current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}, from SCOP206

Results of FFAS03 search in JCSG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst FVPGQSQRTFVFAATDYTAFALLPPLMNRLQHSAPGVRLRLVNAERKLSVEALASGRIDFALGYDEEHERLPEGIQAHDWFADRYVVVARRDHPRLAGAPTLEGYLAERHAVVTPWNEDSGVIDRLLARSGLRREVAVQLPTVLAALFLAGSTDFLLTAPRHAARALAEAAGLALYPAPFDIPPYVLRLYSHVQHVGRDAHAWMIGQLKGLDLast
1 -77.100MJ15872A YP_269805.1 402763 Purified-2009-10-17  ali follow..  18  90FNPAELSGILQISSSDYALVTILPMLLTQVNALAPNLKVIIRDFESDNLNQLMVTGELDLVFTFPEF---IPDNYPNKRLFEDHHVCVTGSNSIYRGKKYSLLELAQLPQIVISPSRPNKGSHDSWFAKQGMKRHILMSVPSFSAASTIIEATNTIAFLPSRLLP----DPKLVAIEIEQNPPKFDVIVAWHQRSNNNPLHLWLLGLLDNI. 294
2 -76.600MJ16305B YP_096410.1 403149 Purified-2009-09-04  ali follow..  21  92FDPFQTKRSFKIALPDYVELILLPSLMAALEK-LPHIVIETTIQSMADDPHLFIDENVDLAIGAINE-NSLSAQLKVEKLYEEEIICFASKNNPLINRPLSLEDYISNKHIAFSFNQERYSHSAEYLYKRKLVRNDMLFVKNILPAIFAVANSDVISTAPSFLINMFARQFNLGMQPLPFNLEPTPIYLVTHSKSQYDEGVSWLAKLVSSS. 301
3 -46.100MI5695F YP_001093047.1 397918 Purified-2009-07-14  ali follow..  10  96KSSELASERLRVAVTPSIMASLSLAFSRSNAR-DAFSQLQFVIWG-DDSADQIHNGELDMGVTFDAC---NEHPLSVEALGCLSGVCLANEEHAIWSEPLTLETICRHPFLCLDGKGDKIDPLEVFARQNGADIDSIERVSSRDEWYSHLLTMNSVAFLPCSEAEICGALPGIRVVRLSDEESMSPQYLLLENPAEYRRYSLEQRELIIQL. 313
4 -31.200GE9959A NP_744664.1 396785 Selected-2008-07-09  ali follow..  19  185...GTLRGVVHVGALPLGRSRILPDAILRFTAQHPQVRVVTNESPFDLLATELRVGDVDFVLGALRPHD-YASDLVGEPLINEEMVVLARRGHPLLHTHLTLKGVHQARWVLPRAGSPARQLLDNCFAAAGLTAWPVVESADLAVIRGLLVRSDMLAAVSAHQLAYEIASGELQRLPLALPGTARAIGLMQRSGCLQSPAAVALMACIRQVI 393
5 -29.800MJ5394B YP_573074.1 402843 Purified-2009-10-17  ali follow..  17  105........SVSVGTVMAPAVTLLTSAVERVHRDRPNLKVSIDVDVSHELIPRLVEGEFDFAIARIPSTLP-AGDFVFEEIGEEALCFVCRAGHPLADTSLNLEAMVEYPWVLQPPGALMRQRVDHLFLHHGVA---IIDTPDILVALAMVDKSDTVTVTTRQVAELLCDQPRFRILPFPEALSVQPYGLVSLREQRLSPGAAALMSALRDLI 309
6 -26.600MJ16352A YP_001083951.1 402107 Purified-2009-08-28  ali follow..  12  70........TVRIASLPSTAHPLLSTLYKVLQEKYPLIKLSVREGQGVHLEKWLEDGSVDLAILYRFNPT---PKQGDIYLTQADTYLVGCEGDALTASEVDFKAINQLPLVTFCRPSNWRNFLDHMAYENGVELNIVFEADSISLQTHLVSESRMYTMLGPQALKKASQYTSIQAAKIINPALKRYISLSISKHGYLTPACKAVMEEIRNL. 270
7 -26.400MJ10004D YP_001085762.1 402131 Purified-2009-08-28  ali follow..  10  16............SFGASSSIYLLPEILEAFRQRYPKIEIYIDEGEDKEVAQWLLERRIEVGFLIMPD-----ERFDTFPLIEDRFVALIPSGYPLAQQLIDPAQLENCSFIMTM--AGSRHQVELILKNFNVKPDIKFYVSQILSIVSMVHNQLGISIVSDMVITKELLSLYPNVVKRPFKPNLKSIGLAVKNKKHISPAVKAFIEVAQEV. 209
