelandii [TaxId: 354]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst ELKVVTATNFLGTLEQLAGQFAKQTGHAVVISSGSSGPVYAQIVNGAPYNVFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPGLVDNQGKVLAGNGWRHIAISNPQIAPYGLAGTQVLTHLGLLDKLTAQERIVEANSVGQAHSQTASGAADLGFVALAQIIQAAAKIPGSHWFPPANYYEPIVQQAVITKSTAEKANAEQFMSWMKGPKAVAIIKAAGYVLPQLast
1 -111.000d1atga_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Azotobacter vinelandii [TaxId: 354]}  ali model 3D-neighbors  100  1ELKVVTATNFLGTLEQLAGQFAKQTGHAVVISSGSSGPVYAQIVNGAPYNVFFSADEKSPEKLDNQGFALPGSRFTYAIGKLVLWSAKPGLVDNQGKVLAGNGWRHIAISNPQIAPYGLAGTQVLTHLGLLDKLTAQERIVEANSVGQAHSQTASGAADLGFVALAQIIQAAAKIPGSHWFPPANYYEPIVQQAVITKSTAEKANAEQFMSWMKGPKAVAIIKAAGYVLPQ 231
2 -81.100d4kd5a_ c.94.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}  ali model 3D-neighbors follow..  24  3ELNISAAASLKEAMAKIEEEYKKVSNVKLTVNYGASGSLQQQIEQGAPCDLFISAGQKQMKVLDEEKLLVSDTMKDLVKNDLVLISSADSSV-SGMKDLTTDKVKKIAVGEAESVPAGKYADEVLTNLNLKDKL--KDKLVFAKDVKEVLAWVQSGNADVGFVYFSDTVNNDKIKVVE--KTDEKTHSPITYPVSVIKASKNVDAAKKFEEFLLSESGQKIFEEFGYKKVE 229
3 -73.900d3gzga_ c.94.1.0 (A:) automated matches {Xanthomonas axonopodis [TaxId: 92829]}  ali model 3D-neighbors follow..  25  3PVTVFAAASLKESMDEAATAYEKATGTPVRVSYAASSALARQIEQGAPADVFLSADLEWMDYLQQHGLVLPAQRHNLLGNTLVLVAPASSKLRVDPRA-ALGENGRLAVGQTASVPAGSYAAAALRKLGQWDSV--SNRLAESESVRAALMLVSRGEAPLGIVYGSDARADAKVRVVA--TFPDDSHDAIVYPVAALKNSNN-PATAAFVSWLGSKPAKAIFARRGFSL.. 231
4 -72.300d4rxla_ c.94.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}  ali model 3D-neighbors follow..  20  1TLHIYAASSMTNAVNALVADYSQQHDVKLVTVYGGSSSLARQIEAGAPADLFISANEEWANYLVEKGLVKPNKVVTLAANSLVLIRPTAQELQDAAAWQTALADSRLAVAQVDAVPAGMYAKQALQHAGVWPEL--ESRLAQTNNVRLALALVERGESPLGIVYKTDALLSDKVTIVT--AFSAQSHQPIRYPLAQLNDKAA---SAEWVAYLRSDAAQQILQRFGFES.. 227
5 -43.000d2onsa2 c.94.1.1 (A:32-342) Molybdate-binding protein, ModA {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  17  3KLKVFHAGSLTEPMKAFKRAFEEKPNVEVQTEAAGSAATIRKVELGRKADVIATADYTLIQKMMYPEFA--NWTIMFAKNQIVLAYRNDSRYADEIEILKRPDV-RFGFSNPNDDPCGYRSLMAIQLAELYRIEINKSKIMIRSMEMELIHLVESGELDYFFIYKSVAKQHGF----NFVELPVEIDKPIVYGITIPKNAENRELAVEFVKLVISEEGQEILRELGQEPLV 293
6 -21.000d4eloa_ c.94.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}  ali model 3D-neighbors follow..  15  6......SGRGQSLVEPLVKQFEAETGIRVQVRYSTDAQILAALQERSPADLFWANTAGALGQASAKGLLRPLGETLLVRLRVLAYNPKAEELPESLLDLPRFAREKGLVGRVGWTPTYSSFQDMVAGMIALYGEEKTREWLLAPSNPAMLDAIRAGEVDLGSTYYVVRFRRAGYRLGMHHFRDGDAGNLAVTGAGLLKTSKNLAAATRFLTYLLSPQAQQYFVGNIGEYP. 264
7 -20.300d1nnfa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  16  1DITVYNGQQ-KEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEKTPADVFYTEQTATFADLSEAGLLAPISEQTIGRSRVVVYDHSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKG-WLKGLKENGKLYAKN-SVALQAVENGEVPAALINLAKEKGVENLKSRLYFVRHQDPGALVYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYP. 266
