current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2fyia1 c.94.1.1 (A:88-307) LysR-type regulatory protein Cbl {Escherichia coli [TaxId: 562]}, from SCOP206

Results of FFAS03 search in PDB0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst TNDTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPHDHPLTQISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKRQVMESLast
1 -108.0002fyi_A mol:protein length:228 HTH-type transcriptional regulator cbl  ali model follow..  100  9TNDTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPHDHPLTQISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKRQVMES 228
2 -106.0004lq2_A mol:protein length:245 HTH-type transcriptional regulator CysB  ali model follow..  42  3TWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALR 222
3 -84.9004gwo_A mol:protein length:330 HTH-type transcriptional regulator CysB  ali model follow..  42  88TWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALR 307
4 -84.7001al3_A mol:protein length:324 CYS REGULON TRANSCRIPTIONAL ACTIVATOR CYSB  ali model follow..  40  88TWPDKGSLYVATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPEHPLATKGSVSIEELAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPVSDPDLVKLDANGIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALR 307
5 -66.7002hxr_A mol:protein length:238 HTH-type transcriptional regulator cynR  ali model follow..  21  25ADLTRGSLRIAVTPTFTSYFIGPLMADFYARYPSITLQLQEMSQEKIEDMLCRDELDVGIAF-APVHSPELEAIPLLTESLALVVAQHHPLAVHEQVALSRLHDEKLVLLSAEFATREQIDHYCEKAGLHPQVVIEANSISAVLELIRRTSLSTLLPAAIATQH--DGLKAISLAPPLLERTAVLLRRKNSWQTAAAKAFLHMALDKCAV.......... 231
6 -59.0002ql3_A mol:protein length:209 Probable transcriptional regulator, LysR fami  ali model follow..  17  4....AGPIAVGCYPALGPTILPSMLYAFTAEYPRASVEFREDTQNRLRTQLEGGELDVAIVYD-LDLSPEWQTVPLMTREPMVVLGAEHPLAGVDGVRLADLAEHPMVLLDAPPSTNHAM-DVCREAGFAPRVAYRTANFETARAFVGRGLGWTLLLQRPRVDVEGLPVVVKPIAEPKPSVAVVVAWHQEATLSRVARAFIRFVTAG............. 208
7 -57.7004ab5_A mol:protein length:222 TRANSCRIPTIONAL REGULATOR, LYSR FAMILY  ali model follow..  19  3TEGEAGELRIAVECHTCFDWLMPAMGEFRPMWPQVELDIVSGFQADPVGLLLQHRADLAIVSEAEKQ-NGISFQPLFAYEMVGICAPDHPLAAKNVWTAEDFIGETLITYPVPDEMLDLPKKILIPKNINPPR-RHSELTIAIIQLVASRRGIAALPYWTVMPYLEKGVVHRQITADGLQSKLYAAIRTEDTDKSYLNNFCQIIRER............. 208