8 -25.800MJ9946AD YP_001083473.1 402177 Purified-2009-11-14  ali follow..  12  92........RLKIGTSHHIGLHHLPAPLKHFVQQFPQVTLDVHFVDSEQAHEQVLAGDLEL--AFLTLPPSGDERLNYITIWNDPLVFVAAPFHPLAQKNLTLQDLIEYPSLLPAAQTYTAQITLAEFEKQGLKPKITMSNNPLESIRMLVSIGLGWSVLPKTLLNQ-----DMQQLDLNVEMN--QLGMVWHPARTQSRAMQELIKMMQE.. 286
9 -25.800MJ5559B YP_001084443.1 402153 Purified-2009-08-28  ali follow..  11  46.....KTGTLKLGVPPLGS-QLLTTALFDFHRQWPDIELAFMEVGSRGIEQALLNNELDVGVLLQPFDE---QTFNSIELCNYPLMVLLRRDATWARKKINLEELQHQSFLMFPENFSLNSIILDACKQYGFYPTIACRTSQWHLLADMVLQRMGIALLPQYYTDMLDPT---LFAAVPLEKPNIHLVMAWKKNLPASPAVQAWLSIVRQ.. 246
10 -25.700MJ15765A NP_794810.1 403300 Purified-2009-10-30  ali follow..  12  98........RFRLGALYSLTVKTVPQLIMGLKIRRSELNIDLILGSNIDLLYKLKNMEVDAML-VSLDESTNDPDCEHLALFSDDIFLAVPTDSPFAHHEVDLIDLREATFITLTQGFATHRDGVRVFQQAGFEPKVAMQVNDIFTLLSMVSSGVGYALLPGRIAAVYENRVRLIPLQSRYRMQQ-HIGVVFLKSKERDPNLLALLAECRMY. 299
11 -25.600MJ9078DF YP_354904.1 403429 Crystal|NMR-2010-01-14  ali follow..  18  84.RPEQLRSTVRIGTIDSIVQAWLPRFIERVRELYPGLTLDLNVDTSRGIAREIVERKIDLAL----MGPVLEAGLRNVDLGSMDCAWVAAPGFGLGGRRIGLADLVDLPILTFSRNSDPHVWLMRQFEELRLPQPAISNSNSLSAMLRLALEGVGVALMTRPVVEAALASGALDLLDVDPPFPPLALHAVFADHGDN............... 276
12 -25.600MJ9946O NP_791994.1 403323 Purified-2009-10-30  ali follow..  16  92........RLTLATSHHIGLHRLPPVLRAFTRAYPKVALDIQFLDSEVAYEEILHGRAELAV--ITLAPEPHALIRAMPVWDDPLDFVAAPEHPLANGPMQLADIVRYPAVFPGSKTFTHHIVSGLCEAEGLKPNIAMSTNYMETIKMMVSIGLAWSVLPRTMLDE-----QVARIPLPGVQLNRQLGYILHTERTLSNAARAFMKLLDA.. 287
13 -25.200MJ9078CG NP_791619.1 403253 Purified-2009-10-23  ali follow..  15  84.SDTPPSGLLRLGVPQTIGDVVLLDALKQLRGEFPDLRAQVSTGWGSHLIGKIENGELDAAAALFPAGKIFPDNIVGQSIGKMELVVVCAKGSV-PKKPGKLADCYEQGWVLNPDGCGFRAGLQRTLTDQGLSMKVNLETFGTELQLGLVADGMGLGLVPRPLLERSAHREQLVVLPLKDFKPVMDLWLFYPRF.................. 275
14 -25.200MI15770B YP_001813813.1 398113 Purified-2009-07-03  ali follow..  15  83.KTDVLCGTLRVAAPESLTISRLGPVIKRFSQHHPDVKLILTNGTCGENQEELLNGRVDVA--MMLFPAMAVEKCLHHVLTEEKIVMVGAPDAPEHFKD-IQKKQSDHVYITNEQGCSYRTMFEQHLTKQNLLSFQTMELWSIGAIKKMVMSGLGFAVLPYITVQEELENGSLKIIKQDEAFEPIYSHILIKKKKWVSPIAHAFMEAVID.. 288
15 -24.800MJ9946D YP_269555.1 402759 Purified-2009-11-17  ali follow..  89.....EKGEVKLGVPSMLGSYFFPEILMAFKRKYPNLKLTIIEAGTQSIRQMLLDGELDLGVIHNEDV---PQRLETEHLVTSQMVAVVSERHPLAQPYIKFEDFFKEDLVMFKAGYFHREFIDEICEKYHFKPKISFETNLLPMMLNIVRHDFSISALLELVTEHENGVVAIPFEEP-----HLNIAMAWRKNGYLSLADRAFLEFVNA.. 287
16 -24.600MJ9946S YP_354162.1 403383 Purified-2009-11-14  ali follow..  14  99.................TAVPMVADLTAPFLERHPAVHVRILSRTSTEILSGIESLEFDAGITYLDNEP--LGRVTQVPLYAESYRLVCGPAFPLPTGSLGWDEVARLPLCLLTADMQNRRIVNQHLAGTGAPASPSVESNSTLTLFAHVMTGRWASVLPKKLADLFAGTGRLRAIPIVGPEVSHQVGLIAAYREPHTPILTALIEAARRLE 292
