current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}, from SCOP206

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst NCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTLast
1 -18.400sp|P98164|LRP2_HUMAN(removed signalp:1-25) Low-density lipoprotein receptor-related protein 2 OS=Homo sapiens GN=LRP2 PE=1 SV=3 (Range: 4351-4630)  ali follow..  34  5PCRCMHGGNCYFD--ETDLPKCKCPSGYTGKYCEMAFSKG 42
2 -17.200sp|Q6EMK4|VASN_HUMAN(removed signalp:1-23) Vasorin OS=Homo sapiens GN=VASN PE=1 SV=1 (Range: 301-600)  ali follow..  36  88PSTCLNGGTCHLGTR--HHLACLCPEGFTGLYCESQMGQG 125
3 -16.100sp|Q9NR61|DLL4_HUMAN(removed signalp:1-26) Delta-like protein 4 OS=Homo sapiens GN=DLL4 PE=1 SV=1 (Range: 451-659)  ali follow..  31  10SSPCFNRATCYTDLS-TDTFVCNCPYGFVGSRCEFPVGL. 47
4 -15.900sp|O00468|AGRIN_HUMAN(removed signalp:1-29) Agrin OS=Homo sapiens GN=AGRN PE=1 SV=4 (Range: 1651-1950)  ali follow..  37  144GHPCLNGASCVPR---EAAYVCLCPGGFSGPHCEKGLVEK 180
5 -15.900sp|Q8TER0|SNED1_HUMAN(removed signalp:1-24) Sushi, nidogen and EGF-like domain-containing protein 1 OS=Homo sapiens GN=SNED1 PE=1 SV=2 (Range: 1051-1350)  ali follow..  40  239ENPCQNGGTCVPGA---DAHSCDCGPGFKGRRCELACIKV 275
6 -15.800sp|Q8N2E2|VWDE_HUMAN(removed signalp:1-20) von Willebrand factor D and EGF domain-containing protein OS=Homo sapiens GN=VWDE PE=2 SV=3 (Range: 901-1200)  ali follow..  52  260SCDCLNGGSCVSDRNFSGVYLCVCLPGFHGSLCEVDIS.. 300
7 -15.700sp|Q63HQ2|EGFLA_HUMAN(removed signalp:1-24) Pikachurin OS=Homo sapiens GN=EGFLAM PE=1 SV=2 (Range: 601-900)  ali follow..  29  166RAPCAHGGSCRPR---KEGYDCDCPLGFEGLHCQKECGNY 202
8 -15.600sp|Q07954|LRP1_HUMAN(removed signalp:1-20) Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens GN=LRP1 PE=1 SV=2 (Range: 4351-4524)  ali follow..  28  8VGHCSNGGSCT--MNSKMMPECQCPPHMTGPRCEEHVFSQ 45
9 -15.400sp|Q8TER0|SNED1_HUMAN(removed signalp:1-24) Sushi, nidogen and EGF-like domain-containing protein 1 OS=Homo sapiens GN=SNED1 PE=1 SV=2 (Range: 1201-1389)  ali follow..  40  89ENPCQNGGTCVPG---ADAHSCDCGPGFKGRRCELACIKV 125
10 -15.100sp|Q9NYQ7|CELR3_HUMAN(removed signalp:1-31) Cadherin EGF LAG seven-pass G-type receptor 3 OS=Homo sapiens GN=CELSR3 PE=1 SV=2 (Range: 1501-1800)  ali follow..  29  197SGPCKNSGFCSER---WGSFSCDCPVGFGGKDCQLTMAHP 233
11 -14.900sp|Q8TDW7|FAT3_HUMAN(removed signalp:1-32) Protocadherin Fat 3 OS=Homo sapiens GN=FAT3 PE=2 SV=2 (Range: 3601-3900)  ali follow..  21  169EKPCPGDMQCVSYEASRRPFLCQCPPGKLGECSGHTS... 205
12 -14.800sp|Q13201|MMRN1_HUMAN(removed signalp:1-19) Multimerin-1 OS=Homo sapiens GN=MMRN1 PE=1 SV=3 (Range: 901-1200)  ali follow..  32  128RHPCQNGGTCING---RTSFTCACRHPFTGDNCTIKLVEE 164
