current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}, from SCOP206

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
1 -4.380HGC00672 gi|162843654|dbj|BABA01001055.1|4.0 TMP00845;  ali follow..  20  42...........ENRNFIETYTITLTKGFAGDSTSIFINDS 70
2 -2.140PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]  ali follow..  160.....GTNNAMVTVDPNFSGN---NLTMNGTLLPYSDSNV 191
3 -1.920HGC01213 gi|163579070|dbj|BABE01006032.1|2.0 TMP01709;  ali follow..  15  109..DCSASDVTLQLSAASQSVPVGGSLDFTSGNYLVDGSDS 153
4 -1.700HGC00106 gi|162841414|dbj|BABA01003295.1|1.0 TMP01000;  ali follow..  18  19..PIRNNKYMKSLRVYVSGNNLFCITGYSGLDPELDISNV 56
5 -1.610PB001030 Q6D4H5_ERWCT/1-146 PB001030; Pfam-B_1030;  ali follow..  39........QYNDLFSYAIKRLERCHFGEDKPACKH..... 65
6 -1.540PB010473 Q8A4J5_BACTN/121-234 PB010473; Pfam-B_10473;  ali follow..  14  59...CIPFGLLSGSLLVWLTFRLNARYGEHG.......... 85
7 -1.380PB028090 gi|167758043|ref|ZP_02430170.1| hypothetical protein CLOSCI_00381 [Clostridium scindens ATCC 35704]gi|167663940|gb|EDS08070.1| hypothetical protein CLOSCI_00381 [Clostridium scindens ATCC 35704]  ali follow..  20  158......GGWWNWVNGIAGILNILCMTGWWGIYSSKDKKDM 191
8 -1.290PB004718 Q5LIA4_BACFN/1-189 PB004718; Pfam-B_4718;  ali follow..  14  46..........VGYTNVFDTY--LSPQEYKGIEFRISRETM 73
9 -1.220PB018258 Q7MT99_PORGI/1-157 PB018258; Pfam-B_18258;  ali follow..  18  24RTDCPKREQCLRASAY........................ 39
10 -1.180HGC00711 gi|162743779|dbj|BAAZ01020484.1|1.0 TMP00907;  ali follow..  11  86GDPCEAASRVARA---NGAEVTTC--SVTGEDVVVEVSVE 120

FFAS is supported by the NIH grant R01-GM087218-01
1 0 7 2 9 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.