8 -54.4003fzv_A mol:protein length:306 Probable transcriptional regulator  ali model follow..  18  90NDVIAGQIDIGCFETVAPLYLPGLIAGFRQAYPGVEIRIRDGEQQELVQGLTSGRFDLAFLYEHDLDSTIETEPLMPPQRPHALLPEGHRFAGQAQVSLRDLCLEPMILLDVQPS-RTYFVSLFEELGLTPNIAFSSPSIEMVRGMVGQGFGFSLLVTRPHSECDGKKVVMVDLAEPVSTSGLAAAWLKRAQLTKPARLFVDYCREQLGK.......... 300
9 -51.3001i69_A mol:protein length:219 HYDROGEN PEROXIDE-INDUCIBLE GENES ACTIVATOR  ali model follow..  20  1.ETMSGPLHIGLIPTVGPYLLPHIIPMLHQTFPKLEMYLHEAQTHQLLAQLDSGKLDAVILA-LVKESEAFIEVPLFDEPMLLAIYEDHPWANREAVPMADLAGEKLLMLEDGHSLRDQAMGFCFEAGADEDTHFRATSLETLRNMVAAGSGITLLPALAVPERKRDGVVYLPAIKPEPRRTIGLVYRPGSPLRSRYEQLAEAIRA.............. 205
10 -50.2003jv9_A mol:protein length:219 Transcriptional regulator, LysR family  ali model follow..  16  3....EGAFKLGLIFTVAPYLLPKLIVSLRRTAPKMPLMLEENYTHTLTESLKRGDVDAIIVA-EPFQEPGIVTEPLYDEPFFVIVPKGHSFEELDAVSPRMLGEEQVLLLTEGNCMRDQVLSSCSELAAKQRNTLQGSSINTIRHMVASGLAISVLPATALTENDHMLFSIIPFEGTPPSRRVVLAYRRNFVRPKALSAMKAAIMQ.............. 208
11 -48.7004qba_A mol:protein length:204 LysR family regulatory protein  ali model follow..  15  8IGEVNGTISIGCSSLIGQTLLPEVLSLYNAQFPNVEIQVQVGSTEQIKANH--RDYHVMITRG--NKVMNLANTHLFNDDHYFIFPKNRR---------DDVTKLPFIEFQADPIYINQIKQWYNDNLEDYHATITVDQVATCKEMLISGVGVTILPEIMMKNISKEEFEKVEIDNEPLIRSTFMSYDPSMLQLPQVDSFVNLMASF............. 204
12 -47.5003ho7_A mol:protein length:232 OxyR  ali model follow..  16  6QQSLTGRLNIAVLPTIAPYLLPRVFPIWKKELAGLEIHVSEMQTSRCLASLLSGEIDMAIIA-SKAETEGLEDDLLYYEEFLGYVSRCEPLFEQDVIRTTEVNPHRLWLLDEGHCFRDQLVRFCQMKGLHEQTAYSGGSMEAFMRLVESGQGITFIPQLTVEQLSPSQKELVPFGMPRPVREVRLAVRQDYSRRKLREQLIGLLRSAVPSDMHK...... 220
13 -47.0004xws_A mol:protein length:227 OxyR  ali model follow..  16  3MAQLAAPLKVGAIYTIGPYLFPHLIPQLHRVAPQMPLYIEENFTHILRDKLRTGELDAIIIA-LPFQEADVLTKPLFDEPFYVLMPADHPWTAKASIDSELLNDKSLLLLGEGHDFRDQVLEACPTVRKGKHTTVESSSLETIRHMVASGLGVSVLPFSAVDSHAPGVIEVRPFSAPVPFRTVAIAWRASFPRPRAIEVLADSIRL.............. 212
14 -41.6001ixc_A mol:protein length:294 LysR-type regulatory protein  ali model follow..  15  89...DVGELSVAYFGTPIYRSLPLLLRAFLTSTPTATVSLTHMTKDEQVEGLLAGTIHVGFSRFFPR-HPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRG-SFADEVIGLFKHAGIEPRIARVVEDATAALALTMAGAASSIVPA-SVAAIRWPDIAFARIVGTRVKVPISCIFRKEK--PPILARFVEHVRRSAKD.......... 294