13 -14.700sp|Q04721|NOTC2_HUMAN(removed signalp:1-25) Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 (Range: 1351-1650)  ali follow..  26  5SSPCQHGGSCHPQRQ-PPYYSCQCAPPFSGSRCELYTAP. 42
14 -14.700sp|Q99102|MUC4_HUMAN(removed signalp:1-28) Mucin-4 OS=Homo sapiens GN=MUC4 PE=1 SV=3 (Range: 1651-1950)  ali follow..  23  203VNYCYNQGHCYISQTLGCQPMCTCPPAFTDSRCFLAGNN. 241
15 -14.700sp|O00468|AGRIN_HUMAN(removed signalp:1-29) Agrin OS=Homo sapiens GN=AGRN PE=1 SV=4 (Range: 1051-1350)  ali follow..  31  256SQPCFHGGTCQDWAL-GGGFTCSCPAGRGGAVCEKVLGA. 293
16 -14.600sp|P82279|CRUM1_HUMAN(removed signalp:1-25) Crumbs homolog 1 OS=Homo sapiens GN=CRB1 PE=1 SV=2 (Range: 451-750)  ali follow..  18  203SQPCQSRGRCINL---WLSYQCDCHRPYEGPNCLREYVAG 239
17 -14.500sp|P0CG36|CFC1B_HUMAN(removed signalp:1-25) Cryptic family protein 1B OS=Homo sapiens GN=CFC1B PE=4 SV=1  ali follow..  44  63PRCCRNGGTCVL------GSFCVCPAHFTGRYCEHDQRRS 96
18 -14.500sp|P56975|NRG3_HUMAN Pro-neuregulin-3, membrane-bound isoform OS=Homo sapiens GN=NRG3 PE=1 SV=1 (Range: 151-450)  ali follow..  27  145LAYCLNDGECF-ETLTGSHKHCRCKEGYQGVRCDQFLPKT 185
19 -14.400sp|P0CG37|CFC1_HUMAN(removed signalp:1-25) Cryptic protein OS=Homo sapiens GN=CFC1 PE=1 SV=1  ali follow..  44  63PRCCRNGGTCVL------GSFCVCPAHFTGRYCEHDQRRS 96
20 -14.400sp|Q8TDW7|FAT3_HUMAN(removed signalp:1-32) Protocadherin Fat 3 OS=Homo sapiens GN=FAT3 PE=2 SV=2 (Range: 4051-4350)  ali follow..  32  22REECENGGSCVNV---FGSFLCNCTPGYVGQYCGLRPVVV 58
21 -14.300sp|Q63HQ2|EGFLA_HUMAN(removed signalp:1-24) Pikachurin OS=Homo sapiens GN=EGFLAM PE=1 SV=2 (Range: 451-750)  ali follow..  36  97EASCIHGGTCTA--IKADSYICLCPLGFKGRHCEDAFTLT 134
22 -14.200sp|Q9NYQ6|CELR1_HUMAN(removed signalp:1-20) Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens GN=CELSR1 PE=1 SV=1 (Range: 1651-1950)  ali follow..  25  243LNPCENMGACVRSPGSPQGYVCECGPSHYGPYCENKLDL. 281
23 -14.000sp|Q9HCU4|CELR2_HUMAN(removed signalp:1-31) Cadherin EGF LAG seven-pass G-type receptor 2 OS=Homo sapiens GN=CELSR2 PE=1 SV=1 (Range: 1351-1650)  ali follow..  37  199SNTCHNGGTCVNQ---WDAFSCECPLGFGGKSCAQEMANP 235
24 -13.900sp|Q16819|MEP1A_HUMAN(removed signalp:1-21) Meprin A subunit alpha OS=Homo sapiens GN=MEP1A PE=1 SV=2 (Range: 451-725)  ali follow..  23  205PNPCQNDGICVN---VKGMASCRCISGYTGERCQAVQVH. 244
25 -13.700sp|Q9HCU4|CELR2_HUMAN(removed signalp:1-31) Cadherin EGF LAG seven-pass G-type receptor 2 OS=Homo sapiens GN=CELSR2 PE=1 SV=1 (Range: 1501-1800)  ali follow..  37  49SNTCHNGGTCVNQ---WDAFSCECPLGFGGKSCAQEMANP 85
26 -13.700sp|P78357|CNTP1_HUMAN(removed signalp:1-19) Contactin-associated protein 1 OS=Homo sapiens GN=CNTNAP1 PE=1 SV=1 (Range: 751-1050)  ali follow..  28  196RLPCFHGGRCVER---YSYYTCDCDTAFDGPYCNHDIGGF 233
