current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}, from SCOP206

Results of FFAS03 search in JCSG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst GLSAAQRQVVASTWKDIAGADNGAGVGKECLSKFISAHPEMAAVFGFSGASDPGVAELGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGNKHIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYGDISGALISGLQSLast
1 -6.210FM12207A YP_001813159.1 377609 PDB-2008-01-22  ali follow..  157...........HHLARLSVLEKGAHPEVVVWEQARLDDPDVYKLYEQLLLSEETLEQRIHLALIGLEHLLQS-KVLSGGKYLFEVMRERDRPWTMHELMEERLTELKVDLGSLVDFFIRKGLIRISYQ................... 273
2 -5.990MA12129A NP_084280.2 399856 Purified-2009-03-14  ali follow..  11  76SGCGNLAEAVEGAVHIQECVPENLELKKKIFAQLDRIVDD--RVILSSSSSCLLPSKLFSGLAHVKQCIVAHPVNPPYYVPLVELVPHPETAPATMDRTYALMKKIGQSPVRVLKEIDGFVLNRLQYAVISEAWRLVEEEIVSPSD. 219
3 -5.720TM1023 TM1023 282890 Crystal|NMR-2008-06-24  ali follow..  18...........................................VFFFSSQPPDVSGRQSGNVYKFLKKVDNVLDWFPDKKPTGEDLVRKHFG---------LYFIMGILSFTFSYTPTLIAVLDEYNQSFRGRGASLYDVIVDM... 143
4 -5.580SP17028A ZP_02070525.1 409540 Selected-2009-11-12  ali follow..  12  320.LPKGYASFIEAMKQKHPDKR-GTGKVDFLYNEVWGDEAGFKDLHTIIKANDQYGNHALKTVFAAYMNYDKNTPGVLLTDAVIFALGGSHLELGDHMLCREYFPSTALQMNDVLKTAMIRYYD------FMTAYQNL.......... 471
5 -5.570RH20325B NP_952583.1 415453 Selected-2009-12-04  ali follow..  13  39..........................................EVFCRFGKAGGCGSAVMDGLTRMITRGLLSGMDPQVVVRDLAGISCHLGA-------ATCLDALAEAVALALDEGKGEDRCP....................... 113
6 -5.500SP13253C ZP_03459813.1 407428 Purified-2010-09-29  ali follow..  17  116..............................LKEGLEAVPGLTRMYATYYVNQGIVAQKAKKVDEAEGAFKQALAIQPDNVNALNSLGVLLYSQGAATLNTDAEKAKGKESKEYLEKLIPSPSKPAQKKMIDNANTMLNFI....... 232
7 -5.470SP17924A ZP_02423207.1 411295 Purified-2010-11-20  ali follow..  15  15...........................................................SSTVMSLMASASALTNSETVTNTTKIGTTSYTTKGTNDISTTRYSFV----LSTYVSSPSSATANEIHTHW-QVYDYWTGADIGTKQT 99
8 -5.440GE15693B YP_001297428.1 396856 Purified-2009-04-23  ali follow..  1.................................MEKIKSTIIAPYPLTEEQKAELTQWYMDLIEMMRH-IMEKGHLQINKNIITWLTDLHLQLLRSPKFPYYNSAYYKVLIVELRAKGADKEEPELETCFEALYGIL.......... 107
9 -5.440SP19120A NP_249151.1 413330 Selected-2009-11-12  ali follow..  44ATTPQTSGLLGALTGQLGVSQEQAQLAGNDYSQLVKTIPGLDKLAGNNLGGLGNVLGKSGGDSKGLGSLLGNADSMGDVNKAFGTLG----------MDSGMTEKFAQVLVDYFKQGANSELLGSLSNLWGVSKAGGSSLL...... 192
10 -5.440PG9814B NP_284435.1 372229 Purified-2006-12-13  ali follow..  10  6..THDVRRFFARVWQQRLNPLQLSALEQKA-LRIIEAHPEYHRYLERIEDHLPENGESNPFLHMSLHLSVQEIDQPHGIRAIHDTLCAKRGWLEAEHE-------MMEALAETLWTAQRYGTGLD-VNFYMTRLRKLIGL....... 142

FFAS is supported by the NIH grant R01-GM087218-01
1 1 9 0 5 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Slabinski L, Wooley J, Deacon AM, Lesley SA, Wilson IA, Godzik A. Genome pool strategy for structural coverage of protein families. Structure. 2008 Nov 12;16(11):1659-67.