15 -39.2004x6g_A mol:protein length:316 OxyR  ali model follow..  16  86KNQLAAPLKVGAIYTIGPYLFPHLIPQLHRVAPQMPLYIEENFTHILRDKLRTGELDAIIIA-LPFQEADVLTKPLFDEPFYVLMPADHPWTAKASIDSELLNDKSLLLLGEGHDFRDQVLEACPTVR-NKHTTVESSSLETIRHMVASGLGVSVLPFSAVDSYAPGVIEVRPFSAPVPFRTVAIAWRASFPRPRAIEVLADSIRL.............. 295
16 -38.2002h98_A mol:protein length:313 HTH-type transcriptional regulator catM  ali model follow..  20  85IATVSQTLRIGYVSSLLYGLLPEIIYLFRQQNPEIHIELIECGTKDQINALKQGKIDLGFGRLKIT-DPAIRRIMLHKEQLKLAIHKHHHLNQATGVHLSQIIDEPMLLYPVKPNFATFIQSLFTELGLVPSKLTEIREIQLALGLVAAGEGVCIVPA-SAMDIGVKNLLYIPILDDDAYSPISLAVRNMD--SNYIPKILACVQEVFATHHIRPLIESI 305
17 -37.6002h99_A mol:protein length:312 HTH-type transcriptional regulator benM  ali model follow..  18  85IASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKIS-DPAIKHSLLRNERLMVAVHASHPLNQDKGVHLNDLIDEKILLYPSKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPA-STQSIQLFNLSYVPLLDPDAITPIYIAVRNME--STYIYSLYETIRQIYAYEGFTE..... 300
18 -36.9003fxq_A mol:protein length:305 LysR type regulator of tsaMBCD  ali model follow..  15  87RGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANAT--RLAELQECRWAFSSAPRGPGAIIRNAFARYGLPPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHALQ.......... 297
19 -33.9003onm_A mol:protein length:238 Transcriptional regulator LrhA  ali model follow..  16  20....EGSLIIGASDDTADTLLPFLLNRVATLYPRLAIDVRVKRSPFIADMLSSGEVDLAITTAKVDSHPHVI---LRTSPTLWYCSVDYQFQPGEPV--------PLVVMDEPSLYREMAIEHLTQAGVPWRIAYVASSLSAIRAAVRAGLGVTARPIEMMSP----DLRVLGETEGLPGETRYVLCKDKQCDNELALAIFSALQNSYQHTMSSESSLIL 222
20 -30.4004jvc_A mol:protein length:216 Transcriptional regulator MvfR  ali model follow..  16  1......NLRVLLDTAIPPSFCDTVSSVLLDDFNMVSLIRTSPADSLATIKQDNAEIDIAITIDEELKISRFNQCVLGYTKAFVVAHPQHPLCNASLHSIASLANYRQISLGSRSGQHSNLLRPVSDK------VLFVENFDDMLRLVEAGVGWGIAPHYFVEERRNGTLAVLSELYEPGGIDTKVYYNTALESERSFLRFLESARQRLRELGRQRF.... 207
21 -26.4003oxn_A mol:protein length:241 Putative transcriptional regulator, LysR fami  ali model follow..  16  20......TFTIATTDYAMQTILPFALPRIYQEAPNVSFNFLPLQHDRLSDQLTYEGADLAI-CRPTGPVEPLRSEILGRVGVLCLLSKQHPLAN-QEMSLDDYLSHPHAMIAISDGVKALIEQALIDKP-QRKMVLRAYHLEAALAIVDTLPIIITVPALAYLVAERYDLVVKPLPFQFTPFDYSMIWHARCEHSPAQEWLRSVVREECSRLIAKRIEDMG 231