17 -24.500MJ9946M YP_958837.1 403170 Purified-2009-09-04  ali follow..  13  92........ELHAIASHHIGLHHLPNWLRRYRREYPQVDLHLQFMESDAAYDQMNKRNAELAF--VTLSDSMNPEFSILAQWPDPMAFVVGKEHPLATASPSLSDLAPHPALLPDTSTATYRVVSRLFLEANLTLRPLMPTNYLETIKMMVSVGLGWSILPVSMLDN-----SLKVLEVPHPVTR-VLGAVALSRRQLGSAAQALLQIVEQ.. 286
18 -24.100MI5559M YP_002936986.1 398369 Purified-2009-07-17  ali follow..  15  94........SVSIGASETALNIYLLDRLKPFHMAYPGIRLKIYNHSTPQAINAVKNGMIDFAV--VSTPAEVEAPLKMIKLGSFQEILVGGTTFTALGSQLSLKELHNYPLIGLGRETMTFQFFNRLFMSHGLEFAPDTETATTDQILPLVKSELGLAFMPKPMAEAAIANREIVEIALEEEIPQRNICMVYDIHQPISAAARELKKVISD.. 294
19 -24.000MJ9946J YP_384640.1 402935 Purified-2009-10-17  ali follow..  13  94.....AKGEVRVGIPPMMSAYFFPEIIRDFSNSYPDLHLTVSGEGASKIQKMIIDGELDMGVVAGASF---PETLEVRRFLREEVIVCVPRSHPLARGSLTLHEFARHPLIFYREGYYLRELILDVLRGAGLSPTIRFETNLYTLVKSLVQKGMGISVFLRMVVAEDDDLTAISLDPP-----FLDLLIAWKKHGYLSRANRAFADYLLE.. 292
20 -23.900MJ9946L YP_957179.1 403164 Purified-2009-10-23  ali follow..  14  80.RSSIMEARLRVGASSNIGIYMLQPYIRRYKELGVGPEVDVVIDSNPTIARHLSDGELDVAI----EWWHDLPGFHAQAWRNEPVVLIVPPGHPLARTDIDRDTLSNMALIGGEPGTGTGRLLATYFGEHGPFPTVSMQLGSTEAVKQAVKVGLGASLVLESSVREEVQNGSLVAIPVSEPGLSKELMVIYPSSLDKHRPVYSFVGHLCE.. 286
21 -23.900MJ15868A YP_002547625.1 402264 Purified-2009-09-11  ali follow..  16  93........KLSVAASYTVIGYFLPLHIERLKRQFPGVDIQLFELNRESVEEGLLANRYDVAV--LLTSNILNPELTTETLLNSQRRLWLPARHPLLTRPSVGLKDVAEENYIMLTVDEASHTTLKYWSPTPYQPKVTLRTSSVEAVRSLVANGQGVAILSDMVHRPWSEGRRIETVTLTDPVPSMDVGLAWRRNADFSPAMEAFRAYFRRA. 294
22 -23.300MI9078O YP_611622.1 398168 Purified-2009-09-24  ali follow..  13  96........TLRLGTIIDPEFIRLGRLLSQLGASNPRITTELVHGVSGEILERILRRQVDAGYYLAAPDQPSETELHAQKLADFAYRIIAPPGWDARVAGAGWAELARLPWIGTPEVSVHNRLLSRIFAEHDCQQNTVAQVDHEASMLEMVRSGVGLSLCRESIALHQRQSNGVVICETL----PASLGVLTLKDRLEDPLIAAFFDQLSAV. 300
23 -22.900MJ13015C YP_002547445.1 402240 Purified-2009-10-30  ali follow..  16  89.....KRGHVTIHANGATVANLLAPALADFSLVYPNIRFSVTISSAGQAMEALSSAKADMAVTLFSEPD---PGIRVRARAQIVYDVIAASHHPAAHAEMTVTELARFPLAVPDGSFGARRAFDAWFSKAGLELDPVFVTGSLEMQRELVLRGAALTLLPAQTVARERRSGELVVIPVA-AGIRTPIDLCVAGDRQLSFAASKLVDAVER.. 292
24 -22.800MJ15766B YP_573755.1 402804 Purified-2009-10-23  ali follow..  16  91.....ETGHLSLTVGEGFVGDLLDTPLRTFTERYRGVRLDVNTGSTSDIIEAVVEDEAHIGLMYHERLH---PQLRFWHSSRQPLVALMSPSHPLAENELPLATLSEHPMALWRTGHGVRQLVDEGFREAGLGQHVTMQTNSLSVLLHAARSELTLTLLPAFAAARELEDGALVARAVD-RFRQAHAHIITRVGRRMPKAGLQLLRHLER.. 295
