current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}, from SCOP206

Results of FFAS03 search in PfamA30U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
1 -6.260PF15550.4; G3W7G3_SARHA/37-338; Draxin  ali follow..  15  254NNKCFDDCMCMEGLRCYAKFHRNRRVTRRKGRCVEPES.. 291
2 -5.960PF12947.5; A7RMX3_NEMVE/115-150; EGF domain  ali follow..  24  8...CHQDASCVN---TIGSFACTCKPGYTGD......... 32
3 -5.240PF07645.13; Q8WPL1_OIKDI/1687-1732; Calcium-binding EGF domain  ali follow..  25  12DNCDPVNGVCSN---TIGSYECSCPEFFSGN......... 39
4 -5.200PF00008.25; LTBP1_RAT/1462-1496; EGF-like domain  ali follow..  16  1...CQDPNSCIDGVNTEGSYNCFCTHPM............ 27
5 -5.150PF07204.9; Q84142_9REOV/1-99; Orthoreovirus membrane fusion protein p10  ali follow..  13  4....MSSGSCNGATSIFGNVHCQAAQNTAGGDLQATSSLI 39
6 -4.850PF01414.17; C3XRV3_BRAFL/47-109; Delta serrate ligand  ali follow..  15  31SRLCRPKDDFVGHFTCDQNGNKVCREGWMGADC....... 63
7 -4.740PF12351.6; Q6BL79_DEBHA/62-241; Ca2+ regulator and membrane fusion protein Fig1  ali follow..  13  5....SNISTKLAEMTLSVGYLGVCVDIDKSLQCTSFNDLD 40
8 -4.720PF12955.5; Q2HCF4_CHAGB/283-397; Domain of unknown function (DUF3844 topsan)  ali follow..  27  12TNSCSGHGECVDKYARGNAFACLCKPSWGGNMCQKE.... 74
9 -4.370PF08779.8; NS7A_CVHSA/16-99; SARS coronavirus X4 like  ali follow..  17  17KEPCPSGGNSPFHPLADNKFALTCTSTHFAFACADGTRHT 59
10 -4.310PF07785.9; O89742_NPVBS/3-102; Protein of unknown function (DUF1623 topsan)  ali follow..  13  35...CPGTGECLAVCVGTFNAITKLPVPYEQFLLSDHNDKM 71

FFAS is supported by the NIH grant R01-GM087218-01
1 1 1 6 2 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Damiano JS, Stehlik C, Pio F, Godzik A., Reed JC. CLAN, a novel human CED-4-like gene. Genomics. 2001 Jul;75(1-3):77-83.