22 -25.6004rns_A mol:protein length:223 PCP degradation transcriptional activation pr  ali model follow..  11  11...SNRNFRIAASDFGQALMLPRLYATLEETAPQVRVTGVNLRHGPLVEELESGSIDIAF-GGFPTLSAGIKTQTLFREEYVCVMRQSHPALT-HGLDLEAFCRHIIVTAHEFNHVHEQVEARLLELLPPESIRFTTENFLVSAVIAEETDVILTIPSLARWFANRGGLTIFPVPIELPSIEVKQYWHERYDKDPGNIWLRRVIAKIGFQNPPAE..... 223
23 -21.6003hhg_A mol:protein length:306 Transcriptional regulator, LysR family  ali model follow..  13  88HEIPQGVLSVDSAMPMVLHLLAPLAAKFNERYPHIRLSL--VSSEGYINLIERK-VDIALRAGELDD-SGLRARHLFDSRFRVIASPEYLAKHGTPQSTEELAGHQCLGFTEPGSLNTWAVLDAQGNPYKISPHFTASSGEILRSLCLSGCGIVCLSDFLVDNDIAEGIPLLAEQTSDKTHPFNAVYYSDKAVNLRLRVFLDFLVEELGNNLCGK..... 300
24 -21.3003szp_A mol:protein length:291 Transcriptional regulator, LysR family  ali model follow..  14  86CRGASGRIRISAPSNLTKRMMMPMFNAFMEKYPDIHIEL--MMSNQADDLDPTE-WDVIFRVGPQRD-SSLIARKIGEVKDILVASPQYLSSHPQPTHAEELHQHQLLKG-YPLLKWQLTNSQGETVVNSDRGRFQASALNVVRSACSEGLGITLMPDVMLREFEDGSLVQVLSDWSSNPRDIYMLYNHKDHQPEKVRLFIDFVIGYHLQ.......... 291
25 -20.1001utb_A mol:protein length:315 LYSR-TYPE REGULATORY PROTEIN  ali model follow..  16  106......TFNLAMTDIGEMYFMPPLMEALAQRAPHIQISTLRPNAGNLKEDMESGAVDLAL-GLLPELQTGFFQRRLFRHRYVCMFRKDHPSAK-SPMSLKQFSELEHVGVVALNTGHGEVDGLLERAGIKRRMRLVVPHFIAIGPILHSTDLIATVPQ.............................................................. 255
26 -20.1002esn_A mol:protein length:310 probable transcriptional regulator  ali model follow..  19  102......TFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALDEEHERLPEGIQAHDWFADRYVVVARRDHPRLA-GAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPR.............................................................. 254
27 -19.7002qsx_A mol:protein length:218 Putative transcriptional regulator, LysR fami  ali model follow..  14  14TNTDQELLVVDVTPSFASLWLVPNINDFHQRHPNIRVKILTGDGA----KNIHGESDLHVRCLPLSTHYEYSQLLCEETLLLIGNTNLPKLSDN-----QAISHYPFI---PQTTRPQLWEQFKQENDLECPITYHSVGFEHFYLACEAEKGLALLPDFMAQFSLRGDIQHIGNLKLHSGYGYYVVIPNFRLTSRKVALFHDWLKDKLTHHT........ 218
28 -19.0003kos_A mol:protein length:219 HTH-type transcriptional activator ampR  ali model follow..  14  7TKQTQEKLKIGVVGTFAIGCLFPLLSDFKRSYPHIDLHISTHNNR-----PAAEGLDYTI-----GAWHDTDAQYLCSAL---MSPLCSPTLASQIQTPADILKFPLLRSYRRDEWALWMQTVGEAPPSPTHNVMVFDSSVTMLEAAQAGMGVAIAPVRMFTHLLSSERIVQPFLTQIDLGSYWITRLQSRPETPAMREFSRWLTGVLHKTS........ 211