25 -22.200MI10021C NP_746710.1 398446 Purified-2009-06-29  ali follow..  100.................LASFNPMHLLLPLREKYPELHFQLSSLSSEQVIDGLSRNQLDLGICYLDQVN--TSFFEVIELGTTTMGLLHDTRHFQFSDRLRWDELGDIPLGLLSKGMHYRQSLDLSFRSRGLEPNAVLESDSSFQLIQAINTGICCAIMPLDCGLE-DLSEHLRIVPVADAAIHSPVGLLLRRSEPRSAIAEQCFAEARGL. 291
26 -22.000MJ9959C YP_270525.1 402719 Purified-2009-09-11  ali follow..  12  100........HLRLASVPSIACRMLPELLSKFIADVPELHISFYDDNSEAVLRKVEKQQVDIGIASLPHGHE-HADITFTPIWEDQLGVVCREDHPFAETELHWKELRKQRLIRNGT-----SRLLEDTEAEPLLSDSQFLISNMLSLIAMLEEGLGITTLPWFAFPKNNS----KLRFIPLTTPKIHIGIVQLKNKSLSPAAEALANFILK.. 294
27 -22.000MI9078AF YP_166361.1 398297 Purified-2009-07-16  ali follow..  13  87.DPAGVEGRLRLGASETIAQCWLPDLVTRLHQLFPKLEIELVVDISANLRAGLMDRELDLAI----LGPLSEFSVNNVELPDFELAWYAAADTS---SEAIAASYLSRPVLTYPRNTRPYRELKEKLFEQAGPNFSLFPSSSLSACFRLVEADLGVAVLPRALGREYVLAGRIREFDPGWVPAPLRFTICYMGEPKSQLIETAAH....... 284
28 -21.900MJ9812X YP_383498.1 402984 Purified-2009-09-24  ali follow..  10  82LNVNEPKQRISLCCTPAFGIGRLPSIVSAFMADNASADLNFVFNMPEQALEGIENGRFDLAI-IEHCDDLNMAGHRGYPLPDDEMIFLSAPSLGIDSPAPSIEQLFDKRLYLKNEQGCARRFLDKNLALTGHS-ANIIYFDDLQFIMREVLAGKGISFVPIGLVVDELCRHTLMAHRIADFDHFYPRTIILGRRAPSPLLLSFINTIYIAFG 296
29 -21.700MJ9078HW NP_902731.1 402648 Crystal|NMR-2009-12-03  ali follow..  10  92........QARVGVTLMPDILKLGPWVAALVSAHPLLEVQLTHGVSVDVLNLVRKKELDAGFYLGKNP---YMNVSTVPLQTLDFRVALPPAWAGQMASGKLKDLGKLPWVGISQFSSLSKITAELWREINISPKKVAESDHLAVILELVAAGVGAALVREEEALAWEAEGRVWLVPDL---KRAELQFVYPADRAGDPVLETLLRELLAV. 289
30 -21.500MI9946X NP_746578.1 398292 Purified-2009-06-23  ali follow..  12  92........QITIGTIYPATFGVLPNFVSRINQRFPEARIHIHNGNTVGIVREIERGNINLGF----RPVENIGSLRWQSIHREKYLLAIARENPLSSKSTVTPDDLRKQKIIAFSRAYNSQTDDNFPEKYDLNQQVVYSCNDTQAMLAMITAGIGVGFVPEWVKS--IPGQNFELREVEGLERHIGLGLAWSVDDPTVNRDSIIE....... 286
31 -21.400MI12798AC YP_001095923.1 398563 Purified-2009-09-02  ali follow..  15  91......EDQLVIGADPLVPMSVFDSALEKMAEKFPFTRVKLVKLTGNHLNRAIEADEVDVGFNI--MSEAVPENLDFIGIARIEWVCICSPDYKFADEAVDSEMLINERQIVCSSMLQ-----NEYLAKLGRVSQETWEASDLDDMIRLVEQGIGWGIIPLSMYEEKAAIGTLSTFKPVIEKETITVDLLWKSTAQLGPAKSFFIDLLKR.. 290
32 -21.200MJ9946AC YP_001086262.1 402174 Purified-2009-08-28  ali follow..  17  80.....................LIPKCVRYFQQQYPKVNLKLEEANTLLLIDLLLEDRLD--VAIIRSPRNMPDSLILQELLAEPLIAALPSESFNLSQEIDLTA-LRELDFIVSPPSVSAGLFDAIKQERGFQPKIGQNAPQIVSILSLVSANLGVSLVPESTKQ--LQIQGVAYRSLKAPVPTVGLGLAYKKHAPSQMAINFAS....... 264
33 -21.200MJ9078FD YP_001086122.1 402136 Purified-2010-01-11  ali follow..  10  84.PDAPPSGPLKIGAIESSATTRLPNLLAKYHQRYPEVSIQIITGTWKQLLVDISQHKLDGAI----AGNIEFPMLNKLSIYQEDMVLIASHSLGEIR---CQEDLIGKEIFMWTEGCPYRAALEEWLKLKNISLPI-TSITSYATIIGCVSAGSGVALVPKSIYEQYKNLAHIQSYKFE-YLAFMQNHFFWHKNVSNHKARDMFIELIKS.. 284