8 -17.600d1xvxa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Yersinia enterocolitica, YfuA [TaxId: 630]}  ali model 3D-neighbors follow..  16  5GIVVYNAQH-ENLVKSWVDGFTKDTGIKVTLRNGGDSELGNQLVQASPADVFLTENSPAMVLVDNAKLFAPLDAVTQAQGRWTGIAARSTVFVYNPEKISEAELPKMDLAKPEASPSGADFQAIVSAMLELKGEKATLEWLKAKGNSTVMKAVNAGQIDGGVIVDQAKTGENSGKTQLHYFKHQDPGAFVISGGGVLASSKHPKEAQEFVKWITGKSGQDILRT....... 262
9 -16.700d4edpa_ c.94.1.0 (A:) automated matches {Clostridium perfringens [TaxId: 195103]}  ali model 3D-neighbors follow..  15  1KLVVSTWGLNEDVLKEVFEPFAKEHGVEIVLDIGNNSERLTKMKNNSQIDITY-LAESFAEQGVEAGIFDKGYGPAYTLNSIIVVDPSAGIEINSWEDLWKPELKKIAIPDITTTNGPAMVEIAAEKAG-FKELEALKPNVVKSKSSDLANMFSNGEIVAAVASDFAFGTISKAKPEVINVIPESGTYLNFNTININKNSKNKDLAYEFINYALSKEVQEKTAKALNESP. 268
10 -15.400d3e13x_ c.94.1.1 (X:) Ferric-binding protein FbpA {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  17  2ELNIYSARH-YNADFEIIKKFEEKTGIKVNHTQAKASELIKRLSSNSPADIFITADISNLTEAKNLGLLSPVSSKYLKRARIIAYNKNDISKMKNYEDLAKAEFKGEIVMRSATAPYSKTLLASIIANGVLENLATNPK---GGDRDQA-RQVFAGEAKFAVLKNSKNPKDVEVGNSLGIIFPNQTHINI-SGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSNYEFP. 273
11 -14.800d4eqba_ c.94.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 525381]}  ali model 3D-neighbors follow..  17  15..............PELLTQFTEETGIQVQYTFDSNEAMYTKIKQGGTYDIAIPSE--MINKMKDEDLLVPKFSIPYFWGTLGIVYNETMVDEAKNSIMLFDGAREVLGLGLNSLGYSLNSKDPQQLEETVDKLYKLTPNIKAIVADEMKGYMIQNNVAIGVTFSGEASQMLEKNENLRYVVPTEASNLWFDNMVIPKTVKNQDSAYAFINFMLKPEALQNAEYVGYSTPN 270
12 -14.600d1twya_ c.94.1.1 (A:) ABC transporter, periplasmic substrate-binding protein VCA0807 {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  13  2EITISGSTSVARIMDVLAEKYQQHPETYVAVQGVGSTAGISLLKKGV-ADIAMTS-----RYLTESEAQNTLHTFTLAFDGLAIVVNQANPV----TNLTREQLYGIYKGQ--TREASSGTRYSFESLMGLTKTVKDREVLVVNSNSMMKTLVNHNTQAVGFISIGSVDKSVKA-DPTSDNIAKHTYQLSRPFLILHYSDNADEQTKEFIAFLKSESAKKLIVEYGYIMP. 249
13 -14.400d1q35a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]}  ali model 3D-neighbors follow..  19  3EVNVYSYRQ-PYLIEPMLKNFEKDTGIKVNIIFADKGLVDRVKQEGSPADVLLTVDISRVMEIVNADLAQKIDSKVLTRARVIYTSKGKLPAGFDYLDLAKPEYKNVSLFAAMIEHYGIEKTKAFLE-GLKANLARKPQ---GGDRDQV-KAIKEGICDYSIGNSYYYGKMLDDEKQKSWAEAAIINFP-ISGVVIAKHSPNKANAVKLIEYLSGEKAQGLYAELNHEYP. 270
14 -14.100d4n13a_ c.94.1.0 (A:) automated matches {Borrelia burgdorferi [TaxId: 224326]}  ali model 3D-neighbors follow..  12  3IVSIGGSTTVSPILDEMILRYKINNNTKVTYDAQGSSVGINGLFNKI-YKIAISS-----RDLTKEEIEQGAKETVFAYDALIFITSPEIKI----TNITEENLAKILNGE--NRDSSSGSYSSIKDLLLNKIFKTHQDGIVVKSNGEVIEKTSLTPHSIGYIGLGYAKNSIEKGLNILSVINSNKYTIKRNLIIVTNNKYEDKSVTQFIDFMTSSTGQDIVEEQGF.... 250
15 -13.900d1pota_ c.94.1.1 (A:) Spermidine/putrescine-binding protein PotD {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  15..............PGLLEQFTKETGIKVIYTYESNETMYAKLKTYGAYDLVVPST--YVDKMRKEGMIQKDYSIPYIWGATAIGVNGDAVDPKSVTLLLTDDAREVFQMALRKLGYSGNTTDPKEIEAAYNELKKLMPNVAAFNSDNPANPYMEGEVNLGMIWNGSAFVARQAGTPIDVVWPKEGGIFWMDSLAIPANAKNKEGALKLINFLLRPDAKQVAETIGYPTPN 272