29 -18.9003kot_A mol:protein length:219 HTH-type transcriptional activator ampR  ali model follow..  13  7TKQTQEKLKIGVVGVFAIGCLFPLLSDFKRSYPHIDLHISTHNNR-----PAAEGLDYTI----GGAWHDTDAQYLCSAL---MSPLCSPTLASQIQTPADILKFPLLRSYRRDEWALWMQTVGEAPPSPTHNVMVFDSAVTMLEAAQAGMGVAIAPVRMFTHLLSSERIVQPFLTQIDLGSFWITRLQSRPETPAMREFSRWLTGVLHKTS........ 211
30 -17.3003mz1_A mol:protein length:300 Putative transcriptional regulator  ali model follow..  13  87....KGRLRVETASAFANLVIIPALPEFHKKYPDIQIDL--GVSDRTIDYLAEN-VDCAIRAGTLTD-QSLIARRITEMKFVACASRDFLERHPVPQHPSDLEKNCYVVGYFLPKTGQQMPFHFRRGNEEIEVTMAANESTTYLAAARAGLGVIQAPLFMVREDRNGTMVPVLPDWQVEPMPIYLVYPPNRHLSSRLRVFADWVVKVMAQS......... 294
31 -14.9004kd5_C mol:protein length:233 ABC-type transport system, molybdenum-specifi  ali model follow..  12  1SNADSVELNISAAASL-KEAMAKIEEEYKKVDSNVKLTVNYGASGSLQQQIEQGACDLFISAGQKQMKVSDTMKDLVKNDLVLISSADSSVSGMKDLTTDKVKKIAV-SVPAGKYADEVLTNLNLKDKLKDKLVF-AKDVKEVLAWVQSGADVGFVYFSDTVNNDKIKVVEKTDEKTHSPITYPVSVIKASKNVDAAKKFEEFLLSESGQKIFEE..... 226
32 -13.9004n13_A mol:protein length:265 Phosphate ABC transporter, periplasmic phosph  ali model follow..  15  7NQDNEKIVSIGGSTTVSP-ILDEMILRYDKINNNTKVTYDAQGSSVGINGLFNKIYKIAISSRDLTKEEIEQGAKETVFAYDALIFITSPEIKITNITEENLAK--FINRDSSSGSYSSIKDLLEEAQFRQDGIVVKSNGEVIEKTSLTPHSIGYIGLGYAKNSIEKGLNILSVNSTYPTKET-IIVTNNKYEDKSVTQFIDFMTSSTGQDIVEEQ.... 258
33 -13.2004omb_A mol:protein length:347 Phosphate binding protein  ali model follow..  15  47ASGVSGNLSSVGSDTLAN-LMTMWAEEYKRLYPNVNIQIQAAGSSTAPPALTEGTANLGPMSRKMKDVEKPTAVPVAVDALAIFVHKDNPIKGLTMQQVDAIAKKPVQLFGRNSVSGTY-EEALCKGDFRPNVNEQPGSASVVQSVSQSLNGIGYVKTVALAKKEGAAFVEDNEQNALNGT-VYVNKAPNKPLDPLEAQFLKLVLSKTGQQVVVKD.... 315
34 -11.8004h1x_A mol:protein length:265 Phosphate-binding protein pstS 2  ali model follow..  19  151SQHLSGKLSVVGSTSVSS-LMEKLAEAYKKENPEVTIDITSNGSSAGITAVKEKTADIGMVSRELTPEESLTHDAIALDGIAVVVNNDNKASQVSMAELADVFSGKLTTWDK............................................................................................................ 263
35 -11.0003c9h_A mol:protein length:355 ABC transporter, substrate binding protein  ali model follow..  12  29GKTDAQTLVVYSSLDEP--LATPMIEGFQKANPDIAVHYEDMLTGEIYDRIVKETADFAFSSAMRSDLAMSARWPAWAYHKPSFTTEKPPATRAEFVDYLERHAKEIATYDIERSGVGFLFMSVIKAMGAAGVKVYSTSSAILER-VSDGLGYNILGSYAADWASRHPDVGI--KDYTVVMSRIGLVPEAAANPELGRRYLEFFMSKEGQTIMARQ.... 296