34 -20.700MJ9946AE YP_001083768.1 402179 Purified-2009-08-28  ali follow..  33...SRLSGHVTVGFSPSVAAVIGTHFLKLMRNRYPDIKVRLIEGLSGDLKALVNARQLDVAIIFSDDVD---PQWAIQPLVKEQMFLISPKEVLNQNQTITHSQLKELPLILPSQRHGLRLLLEQKIHQL----KVAYEIDGLHLLMESISQLEMATIQPAGASLNSRQDLCLLRVVEP------INYLISLSEEELSPATLATKVVIRAC. 239
35 -20.600MI9078CS YP_612671.1 397920 Purified-2009-09-24  ali follow..  14  97........ALSIGLIDDFDNDLTPRLATILADSLTQCRFKMVTASSHDIHRAMAEKDLHIGV--AASTGELRTGVTEYPLVEEPFILVAPRGCI-TDPDDVGNQLNHLPLLRYARDQLISQQIESHLSRNKMEFDDRFEIGSHLALMAMVARRGWAITTPLGYMRAVRFHEDIDAYALPFAGFSRRISLFAQSDWPDTVPLEVAGTVRRLTQ 298
36 -20.400MI10004C YP_832020.1 398103 Purified-2009-07-24  ali follow..  14  92........HVKAAFFPSAAEMFLPGLLHRVKAV-EGLRFEACFEDPGVAGFAALAADYDIVLAVDGPDVFARQGLVVVPLLNEPLDVAVPAGHVLAKPSLTASDVVGFPWMGVPEGFPFDTVLRQIEVQAGSPAVRAQLFPDLRVLEALVSAGHGLSLLP-RYTALGNQERGFVLRPLLGVTARRSIVALARPDVAARTTIAQVLSMLEAEA 296
37 -20.300PG5559D YP_014768.1 372894 Purified-2006-12-20  ali follow..  11  86...HHLKGRLRIGASFTIGEYFLPEVIAKFHALYPDITIELIIENTAKIADKVELLQVDTGL----EGQVSKKDLEISAFSDDEMCIVGRADGSLT------EIEQGATWIAREEGSGTREYLDHVLSTNGWNVAEKVVAWSNMAVKQMVLEGMGYTVISKCVVQTEITSGKLQTFNEAGSLMR-KFSVLKNRQRLENRIAETFLTFLKE.. 282
38 -20.100MI9078CT YP_511640.1 397930 Purified-2009-07-03  ali follow..  15  100........SLSLGVIEDFENEVTPLLATRLAEAMSQCAFVLQTGASHVLQARIAARELDMVI--CAAGDVAPRGTIALPLLDDPYILAVPKGVSV---SRGLASLSDLPFLRRDLDQVMGQQIEAYLERAGQTPPRRFEMDSNQSISALVAAGTGWTITTALLARAGRFASGIEAHPLPGEAMARQIVLYATSDWAGGIPDQWLGSQFRVL. 320
39 -20.100MJ10001E NP_792613.1 403270 Purified-2009-11-23  ali follow..  16  87...QEENHQIKLVAISALAAGLLPTALSRLPEPLRPQQIQLQSMSPENVVQAVLSKTMDLGAVSLPLEH---RGLEIHWIGEASCVAVLPADSPLAAHDLSMELLRQQTLITMANPYRFRRRIDKAFHDAGGEPPRMLDTNTSLIAMQMARVGLGIALVDPFTAIGVPLQ-DVVVRPIACSIP-FFFGLISAFASPLSEVASALVEEIAV.. 289
40 -19.800FP9946B YP_804543.1 382998 Purified-2007-12-04  ali follow..  89...SNPTHYLNVGYLENFRLEKMYAVLDQISHE-NNIQFSLFPDTPTNLSKGLSSGKYDLIYSLRPYTTD-NVLFKSTDFLENHLQIALPINHPLAMKPQLSFSDLKNETFILLDRDKSPIIVDNVLSKNGYNLKANYYVKNLSQGLSMTALGNGLAFLYSAMNDQLEKQYRIKIKDLTDNFGNQNIVIAMKRSVDNALIGSIFE....... 292
41 -19.600MI12798D YP_009533.1 398136 Crystal|NMR-2009-09-19  ali follow..  15  92......EPRLVLAVDELAWGPALVDRLTGFAERWPDVEMEFLFGIVGDIALMVAEGRAHMGIMVWRDAESRLAGLDYFPAGAVPALPVVAAGHPLAGRAVSPDELEALRQLDIT---------SRGGERPDALSGQVWRVDSYWALRDLVRAGLGWAYLPESLAASDLDAGRLVRLDLAPAGEVWPLYLVRDARRAPGPAARWLLEALAK.. 304
