current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d4i0va_ a.1.1.1 (A:) automated matches {Synechococcus sp. [TaxId: 32049]}, from SCOP206

Results of FFAS03 search in JCSG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVQHRNDVLNRLast
1 -6.170SP17774A ZP_02421418.1 411235 Selected-2009-11-12  ali follow..  13  469.NYAGTLGGKDAYKTLAEYVGSILFASAGITSMKDSGNGYSYTLNACKAITKAYATTNNWDIAFGIPNQVRLVTKTTLSPYYWPDLYNKIIKSFTSEGITTINLDDATTLLYSDFSRENYSRA 593
2 -6.000C.LS8106A NP_419464.1 423845 Selected-2011-09-02  ali follow..  11  10...............................................ERLLAYAAGTLSPPEAVVVATHLALRPETRVWSDLGQAVGGGVLEDLEPSALDAGALDKTLALLDQPEPQEPTVRL 85
3 -5.990FL11062B NP_149192.1 376317 Crystal|NMR-2007-06-08  ali follow..  41PSLYNHFSNMSDLKISMTTYLLNSLNFKLMQDLVGKSGEAAVKIFAYTYKDFAMENKTAYRLFLSTKTTENEEVN-----RMAKETNNIILQVLSFYIKNDVDLIHKSRALRSLLH....... 151
4 -5.650MH15446B SYN_PCC7942_21JUN05_CONTIG52_REVISED_GENESYN_PCC79420111 394063 Purified-2009-06-15  ali follow..  13  234....RNLGGNDLDDWLTDYFAKQLAPTRVLTRLAERIKIQLSTTPEASEVYFDDETLQSLQLQLDRSQFQQILHDRGF--EQLDELLESVLQQGRRQGINPDAIAAVL............... 338
5 -5.540ND8722A BC005944 372002 Selected-2006-08-07  ali follow..  249.CLYVNF---DGAQKKLRECESVLVNDFFLVACLEDF-IENARLFIFETFCR------IHQCISINMLADKLNMTPEIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAM 371
6 -5.470MA16047A NP_061938.2 399907 Purified-2009-03-27  ali follow..  4........GSCPWRNSSSSLQMASLMRKNWRISFTRLT-----LTTPNYFVDHMG---DYEDASLETLNHSVLKAMGYTKKVYEG-GSNVDQFVTRF-LLKETANQIQSLLSSVESAVEAIEE 110
7 -5.290SP19091A NP_252807.1 413271 Purified-2010-09-29  ali follow..  72..LLNSIGG---------SVPEAIRMGRLLRESGFDALVPSSSVCQGTCVYLLAAGKRKTVRGYVGLHRPYYAHGDSLHSRSANGMRYDSAAYFREMDIPSTLVQAMQST............. 170
8 -5.060SP17533A ZP_02045018.1 406597 Selected-2009-11-12  ali follow..  50..........................................................ARSEWASNEFVQSVLADSSISEAELQDMRQRVLNCLTDKGVTGASFGP................. 97
9 -4.980SP16989B YP_001298078.1 409666 Selected-2009-11-12  ali follow..  15  725PGLASKMGGNDTLCAMLNDAFEKATATDFVFGYGGGVSYANQPGCSNAHVFAHAGKPQYWVRRVKEQAHGAITPDKGYGGHDEDQGQMGGVGVLMAIGLGGSGQHPAYDITSPIFDEVTI... 852
10 -4.970PU10068B NP_981043.1 381521 Crystal|NMR-2008-10-28  ali follow..  15  76..LLYKIYSNDEDAVFTRSFIALIIDADTNHNFLSQNDILNVKDQLILYMNN-FRGYVQDHGWAHSIAHEALVRSPKLETLYYEEILQTLLNKVCVHSYKYEEDERIVYPIVAMLQNGLK... 206

FFAS is supported by the NIH grant R01-GM087218-01
1 1 9 0 5 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Slabinski L, Wooley J, Deacon AM, Lesley SA, Wilson IA, Godzik A. Genome pool strategy for structural coverage of protein families. Structure. 2008 Nov 12;16(11):1659-67.