current user: public

anford Burnham Prebys Medical Discovery Institute

Query: d2nxoa1 c.94.1.1 (A:5-281) Hypothetical protein SCo4506 {Streptomyces coelicolor [TaxId: 1902]}, from SCOP206

Results of FFAS03 search in JCSG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst TRPRVGHIQFLNCLPLYWGLARTGTLLDFELTKDTPEKLSEQLVRGDLDIGPVTLVEFLKNADDLVAFPDIAVGCDGPVMSCVIVSQVPLDRLDGARVALGSTSRTSVRLAQLLLSERFGVQPDYYTCPPDLSLMMQEADAAVLIGDAALRANMIDGPRYGLDVHDLGALWKEWTGLPFVFAVWAARRDYAEREPVITRKVHEAFLASRNLSLEEVEKVAEQAARWEAFDEDTLAKYFTTLDFRFGAPQLEAVTEFARRVGPTTGFPADVKVELLKPLast
1 -23.200TM0202 TM0202 282082 Crystal|NMR-2005-02-27  ali follow..  13  17FGETLLNPLGPALIPVVPIMDGKIPTDVKIEIWKNPEEAVAKIVSKEVDFAVLPVTVGANLYGKGVRIKLVGVHEWKVFYLVASDDADGWESLRGQEVYTPGRGQTVDVLMRYFLSKA-DVKILYAPPQEIVALFKSGKVKYAALPEPFVSMCLDRGK----VVLDFQKEWGKELGVPIPIAGLFVREGV---DKETVEKVEKALIDSIRWMKENLDETVQLSSEKLGIPAKILKSSLEEFEYVPVEKCREEVETFLKKLNELEGFEKIPDEGFY.. 298
2 -22.900GS13941A YP_001302749.1 385158 PDB-2009-05-29  ali follow..  10  24TVIKVSVLRGPSVIAFADWLENPPIIDNKKVVVDSPDLAQALLIKQETDIAVLPMINAANLYNKGIKIKLAGCPIWGTLYLV------EKTPLKEPALYVFGNGTTPDILTRYYLGRQ-RLDYPAFNTAGEITQGILAGKVNRAVLGEPFLSIALRKDSSLRITADLNHLTDNDTL-----GFAQTAVVYTPTMEKYRIAFEDALRASCQKAVRYPKETIHSLEEHGIFAQGALTP---KIYYLSAIEAKDAVMGFLRLIEQYGRLPD......... 294
3 -14.600SP18178A ZP_02433689.1 410363 Selected-2009-11-12  ali follow..  35AEIKIGAGDDISGVLMDETVEALKDYKVSSFQDCCSNTAQWAMNAKEINVGFYIARHTVMQNQDVEIYGPVIMNGETIVYK---------HWENVENLAVTQGREKSKDLAQETYPQIQGF-NEITQKGILYALEDEQVDAAILDITKAAKVP--------------DYRNMPLSDTDYISYVLVVDKEFEKT--EAFRDFIDSYNRAVSRLSNSDYLAWTMGVKEEWLENKNIK.......................................... 253
4 -14.400TT16457A YP_557872.1 404271 Selected-2009-08-14  ali follow..  12  38.TMAVGGLPGLYYLPVLTAFKDEGLDVTLEDFAGGSKALEA-VVGGSADVGAGAFEHTLFMQEKGQHYRAFALMGRAPQIVVAVLKSKTMADFKGAKVGVSAPGSSTDLVLTVALRKA-GVQRNEISAAVLAAVSGGQIDALSNVDP---MMTKLARSGAIKVLVDTRTV-QEVFGGTMPAATLYASDSFIQKYPKTTQALANAIVRADHWLQSASDADLLKMVPPAALYVEAFHNVRDAYSPDMPADGPATSLRALSSFDN-RLDPKKIDLN.... 330
5 -14.100TM0484 TM0484 282357 Purified-2004-07-19  ali follow..  23.TVVLDWYPNTNHTGLYVAKDLGFYREDVKIVQPSRLTAEQLVASGKAEFGVSYQEAVTLSRGEGMPIVSIAAIIQHNTSGFAWLKDEGIKDWEGKRYGSWGSPIEKATIEYIMRKY--KVIFVNVGQMDFFAGTLNDVFDFAFYGWDGVASKVKGIEIEFLPLKDIDEVFDYYT-------VLITSESLMKQKPDLVRRFLRATAKGYEYAIQHPVEAAKILLKYAP-SQKYLAGQYKADAEKWGYQKEEVWRRYAEWLHSMGFLKEMIDVT.... 307