42 -19.500MJ12798E YP_958135.1 403239 Purified-2009-10-23  ali follow..  13  94......ETRLRIGFNSLLPAQCLFPAIDAFYQLGVPVDVQVVEEVFAGAWDALQSRRVDMVIG-ADQLSKPAGSFTTKPLGEIPFVFAVAASHPLAQAEEPLTESDIAPFPAAVAADTSRALPPGHAGIFRRQRT--LTVTNIDQKIAIQEAGLGVGWLPLPRIREALAAGRLVTKAVHEPRPPIAIHLARHSE-DKGKALMWFWNRLSE.. 293
43 -19.400MJ12798K NP_902352.1 402599 Purified-2009-09-18  ali follow..  13  92......ETRLTIVLSDTFQSRTLESVACRLEERYPLLELECLVGEQEDVLDLILSGRAQLGLVG--AMDSYPPDVRHQRQREAELALYAAHRHPLAGDRIDEQQLDQHRQLRLN---------TYSDKTPADSGQRQWYAPSYLMLLDMARLGVGWAELPCWLVHSFGGG-ELKQLDVAGWPKRMPVDLVWAANKPLGAAAGWLLQQLTD.. 285
44 -19.400MI12798AF 17739614 397895 Purified-2009-07-22  ali follow..  13  95......EAELSVAISTMVPAEAVVAVLRDFREQFPTVTLSLNVGELGMVMDMVLSRKAGIGIGG--AVLRQDDDLVMEKVGHSFMLPVVAADHPLAQRPLVLADVREEVQLVVTDASGLTK------RDFNVLSYKTWRVSDIATKYQLIKGGLGWGGLPASIVRNDLTNGSLKALELEYEQGEYPLFTLRRVDSPAGPAGQWLAQAFQE.. 294
45 -19.000MJ10038I NP_902892.1 402605 Purified-2009-11-14  ali follow..  11  85AASGQGRGTLRIGSVATLSRNFQEWFLQPVLKE-ADVRLVLESGSLDELLQRLKAHELDVVLSNRPALGDDKQSWRCRTLARQPVVLVGPPRPEG-RTFQFERDLPALPLLVPSRKSEIRLRFDLLCEELALQPAIRAEVDDMAMLRLLARDAGCVALLPAIVVRDELGKGLLQQYCVVPRVEE-TFYAITVQRQYLPPLLQDLLRMAAD.. 291
46 -19.000MJ9946G YP_575208.1 402830 Purified-2009-10-17  ali follow..  19  90.....AEPALRLGIGPYDTF-AIPHLYDQ-----HERDIDLVRLPMADMTTALLANRVDMIC----IEVPSQRGIAHQLLFEEPLVAVLPPDHPDAQSDIPAEVFDRGRHFTYSITPESGHEFEHFFQPAGVYPSHMVQIESVALILELVAAGKGVSILSRWAARDAHQAGHVVMRPLAGDIPRIPWYLAYTQTPHIAAVAEPLADTLRHLY 290
47 -18.500MJ12798C YP_155482.1 403052 Purified-2009-10-23  ali follow..  12  97......EPEVKLALEMVFDRSLLVPVLDEFQQLSRGSRLVISDTVLTGTMEQIQEQAADVVIS-----HHIPRGFIGEPIGQYSMDLVCHPEHPLAKQPINQNELSQYLQIVIQDTGSQPVEDEGWLKAEQ-----RWTVSHFDEALRLIRNGLGFCWLPGYIAQEDLDSGRLAKIEVE-SSRKGSLYMVLPKAELTGPCAKTLSELILK.. 293
48 -18.200MJ9946K YP_154857.1 403091 Purified-2009-09-11  ali follow..  13  90......EPLLTLCYDHTCDSKLWVPSIQHIQQQYPTTELHVDGESQMRALKRIDNGSADLALCPWLPLFRQYGDFETLPVAPFELTVVISTALMKEFGRMPQSRQDLLELPMLVPQNLEIGINLDAVLRLPSQQR--IRVNEVNTQFELLMAGFGWGIIPKHIALDALEQGKLVEISIP-QQVRLEIHLVRSANRTLGPAANAIWESFA... 292
49 -17.900MJ9946AA YP_778302.1 402554 Purified-2009-10-23  ali follow..  13  89...ADGVQVVRLSVVHTLLFTFLPQRLRKLRDELGHIKAKVQAVNIPDGVQALVEGDTDLFLAYHHPQLPIANRFPFLTLGTDKLIPVSATDANGSAVRLSGESQEPIPFMAYAPGTFLGNVVEMLISVETCGLRRTFEAHMSEAVKAMVVAGNGLGWLPASCIARELQEKSVAIAGADSWATDLEIRIYRSAENQNTAAEELWSWM..... 298
50 -17.200MJ10001K YP_001084108.1 402146 Purified-2009-11-14  ali follow..  12  53...RNTQGQITLGCLPSLGLSLIPKLTAKFLKKYPDVFVNIGTDHTQALEQKLLRREIDIAVTFQPHTQ---HGIIATPVLE---PLVYIDSQPISSNQ-DIHSIDENRWI-----QPYADSLMQVVKKYRTFNKSIVNVQTYYMASELVREGLGCSITDIYTAAHSLPNHMIHETKPSLS---TTIYILKNANVSTNKATEDFIELIKR.. 245
