current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d4hsxa_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}, from SCOP206

Results of FFAS03 search in JCSG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst GFKQDIATIRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKSDQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKFFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMKLast
1 -6.770RF20619A.CABIN1 BC054497 421217 Purified-2010-12-07  ali follow..  12 1492.......................LFCERNKT-NFFNGIWRIPVDEIDRPGSFAWHMNRSIVLLLKVLAQLRDHSTLLKVSSMLGKKYDRQVLAQRAFILTVKVLEDTLSELAEGSERPG.................. 1596
2 -6.630PG9814B NP_284435.1 372229 Purified-2006-12-13  ali follow..  11  15...RVWQQRLNPLQLSALEKALRIIEAHPEYHRYLER-TDWLPENGESNPFLH---MSLHLSVQEQAG-IDQPHGIRAIHDTLCAKRGWLEAEHEMMEALAETLWTAQRYGTGLD-VNFYMTRLRKLIGLGAEDQAR 149
3 -6.550PE00071B YP_208077.1 368157 Crystal|NMR-2006-08-05  ali follow..  10  15...RVWQQRLNPLQLGALEKALRIVEAHPEYHRYLERIEDHLDTDW--LPENGESNPFLHMSLHLSVQEIDQPHGIRAIHDTLCAKRGWPEAEHEMMEALAETLWTAQRYGTGLD-VNFYMTRLRKLIGLGAEDQAR 149
4 -6.390PL10453A YP_384072.1 401473 Crystal|NMR-2009-10-09  ali follow..  2TAGGLHNGSGGMESARHCRELVERWLADGSFDARLPEVV--RLRGVLQPEQYHAEGTHTMLAMEAVPDDADPRVFWGVLLHDIGKGHAEAGAG------EVSAIMTRLG............................ 119
5 -6.230SP19120A NP_249151.1 413330 Selected-2009-11-12  ali follow..  15  67AVGGTGALLGLAKNQLAGNDYSQLVKTIPGLDKL---AGNNALAGLGGLGNVLGKSGGDSKGLGSLLGNADSMGDVNKAFGTL-------GMDSGMTEKFAQVLVDYFGKQGANSESNLWGVSKAGGSSLL...... 192
6 -5.850WT2637A.CSTF3 BC108319 422887 Selected-2010-11-11  ali follow..  10  33...DAWSILIREAQNQPIDTYERLVAQFPSSGRFWKLYIEAEIK--------AKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKEKMAQAYDFALDKIG--MEIMSYQIWVDYINFLKG........ 152
7 -5.560RH20319A CHUT_08NOV04_CONTIG199_REVISED_GENE2640 416011 Selected-2009-12-04  ali follow..  286FKKEFFAKVFFSTENRLYKFRKIFDSLFPTVSKIISFYKEKNYKDLSIELQ-RLESEVMISNVAKNLIDLEVNEFIT---------HDAIYCTNEFYNVVRAEVISSFHN........................... 386
8 -5.530SC.B20917C LCAS_20SEP02_SCAFFOLD15_REVISED_GENE1186 427587 Selected-2013-01-04  ali follow..  167AIFEASKGVVNRIQQLGNSLVSTVFSDKQPLRTVIFLYRNPKAHTPKIYDPSSVDAVQAFVIMSAAQTMLDSVVNVRDFL......................................................... 277
9 -5.480SP19252A YP_094301.1 412206 Purified-2010-09-29  ali follow..  54.........RYQDIPQADYLLMAAYLENPYDSKLAAHLGFIHIWKITERERVKNNSPLLPNEIILSKKYFADALQLDPTQLVEGQIFKDKQEEVRGYFTLQKAI................................. 159
10 -5.470GD14180A YP_001300393.1 388190 Selected-2007-09-21  ali follow..  15.IRMLWKDLEPEAKDKGLKLAFRVFFHGVDGVPSYVYEAGATESPIDDNPVFLEKLDKFIEAFAKEYDNPDEVDYIDYGLGRWGEGHGLVLEKQDNLESVIRQITESYARHFKK....................... 155

FFAS is supported by the NIH grant R01-GM087218-01
1 1 9 0 5 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Slabinski L, Wooley J, Deacon AM, Lesley SA, Wilson IA, Godzik A. Genome pool strategy for structural coverage of protein families. Structure. 2008 Nov 12;16(11):1659-67.