36 -11.0004q8r_A mol:protein length:252 Phosphate ABC transporter, phosphate-binding  ali model follow..  12  3....TNSVSISGSTSVGP-VMEAEAEAFKTKKPDVSIEINQIGSSAGIKNAMEGVSEIGMASRDLEKQAGLKEVEIAYDGIALITHKNNPVKDLTLVQIKDIYTGKITNWKELGGNDAPIVVVSREDGSGTRDAFQSDGSGNIKSLVQGNENIGYISFSYVDDS----VSAVKVDGVEATPEN-LAVYKEENLTESGKSFIDFILSEEGQDIVAKE.... 240
37 -10.8002hxw_A mol:protein length:237 Major antigenic peptide PEB3  ali model follow..  11  2......DVNLYGPGGPHT-ALKDIANKYSEK-TGVKVNVNFGPQATWFEKAKKD-ADIAIASDFGKDFNVSKIKPLYFREAIILTQKGNP---LKIKGLKDLANKKVIVVPEGAGKSNTSQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVV-YRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKK..... 226
38 -10.8004gd5_A mol:protein length:279 Phosphate ABC transporter, phosphate-binding  ali model follow..  12  32EAKSTNSVSISGSTSVGP-VMEAEAEAFKTKKPDVSIEINQIGSSAGIKNAMEGVSEIGMASRDLEKQAGLKEVEIAYDGIALITHKNNPVKDLTLVQIKDIYTGKITNWKELGGNDAPIVVVSREDGSGTRDAFQSDGSGNIKSLVQGNENIGYISFSYVDDS----VSAVKVDGVEATPEN-LAVYKEENLTESGKSFIDFILSEEGQDIVAKE.... 273
39 -10.8004io2_A mol:protein length:248 Glutamate receptor 1  ali model follow..  12  3ARLKGITLRIGVIESVPFT-LIEYLRDKMGFVADVQLAPPNTSYTGLVLALANGDYDIAIGDITVTSARREISNSISDNSMRILMRKGTLIDGMDDLKNGKIPYNR-IGIRIGTAGEDYYLREISGGSR--NFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCNLTVGEDFDKSTFGIVTPKEWLYAKDLDVNILSLRETGILDNLKK..... 239
40 -10.8003fir_A mol:protein length:251 Major antigenic peptide PEB3  ali model follow..  10  15FSMANADVNLYGPGGPHT-ALKDIANKYSEK-TGVKVNVNFGPQATWFEKAKKD-ADIAIASDFGKDFNVSKIKPLYFREAIILTQKGNP---LKIKGLKDLANKKVAGESNTSGTGVWEDMIGRTQDIRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEK--LVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKK..... 245
41 -10.7001twy_A mol:protein length:290 ABC transporter, periplasmic substrate-bindin  ali model follow..  15  23PFVQASEITISGSTSVAR-IMDVLAEKYNQQHPETYVAVQGVGSTAGISLLKKGVADIAMTSRYLTESETLHTFTLAFDGLAIVVNQANPVTNLTREQLYGIYKGQITNWKQVGGNDQKIAVVTREASSGTRYSFEVNSNSMMKTLVNHNTQVGFISIGSVDKS----VKAIQFEKADPTSDN-LILHYSDNADEQTKEFIAFLKSESAKKLIVEY.... 271
42 -10.1004ecf_A mol:protein length:264 ABC-type phosphate transport system, periplas  ali model follow..  10  3....GESITAV-GSTALQPLVEAAGEQYTGEHLGTFINVQGGGTGTGLSQIQEGAVQIGNSDLFAGEQKGINARQLVDHRVAVITPIVNKKVGVKNLSTNQLIK--LINRAQGSGTRATFEQFGLANHRSKTAQEQDSSGMVRSIVATTPGAISYVAFSYVNKTVQALSLVAPTEVNVTTNDWRIWSYEHLYTKGHPTGLTKAFITYVQSPAIQNTLVRQ 239