6 -12.900FR14695A NP_110623.1 392498 PDB-2010-04-29  ali follow..  11  21........................................ELPFRIHNICSETGKFDVVLDSITNMPKYGLKIFA-----GVRIDMYSILGDESSGRIYTLRKGTLADFNARILAYYD-KAQVINA-DGDTCIKMANEGYSALVGN-----------------EISIGKSFRNRMK-----ELGLDLPSCAMASTRRIDEVIEAYEQGIDFIKNNHERAAEIISKKSGYSEEVMKKIIGIYGHEVRAELVGSRELYSRVVPELNDIE.......... 222
7 -9.640MJ10004D YP_001085762.1 402131 Purified-2009-08-28  ali follow..  11.TLRIGSFG-IYLLPILEAFRQRYPKIEIYIDEGEDKEVAQWLLERRIEVGFLIMPD--ERFDTFPLIEDRFVALIPSGYPLAQQLYIDPAQLENCSFIMTMAGSRHQ-VELILKNFNVKPDIKFYVSQILSIVSMVHNQLGISIVSDMVITKELLSLYPNVVKRPFKPNLKRSIGL-----AVKNKKHISPAVKAFIEVAQEVWSD...................................................................... 212
8 -8.450SP18507A ZP_03311351.1 410566 Purified-2013-07-19  ali follow..  12  26QTLNFGIISTEASQPFLKDMSKALGMEVKAFFASDYAGVIEGMRFKKVDLSWIGNKGAMVMVDR-VFAQTTAPDGSKGYYSCLIVNKQNLDDMFAQSFSNGDPNSTSGFLVGYYVFAKNGKDPQKIFART-LSVANNTVDVATCNNEGLARLAITAPEKA-----ELRVIWKS----LIPSDPLVWRKDLPDETKKKITDFIFSYGVKGENVEQARKILTALQWGPFIKSDNSQLIPLRQLELFRAKTVLEGNKDMDAKEKAAKIAEIERKLAELG. 321
9 -8.210SP19058A NP_290738.1 411032 Selected-2009-11-12  ali follow..  12  31KALNFGIISTESQQPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDR-VFAQTVAADGSPGYWSVLIVNKNNLNDLLAKTFGNGDPNSTSGFLVPGYYVFSKNNISA---ETNALAVANKQVDVATNNTENLDKLK----TSAPEKLKELKVIWKS----LIPGDPIVWRKNLSETTKDKIYDFWAPFRASSDLQLVPIRQLALFKEMQSVKGNKGLNEQDKLAKTTEIQAQLDDLDRLNNALSAMSSVSKAMQ...... 338
10 -7.950SP19058B NP_252073.1 413305 PDB-2010-05-25  ali follow..  13  28PVINFGIISTESSQPFLKDMSQQTGYQVKAFFAPDYAGIIQGMRFDKVDIAWYGNKAAMEAVDEIFAQTVAASGAPGYWSLLIANKDSKIDSLESLTFGNGDPNSTSGYLVGYYVFAKNNVDPVKAFKRT-LAVANKQVDVATFNTEGMERLELTQPEKA-----QLKVIWKS----LIPGDPLVWRNNLSDEQKNKLRDFFFKYGANAE................................................................... 257

FFAS is supported by the NIH grant R01-GM087218-01
9 6 8 0 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jambon M, Godzik A. New avenues in protein function prediction. Protein Sci. 2006 Jun;15(6):1527-9.