current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}, from SCOP206

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
1 -17.3001f7e_A mol:protein length:46 PROTEIN (Blood Coagulation Factor VII)  ali model follow..  33  8SSPCQNGGSCKDQL---QSYICFCLPAFEGRNCETHKDD. 43
2 -16.2004wm0_D mol:protein length:50 Coagulation factor IX  ali model follow..  42  11SNPCLNGGSCKDDI---NSYECWCPFGFEGKNCELL.... 43
3 -15.9001tpg_A mol:protein length:91 T-PLASMINOGEN ACTIVATOR F1-G  ali model follow..  43  53EPRCFNGGTCQQALY-FSDFVCQCPEGFAGKSCEIDTRAT 91
4 -15.6001hre_A mol:protein length:67 HEREGULIN ALPHA  ali model follow..  27  13KTFCVNGGECVKDLSNPSRYLCKCQPGFTGARCTENVPMK 54
5 -15.6001whe_A mol:protein length:86 COAGULATION FACTOR X  ali model follow..  31  52GHPCLNQGHCKDGI---GDYTCTCAEGFEGKNCEFSTR.. 86
6 -15.5001fsb_A mol:protein length:40 P-SELECTIN  ali model follow..  25  6DMSCSKQGECLETI---GNYTCSCYPGFYGPECEYVRE.. 40
7 -15.3004bdw_A mol:protein length:85 COAGULATION FACTOR XIIA HEAVY CHAIN  ali model follow..  30  50TNPCLHGGRCLE---VEGHRLCHCPVGYTGPFCDVDTAA. 85
8 -14.7001gk5_A mol:protein length:49 MEGF/TGFALPHA44-50 CHIMERA  ali model follow..  36  11DGYCLNGGVCM-HIESLDSYTCNCVIGYSGDRCE...... 43
9 -14.5001egf_A mol:protein length:53 EPIDERMAL GROWTH FACTOR  ali model follow..  28  11DGYCLNGGVCMH-IESLDSYTCNCVIGYSGDRCQTRDLRW 49
10 -14.2001fax_L mol:protein length:96 FACTOR XA  ali model follow..  29  9TSPCQNQGKCKDGL---GEYTCTCLEGFEGKNCELFTRKL 45
11 -14.1001a3p_A mol:protein length:45 EPIDERMAL GROWTH FACTOR  ali model follow..  30  8DGYCLNGGVAM-HIESLDSYTCNCVIGYSGDRCQ...... 40
12 -13.6004fbr_A mol:protein length:267 Myxobacterial hemagglutinin  ali model follow..  18  171DAKSNDGGKTLSGT---MTYNGEGPIGFRGTLTSPDTYTV 207
13 -13.5003u7u_G mol:protein length:55 Neuregulin 1  ali model follow..  38  16...CVNGGECVKDLSNPSRYLCKCPNEFTGDRCQ...... 48
14 -13.4001p0s_L mol:protein length:138 Coagulation factor X precursor  ali model follow..  29  52TSPCQNQGKCKDGL---GEYTCTCLEGFEGKNCELFTRKL 88
15 -13.3001pfx_L mol:protein length:146 FACTOR IXA  ali model follow..  38  53PNPCLNGGLCKDDI---NSYECWCQVGFEGKNCELDATC. 88
16 -13.3004gk9_A mol:protein length:279 agglutinin (BOA)  ali model follow..  13  48NIKSGDGGRTLTG---TMTYVGEGPIGFRATLTQSNTYAV 84
17 -13.2001nfu_B mol:protein length:195 COAGULATION FACTOR XA, LIGHT CHAIN  ali model follow..  29  47TSPCQNQGKCKDGL---GEYTCTCLEGFEGKNCELFTRKL 83
18 -13.2003ltf_D mol:protein length:58 Protein spitz  ali model follow..  28  13AWYCLNDAHCFAKIADLPVYSCECAIGFMGQRCEYKEID. 52
19 -12.8001dan_L mol:protein length:152 BLOOD COAGULATION FACTOR VIIA light chain  ali model follow..  33  52SSPCQNGGSCKDQL---QSYICFCLPAFEGRNCETHKDD. 87
20 -12.7001aut_L mol:protein length:114 ACTIVATED PROTEIN C  ali model follow..  24  19ASLCCGHGTCIDGI---GSFSCDCRSGWEGRFCQREVSFL 55