43 -10.1002o1m_A mol:protein length:258 Probable amino-acid ABC transporter extracell  ali model follow..  10  11GQKKVQTITVGTGTQFPNICF-ELIKELDKRLPHYKFTFKTMEFSNLLVSLGQHKVDIVAKSKEREKKFLFNKVAYNHFPLKITVLQNNDTIR----GIEDLKGKR-VITSATSNGALVLKKWNEDNGRPFEIAYEGQGANETANQLKSGADATISTPFAVDFQNKTSTIKEKVGNVLSNAKVYFMFNKNQTLSDDIDKALQEIIDDGTLKRLSL..... 238
44 -10.1004exl_A mol:protein length:265 Phosphate-binding protein pstS 1  ali model follow..  10  3....GESITAV-GSTALQPLVEVAADEFGTIHVGKTVNVQGGGSGTGLSQVQSGAVDIGNSDVFAEEKDGIDASALVDHKVAVLALIVNKEVDVDNLTTEQLRQ--VINRAAGSGSRATFDTVIMEGQSAMQSQEQDSNGAVKSIVSKSPGAISYLSLTYIDDSVKSMKLYDLSPENISSNNWPLWSYEHMYTLGQPNELAAEFLNFVLSDETQEGIVKG 239
45 -9.9202pvu_A mol:protein length:272 ArtJ  ali model follow..  13  31GGATKKKVVVGTDAAFAPFEY-DLLDAVMKA--GLDYELKNIGWDPLFASLQSKEVDMGISGITITDERKQSSDPYFEATQVILVKQGSPVKNALDLKGKTIG------VQNATTGQEAAEKLFGKPHIKKFETTVVAIMELLNGGVDAVITDNAVANEYVKNNPNKKLQVIEDPKNFASEYYGMIFPKNSELKAKVDEALKNVINSGKYTEIYK..... 252
46 -9.7902v25_A mol:protein length:259 MAJOR CELL-BINDING FACTOR  ali model follow..  13  35..KSKGQLIVGVKNDVPHYALLDQATGEIKGFDDKKIKLVAVNAKTRGPLLDNGSVDAVIATFTITPERK--SEPYYQDAIGLLVLKEKKYKSLADMKGAN------IGVAQAATTKKAIGEAAKKIGIDVKFSEFPDYPSIKAA-LDAKRVDAFSVDKSILLGYVDDKSEI-LPDSFEPQSYGIVTKKDPAFAKYVDDFVKEHKNEIDA.......... 252
47 -9.7803fd3_A mol:protein length:208 chromosome replication initiation inhibitor p  ali model follow..  16  3......TLNIATADSLGTWFLDAVSKFTGGS--DYLVNIAVDDQDHTVEWLRGGRV-LAAVTAHDKPVQGCRVTPLGVLRYHATASPDF----ADGVTPAALARAPGLTFNQ----KDRLQASWIRTALGEDVSYPTHWLPSTDGFVKAGMGWGLNPVQLVAEHLAAG.................................................... 162
48 -9.7301atg_A mol:protein length:231 PERIPLASMIC MOLYBDATE-BINDING PROTEIN  ali model follow..  12  1......ELKVVTATNF-LGTLEQLAGQFAKQ-TGHAVVISSGSSGPVYAQIVNGAPYNVFFSADEKSPEKLDNQGFYAIGKLVLWSAKPGLVDNQGKVLAGNGWRHIISNPQIAPYGLAGTQVLTHLGLLDKLTAQANSVGQAHSQTASGLGFVALAQIIQAAAKIPGSHWFPPANYYEPIVQQAVITKSTAEKANAEQFMSWMKGPKAVAIIKA..... 224
49 -9.6803cvg_A mol:protein length:294 Putative metal binding protein  ali model follow..  11  15SKHSPVQLRIGNGGAGQSGLVKELADAFIKSKVDFKVAWYKSDTTVTINYLKDGIVDVGITYSPVAERISIKSYYAFRDHFMLIGPPSNPAKLSGDSDIADMPPVRFLSRYDKSATNIKEAELWLSIGQVPWATAYST-AILLREYTITDYGTYLSIPRGLRDQMVIYKKGTNDADDPLLNPAHLLVGARAKNAEMAKEFAKWL---VSKEGGQKVIEG. 270
