current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d1b0ba_ a.1.1.2 (A:) Hemoglobin I {Clam (Lucina pectinata) [TaxId: 244486]}, from SCOP206

Results of FFAS03 search in JCSG0516
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst SLSAAQKDNVKSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGLFSGAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLAGFMKSYGGDEGAWTAVAGALMGMIRPDMLast
1 -8.700PG9814B NP_284435.1 372229 Purified-2006-12-13  ali follow..  11  6..THDVRRFFARVWQQRLNPLQLSALEKALRIIEAHPEYHRYLERIEDHLDTDWLPENGESNPFLHMSLHLSVQEQAGIDQPHGIRAIHDTLCAKRGWLEAEHEMMEALAETLWTAQRYGTGDVNFYMTRLRKLIGL..... 142
2 -8.540PE00071B YP_208077.1 368157 Crystal|NMR-2006-08-05  ali follow..  11  6..THDVRRFFARVWQQRLNPLQLGALEKALRIVEAHPEYHRYLERIEDHLDTDWLPENGESNPFLHMSLHLSVQEQAGIDQPHGIRAIHDTLCAKRGWPEAEHEMMEALAETLWTAQRYGTGDVNFYMTRLRKLIGL..... 142
3 -6.300PK9814B YP_413382.1 389379 Crystal|NMR-2008-06-26  ali follow..  6..RDQARQFFFETWRKYKQREMLSAMEMALEVILQHPEYHALLDDVEHHQDRDYPPEMGETNPFLHMGMHIAIKEQLSIDQPAGIRARFERLLKKTGNE---HAAMHQTMECLAEMIWQAQRDVMVYFECLDRQGI...... 142
4 -6.270RH20015A ZP_04008605.1 415217 Selected-2009-12-04  ali follow..  329......................................................................FYIQILKELNENEELIEDLLKLSGAHGLSEIPSSQVKVIINLCYQVIGKCIDLKEDWSKFYDQFNNDISTIL 410
5 -6.270PG9814A YP_557723.1 372221 Purified-2006-12-05  ali follow..  10  6..RDEVRLFFTDTWRKQRQGEILTPLEIAADWIVEHPEYHADLTDGEAAQAQDYSPERGQTNPFLHLSMHLAITEQLSIDQPPGIRAAHERLAARLGST---HEAQHAIMDCLGETIWEAQRDTDAYLQRIERRAT...... 142
6 -6.050PU9814B YP_545107.1 381752 Crystal|NMR-2009-02-20  ali follow..  12  8..RDQVRQFFFDAWAKFQQQQALTDLEIAVDIIQAHPEYHHVLEAPEQYLEQSYFPEMGETNPFLHMSLHLSVLEQVSIDQPPGIHAAYHALARKYGS---VIEAQHALMDCLAEAIWQAQRDAQAYAACIEAKAR...... 144
7 -5.950TB5252A 13815007 358088 Purified-2004-07-15  ali follow..  4LVLTLDHRRLEGLIDELLANPNLSLYGVIWKAYKNHIYWEELFKRVTDTSLLAIIRGLETEHGSMWILLKQTEELLRSNEIEGEKIREFMRVLLEHDGAE-EGSIYQFLESLSDEEQARLILEDIALAEP............ 136
8 -5.920SP19120A NP_249151.1 413330 Selected-2009-11-12  ali follow..  13  59QLGVSQEQAVGGTGALLGLAKNQLAGNDYSQLVKTIPGLDKLAGN----NALAGLGGLGNVLGKSGGDSKGLGSLLGNADSMGDVNKAFGTL-------GMDSGMTEKFAQVLVDYFGKQGANSNLWGVSKAGGSSLL.... 192
9 -5.870GS13275A NP_809257.1 384986 Selected-2007-09-11  ali follow..  12  207....................................................NLMKQEFPQRVSEFQLVESYINGLVNMDDKSTVRDYTKQVYAQIDASSLDVSA----VSRLKTMIAIAENSKFLWVE............. 279
10 -5.760PH10052D YP_678758.1 373334 Purified-2007-03-05  ali follow..  10  5TRERPKIDRIACPW-LILRFIDPEAEIIYVPTNQVLDQALEEYTHEGPFCTFDYILKKHLLTDEA---LHRLALIVRAADQASGLFAISAGLSYNIKDDHEMLRQGLIIYDALYSWCKYVSTETHGWEF............. 148

FFAS is supported by the NIH grant R01-GM087218-01
1 1 9 0 5 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Slabinski L, Wooley J, Deacon AM, Lesley SA, Wilson IA, Godzik A. Genome pool strategy for structural coverage of protein families. Structure. 2008 Nov 12;16(11):1659-67.