16 -12.100d3pu5a1 c.94.1.0 (A:31-351) automated matches {Bordetella parapertussis [TaxId: 519]}  ali model 3D-neighbors follow..  15  4HIYVTSGGSFLENVRKMAEPFEKQSGVKVTLVPGTNPAHALKIRGTPPYDV-AAFGGNDMYRLIRAKKLAQGSLYDYSSVGIAYRPDKIQGGVKSWKEFVERTVAQVFFNNLSSNVRGAEVLSMFGKIYGSGYGDIEASIATLERMKDPVVLLTSGEGAIGPGWDGRTFIAEDSTKGMVKWVDPTEGAVSSGPVMAVVKGGKEDLAKAFMNYALGEEAQKAFCEAMYYGA. 276
17 -11.800d1sbpa_ c.94.1.1 (A:) Sulphate-binding protein {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  17  22..............KAFSAHWKQETGDNVVISHGGSGKQATSVINGIEADTVTLALAYDVNAIAERGRILPDDSAPYTSTIVFLVRKGNPKQIHDWNDLIKPGVS-VITPNPKSAAWGYALHHN-KAEDFVKALFKNVEVLDSGARGSTNTFVERGIGDVLIAWENEALLATNELGKDKFEIVTPSESILAEPTVSVEKKDTKAVAEAYLKYLYSPEGQEIAAKNFY.... 260
18 -11.700d2v84a_ c.94.1.0 (A:) automated matches {Treponema pallidum [TaxId: 243276]}  ali model 3D-neighbors follow..  12  14..............TSLIKKFEQQYNVQVVYDYASNEDMFAKLSIGASYDLVVPSGD-FVSIMKRKHLLEKSVPYYLGAAGIAVNKKAVPSYARTWSIFSRKDLARMSMMDDMREVMGAA----LASLGYNVNTKNEQELLVKFDSDGYAKSFASGDFVVAHGFAEAFFAETPEAMHEDFFIPQDVASPVVDSFCIPKGARNRDLAHAFINFFLEPAYAEFLDTFGFPSTI 274
19 -11.500d4ecfa_ c.94.1.0 (A:) automated matches {Lactobacillus brevis [TaxId: 387344]}  ali model 3D-neighbors follow..  14  4SITAVGSTALQPLVEAAGEQYGEHLGTFINVQGGGTGTGLSQIQEGA---VQIGNSDLFAGEQKGINARQLVDHRVAVVGITPIVNKKVGVKNLSTNQLIKIFTGQITVGGADQSAQGSGTRATFEQFGLANHRSKTAQEQ--DSSGMVRSIVATTPGAISYVAFSYVNKTVQALSLNHVAPTEVNVTRIWSYEHLYTKGHPTGLTKAFITYVQSPAIQNLVRQLGY.... 241
20 -11.400d2voza_ c.94.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}  ali model 3D-neighbors follow..  14  2TINLYSSRH-YNTDDALYDAFGEVNLIEA-----SAEELIERIQANSPGDILFTVDAGMLWRAEQAGLFQPVRSGKLQRARVLYYSRDNPADLSTYEALADPQWRNLSLTASRIAIHGEPETRRWLQ-GLVGNFARQPE---GNDTAQI-RAIAAGIGDVAIAYYIRLQKSTDPADQEVVE-ERGTHVNV-SGAGVLKNAPNRDAAIAFLEYLASDDAQRYFAEGNNEYP. 269
21 -9.720d2fyia1 c.94.1.1 (A:88-307) LysR-type regulatory protein Cbl {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  12  7VLTIATTHTQRYSLPEVIKAFRELPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPW--------FRWHHSLLVPHDHPLTQISPLTLESIAKWPL-ITYRQGITGRSRIDDAFARKGLLADIVLS-----AQDSDVIKTYVALG---LGIGLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKR....... 215
22 -9.370d1al3a_ c.94.1.1 (A:) Cofactor-binding fragment of LysR-type protein CysB {Klebsiella aerogenes [TaxId: 28451]}  ali model 3D-neighbors follow..  10  7SLYVATTHTQRYALPGVIKGFIERPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPC--------YHWNRSIVVTPEHPLATKGSVSIEELAQYPL-VTYTFGFTGRSELDTAFNRAGLTPRIVFT-----ATDADVIKTYVRLG---LGVGVIASMAVDPVSDPDLVKLDANGIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDT....... 215

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.