50 -9.5603hn0_A mol:protein length:283 Nitrate transport protein  ali model follow..  11  2..TEDTVIKVSVLRGPSVIAFADWLEN-IIDNKKVQVKVVD-SPDLAQALLIKQETDIAVL-------PMINAANLYNKGIKIKLAGCPIWGTLYLVEKTPLKEPALYVFGNGTTPDILTRYYLGRQRLDYPLNYANTAGEITQGILAGKVNRAVLGEPFLSIALRKD-ITADLNHLTDNDTLGFAQTAVVYTPTMEKYRIAFEDAL............. 203
51 -9.4704f3s_A mol:protein length:255 Putative periplasmic binding protein  ali model follow..  11  4SIVEGRTLNVAVSPASPPMLFKSALFSSYCQSRHCKLNITEYAWDGMLGAVASGQADVAFSGISITDKRKKVSEPYYINSFYLVSMANHKITLNNLNELNKYS----IGYPRGMAYSDLIKNDLEPKGYYSLSKVKLYPTETMADLKNGNLDLAFIEEPVYFTFKNKKKMPIESYVFKNVDQLGIAFKKGSPVRDDFNLWLKEQGPQKISGIVDS..... 230
52 -9.4003kbr_A mol:protein length:239 Cyclohexadienyl dehydratase  ali model follow..  14  13...ESGVLRVATTGDYKPFSYRT-MAQRLAESLGAKLVVVPTSWPNLMRDFADDRFDIAMSGISINLERQRQSIPYLRDGKTPITLCSE---EARFQTLEQIDQPGVAIVNPGGTNEKFARANLKKARILVHPDNVTIFQQIVDG--KADLMMTDAIEARLQSRLHPELCAVHPQQPFDFAEKAYLLPRDEAFKRYVDQWLHIAEQSGLLRQRME..... 233
53 -9.4004jb7_A mol:protein length:256 Accessory colonization factor AcfC  ali model follow..  12  13YFQSNADVNL-YGPGGPHVPLIKVAESFEKSQ-SKRVNITFGPQATWNDKAKKN-ADIAIAEGHSERFSKFNIHPVFMREAIILVKKGNP---KNIKGMADLLK-GIVVNDGAGVSNTSGTAVWEDSAFRSNIHVFAPNSSARKAFVDGEDIDAWITDWAIANPTIGDMVRME-DEYRIYRDFNVVLAKNP--SSEAIDFFDYLTKSKDAEAI....... 242
54 -9.2704gvo_A mol:protein length:243 Lmo2349 protein  ali model follow..  12  4ANQKVQTITVGTGTQFPNVCF-ELVKEIDKRLPGYKFKFKTMDFSNLLVSLGAGKVDIVAKSKEREKKFLFNDVAYNNFPLQLTVLDSNNSIN----STKDLAGKR-VITSATSNGALVLKKINEEQGNNFEIAYEGQGSNDTANQLKTGADATISTPFAVDFQNKTSAIKEKVGDVLSNAKVYFMLGKDTKLSKKVDEALQSIIDDGTLKKLSE..... 231
55 -9.2604dz1_A mol:protein length:259 DalS D-Alanine transporter  ali model follow..  11  24SIVEGRTLNVAVSPASPPMLFKSALFSSYCQSRHCKLNITEYAWDGMLGAVASGQADVAFSGISITDKRKKVSEPYYINSFYLVSMANHKITLNNLNELNKYS----IGYPRGMAYSDLIKNDLEPKGYYSLSKVKLYPTETMADLKNGNLDLAFIEEPVYFTFKNKKKMPIERYVFKNVDQLGIAFKKGSPVRDDFNLWLKEQGPQKISGIVDS..... 250
56 -9.0703k4u_A mol:protein length:245 BINDING COMPONENT OF ABC TRANSPORTER  ali model follow..  14  2..SLRGELRVGLEPGYLPFEMKD-LAREMAKAMGVKLKLVPTSWDGLIPGLVTEKFDIIISGMTISQERNLRVEPYIVVGQSLLVKKGL---EKGVKSYKDLDKPELLVTKFGVSAEYAAKRLFKNAKLKTYDTEAEAVQEVLNGKADMFIFDLPFNVAFMAQKGQGYLVHLD--TSLTYEPLGWAIKKGDDFLNWLNHFLAQIKHDGSYDELYE..... 224

FFAS is supported by the NIH grant R01-GM087218-01
1 1 6 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.