51 -17.200MI9946BL YP_560390.1 397949 Purified-2009-10-28  ali follow..  12  87...ATPQATIEFAVPHTLSLTYFPRWLQRIEAQMGPIHTRLRALNVHDAALSLVEGGCDLMMGYHHPSHPVPGRYDMLTLGNEPISPFSAPGRAGRPRTLPGSAEAPTPYLSYTPNAYLGRMTEVILAPERLYLDRLYETDMAEGLKAMALAGHGIAFLPHSAVEDAVADGKLIRLGTPEGQLTLTMEIRLYRDKLAAKSDDARQILVRQL. 305
52 -16.800MI9078AV EXIG_01APR05_CONTIG263_REVISED_GENE408 398412 Purified-2009-07-10  ali follow..  11  87...GAVYGTLRIAVASIMGQYWLPRVLKRFVERYPHVRVQLVTGWSSEMMRHMLEEHFHIGI-----RGNPDWKGVKERLFSDPLYLVDSELTSLEQLRKTERPFIQFK----SDSTYYQEILEWWQDRFSSPPARTLVVDQIETCKQMALHGIGFAILPESTIHEASEVMQIPLKTSSGKILKRDTWILSTESMLELKQVQAFWDIVKE.. 285
53 -16.500MJ9078CV NP_793452.1 403350 Purified-2009-09-04  ali follow..  11  86LHGTHLAGRITLGVPDEYAVHVIRDILPVFAAAWPNVVLELKTAPSFTLREQVLRGKLQAAVIAQPKGQLNAEA---QFLVSTKPVWVGPVNATLASTD-------PLPLAVHAAQCPYREAMMASLRHNGRKTRVVLESPSNQAIKACVEAGLAVSLIDRSGVTE-----AMQILNDLPEIAEHEIVFLRSPASQTDEAVSLLAQAMQK.. 280
54 -15.900MI9946BE NP_371500.1 398581 Crystal|NMR-2009-10-28  ali follow..  87...TMFQSKLNVVVSSYIATFIMPKFLKSFFNEHPFIDVSL-HVKNENIEKDINNHTYDIGI----RNQPKLREVHSEKVCEGKIVLIAPNKENN--HLLTEASLFEKYKIISDNHPEYWSSLKNNILNIYGKAQF-LSINDVHTSIKLIEMNQGISFLPIYITTDSDYNISV----INTKILQAPISFTYIYSKKESPEILVFIKSFKKY. 283
55 -15.300SP17929A ZP_02423721.1 411302 Purified-2010-11-20  ali follow..  13  36.DAEIAENCLYIALDNPMILDSLMPLFEKFSKANPNCQLHFLFGNTEDIYDKLNKNRIDFGF--------IENNASANDDTYRCLIISTKQNSIICEKACTIESLDPSVIQT------------AVIWKKASNNAFANSFSDFLFSNQAVINVEYV........................................................ 171
56 -14.900MI9078AL NP_102880.1 398316 Crystal|NMR-2009-11-01  ali follow..  10  93FIIPEIVGVVRLGSPDDYGERVLPHVLKRFAQSHPSIAVDVTIDQSSNLRRRMDDRALDITLLTNSYKTSALGA---EVLLTEPIVWAGAKGGCAHLRE-------PLPVSLWEEGCAWRAGALEALGREGRNYRVAYMSAHTAGQRAAIMADLAVAPLPRSFL-----GNDMVELCPKDGMPDITYNLAMVVAPDASAPVKAVADHIRA.. 288
57 -14.500MJ9078BU YP_094277.1 403128 Purified-2009-08-28  ali follow..  11  83FKAPELQGEIRFGLPEDFASIILSDVLVEFSRLHPRVLLNVECDLTLNLIERFNEGKFDLILIKTTQQQVGSES---IYVCTEPVEWIGKKELLPL-----LDKPGPIPLVLSPTPCVYRGNVIDTLDKNHIDWRLVYSSASYAGKMAAVRAGLGITAIQRSMIPNYLERLDYDFLP---ILNDVHVSLL--KKSGSNKAIESLEFFILQ.. 279
58 -14.500MJ9078BI YP_574429.1 402818 Purified-2009-11-03  ali follow..  14  82MGVDRQGELIRLGTSEEQASTYLPELLPRFAARFPEVRLEVSCSISGSLVHDFQEGLLDVAL-----VVRHGPTQTGRLLGREPMVWVVAEDRAIDDWE-------ILPLALNPEGCIFRAHAFAALGPTERRWDVRYSSRSPTGINLPVQAGLAATVKTPRSVRIVGEEEGL-------PLGHVEIEMHRTPGHSSDAFVAFCDELEHIVT 279