21 -12.5001p9j_A mol:protein length:54 chimera of Epidermal growth factor(EGF) and T  ali model follow..  30  16...CLHDGVCM-YIEALDKYACNCVVGYIGERCQ...... 45
22 -12.3001ivo_C mol:protein length:53 Epidermal growth factor  ali model follow..  30  14...CLHDGVCM-YIEALDKYACNCVVGYIGERCQ...... 43
23 -12.3002ygo_A mol:protein length:188 WNT INHIBITORY FACTOR 1  ali model follow..  44  152PGGCRNGGFCN------ERRICECPDGFHGPHCEG..... 180
24 -12.1003asi_A mol:protein length:410 Neurexin-1-alpha  ali model follow..  23  190EDSCSNQGVCLQQ---WDGFSCDCSTSFSGPLCNDPGTTY 227
25 -11.9004xlw_A mol:protein length:124 Neurogenic locus notch homolog protein 1  ali model follow..  27  9ANPCEHAGKCLNTL---GSFECQCLQGYTGPRCEIDVNE. 44
26 -11.8004d90_A mol:protein length:143 EGF-like repeat and discoidin I-like domain-c  ali model follow..  25  5PNPCENGGICLPGLA-DGSFSCECPDGFTDPNCSSVVEVA 43
27 -11.6005fm9_A mol:protein length:157 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  33  9SNPCANGGQCLPFE---ASYICHCPPSFHGPTCRQDVNE. 44
28 -11.3002vj3_A mol:protein length:135 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  27  12ANPCEHAGKCINTL---GSFECQCLQGYTGPRCEIDVNE. 47
29 -11.2005fma_A mol:protein length:154 NEUROGENIC LOCUS NOTCH HOMOLOG PROTEIN 1  ali model follow..  33  6SNPCANGGQCLPFE---ASYICHCPPSFHGPTCRQDVNE. 41
30 -10.9004cbz_A mol:protein length:312 PROTEIN JAGGED-1  ali model follow..  42  272HQPCLNGGTCSN--TGPDKYQCSCPEGYSGPNCEI..... 304
31 -10.1004xbm_A mol:protein length:531 Delta-like protein 1  ali model follow..  27  467HAPCHNGATCHQRG---HGYVCECARSYGGPNCQFLLPE. 502
32 -10.1002vj2_A mol:protein length:169 JAGGED-1  ali model follow..  42  131HQPCLNGGTCSN--TGPDKYQCSCPEGYSGPNCEI..... 163
33 -10.0004xl1_B mol:protein length:230 Delta-like protein  ali model follow..  22  200SGCHEQNGYCS------KPDECNCRPGWQGPLCNEAA... 230
34 -9.7301mox_C mol:protein length:50 Transforming Growth Factor alpha  ali model follow..  24  16...CFHGTCRF--LVQEDKPACVCHSGYVGARCE...... 44
35 -9.7203r05_A mol:protein length:1254 Neurexin-1-alpha  ali model follow..  31  195GGVCLNGGVCSVV---DDQAVCDCSTGFRGKDCSQGKEEY 232
36 -9.6905e8d_A mol:protein length:75 Proepiregulin  ali model follow..  28  40NGYCLHGQCIY--LVDMSQNYCRCEVGYTGVRCE...... 71
37 -9.5503h5c_B mol:protein length:317 Vitamin K-dependent protein Z  ali model follow..  27  10SQPCLHNGSCQDSI---WGYTCTCSPGYEGSNCELAKNEC 46
38 -9.3101iox_A mol:protein length:50 Betacellulin  ali model follow..  24  16...CIKGRCRF--VVAEQTPSCVCDEGYIGARCE...... 44
39 -9.0605f1a_A mol:protein length:553 Prostaglandin G/H synthase 2  ali model follow..  31  8..PCQNRGVCMS--VGFDQYKCDCTTGFYGENCST..... 39
40 -9.0104xlw_B mol:protein length:261 Delta-like protein  ali model follow..  25  231.HKGCRHGTCT------IPWQCACDEGWGGLFCDQAAA.. 261

FFAS is supported by the NIH grant R01-GM087218-01
1 1 0 0 1 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.