59 -12.000MJ9078BN YP_572248.1 402854 Purified-2009-09-24  ali follow..  12  88VSEQRLDGVVRLGIPD---VVYLPEALSEFEAQYPGVELQVDCGLSVDLVQSVRAGSLDLAI-----TTRQPKSPGGEVLCREPTVWAGAAGHDTRRTPLPLAVSKDGVCIF-------RERALAALDAMGIPWRIAYTSASLSGLTAAVRAGLAITVLTPSML-----GAGLRVIGSGEGLPELP--ALHRSPGRPNEATRQLALSLQT.. 282
60 -11.600MI9078BS ROSE_TM1040_30MAR04_CONTIG40_REVISED_GENE43 398523 Purified-2009-09-24  ali follow..  15  88...DEVSGELVVTSLSSMAPMLAPAL-AEFQQLHPDLVIRYLTGDR---LFRLEYGEAHVALRAGAAPEQ--PDNVVQPFVAQRLALYASREYVERHGMLKGQDDMVNHRFIASDNENTRAPFERWLRSTIPAENIVFRCSDAVAGHQAIRAGAGIGFVSLWEAA---SSPDLVMMMDPHDEWSGKIWLVTHVDLHRTNKVQSFVRFLKE.. 285
61 -11.300MJ9078AW YP_270096.1 402765 Purified-2009-10-17  ali follow..  11  92........LVRIGVTEALGNFFVSPNLLTLQQQHPSIDVHLLLFSR---YVKISRNEADIAIAVERPKST--CDYKLQLYVHQDYLDHNLKQYPQGITLDNLAEHKWVTYVDNLIFTDQLSYIKELDRYLSGELKANFSSTSIISQYFAIKSGLGIGILPCFLADQDKSLIKLHSQDITISR---SFWLVTHPESKRLSHVNTVWQYLKQ.. 292
62 -10.300MJ9078FB YP_001084968.1 402121 Purified-2009-09-11  ali follow..  15  26...IQPRGVVKVSVPVDIAQNLLPKILPAFLKKYPEIRLQLIVSNRR--VDVINEG-IDIALRVRSKLDD-DPSLVLRQFALIEQSLFASQAYLNEFGNIKSPDELS-DHRILSLSEEHLDQQFILHGPDNQLKKVTIMGTNIYMLAQLASQNCGIALLPDTAAEDFVKSGQLVQILPDWKAAHGIFHAVYPSRRGLLPAVRVFIDYLVE.. 231
63 -10.300MJ9078FI YP_001084383.1 402151 Purified-2009-08-28  ali follow..  12  31...INATGRLRMSVPVLFGQLFAAPLMVKFAQQHADLQLEIS---NDRNVDLIEEG-FDLCIRIGALPDT--TQLVAKPIGEHRMLLCASPDYLNKAGPVEHIEDLD-QHATIADPHFGQMQKWRLQKENDEPLFIKPKAKLLLNDLQAIKNAALIAWLPDWLIQNELQDGKLVQVLDAMSSTAFPIHLVWPTLPFMPLKTRLAIDYLAQ.. 235
64 -10.200MJ9812AY YP_001084450.1 402114 Purified-2009-09-21  ali follow..  13  62...DSLSGVLNIAVSPAFAEKWLLPRIDHFQKQYPDIDIRL---DINLKTVDFLEQKVDVGVRY----QGQWQGLEAVKLMDEEVYPVCSNEHSFLLTPNDLKNITLI-HDLSMEKHQQFPGWQSWLKSVGLNDINISRGMQIAVLQAAMEGHGVALARSVMVQKDIQTGRLIRLFPQINFSSPFSYYLVYRPQYANLPKLDWFFEEIHRI. 274
65 -9.780MJ9078DB YP_353024.1 403399 Purified-2009-09-04  ali follow..  14  86...AGLSGQIRIGAPDGCANYLLPQVLAQICTDNPGLEVQIVALPR---VFNLSKREADLAIGVSRPEA---GRLRVQKLADYRLHLAASAEYLSRHPPIRALEDLK-AHQLVGYIPDMIFDKELDYLTGLGSGSVPFASNSVSVQLNWLRAGAGVGIVHDFAMPSAPELVKILPEALSLSRSFW---LIRHQDDVRLERLNRFTDALVQ.. 282
66 -9.010MJ15773A SMIT_C_1_838 403736 Purified-2009-09-18  ali follow..  11  28.NPEEEKDEFSIASQHYD--FLPPTITAFSERYPDYKNFRIFESTTVQILDEVAQGHSEIGIIYLNNQNKKKLGLEIIELISFHTHIYLREGHPLAQKELVMEDLADLPTVRFTQEKDEY-YSENFVDTSASSQMFNVTTDAYATGSGFLDSDNGITVIR.................................................... 206

FFAS is supported by the NIH grant R01-GM087218-01
1 1 4 9 9 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.