27 -13.600sp|O75094|SLIT3_HUMAN(removed signalp:1-33) Slit homolog 3 protein OS=Homo sapiens GN=SLIT3 PE=2 SV=3 (Range: 901-1200)  ali follow..  35  28QNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDD. 66
28 -13.400sp|Q02297|NRG1_HUMAN Pro-neuregulin-1, membrane-bound isoform OS=Homo sapiens GN=NRG1 PE=1 SV=3 (Range: 151-450)  ali follow..  27  37KTFCVNGGECVKDLSNPSRYLCKCQPGFTGARCTENVPMK 78
29 -13.400sp|Q99944|EGFL8_HUMAN(removed signalp:1-25) Epidermal growth factor-like protein 8 OS=Homo sapiens GN=EGFL8 PE=1 SV=1  ali follow..  42  90AKPCLNGGVCV------RPDQCECAPGWGGKHCHVDVDE. 122
30 -13.400sp|P82279|CRUM1_HUMAN(removed signalp:1-25) Crumbs homolog 1 OS=Homo sapiens GN=CRB1 PE=1 SV=2 (Range: 601-900)  ali follow..  37  268SNPCHNGGVCHSR---WDDFSCSCPALTSGKACEE..... 299
31 -13.400sp|Q5IJ48|CRUM2_HUMAN(removed signalp:1-28) Crumbs homolog 2 OS=Homo sapiens GN=CRB2 PE=1 SV=2 (Range: 451-750)  ali follow..  24  133PLPCVHGGSCVDL---WTHFRCDCARPHRGPTCADEIPAA 169
32 -13.400sp|P13385|TDGF1_HUMAN(removed signalp:1-30) Teratocarcinoma-derived growth factor 1 OS=Homo sapiens GN=TDGF1 PE=1 SV=1  ali follow..  48  50RTCCLNGGTCML------GSFCACPPSFYGRNCEHDVRK. 82
33 -13.300sp|Q99466|NOTC4_HUMAN(removed signalp:1-23) Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 (Range: 1051-1350)  ali follow..  22  20FHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPK 59
34 -13.200sp|Q9NYQ6|CELR1_HUMAN(removed signalp:1-20) Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens GN=CELSR1 PE=1 SV=1 (Range: 1501-1800)  ali follow..  43  135GRRCQNGGTCVNR---WNMYLCECPLRFGGKNCEQAMPHP 171
35 -13.200sp|Q14517|FAT1_HUMAN(removed signalp:1-21) Protocadherin Fat 1 OS=Homo sapiens GN=FAT1 PE=1 SV=1 (Range: 3601-3900)  ali follow..  30  177DDPCPEGSECVSD-PWEEKHTCVCPSGRFGQCPGSSS... 212
36 -13.200sp|Q8WWG1|NRG4_HUMAN Pro-neuregulin-4, membrane-bound isoform OS=Homo sapiens GN=NRG4 PE=2 SV=1  ali follow..  33  14KSFCLNGGLCY-VIPTIPSPFCRCVENYTGARCE...... 46
37 -13.100sp|O94813|SLIT2_HUMAN(removed signalp:1-18) Slit homolog 2 protein OS=Homo sapiens GN=SLIT2 PE=1 SV=1 (Range: 751-1050)  ali follow..  30  195SNPCKHGGTCHLKEGEEDGFWCICADGFEGENCEVNVDD. 233
38 -13.100sp|P82279|CRUM1_HUMAN(removed signalp:1-25) Crumbs homolog 1 OS=Homo sapiens GN=CRB1 PE=1 SV=2 (Range: 751-1050)  ali follow..  37  118SNPCHNGGVCHSR---WDDFSCSCPALTSGKACEE..... 149
39 -13.100sp|Q8N2E2|VWDE_HUMAN(removed signalp:1-20) von Willebrand factor D and EGF domain-containing protein OS=Homo sapiens GN=VWDE PE=2 SV=3 (Range: 1051-1350)  ali follow..  48  110SCDCLNGGSCVSDSPGSGVYLCVCLPGFHGSLCEVDISG. 151
40 -13.100sp|Q9NYQ7|CELR3_HUMAN(removed signalp:1-31) Cadherin EGF LAG seven-pass G-type receptor 3 OS=Homo sapiens GN=CELSR3 PE=1 SV=2 (Range: 1651-1950)  ali follow..  29  47SGPCKNSGFCSER---WGSFSCDCPVGFGGKDCQLTMAHP 83
41 -13.100sp|Q9Y4C0|NRX3A_HUMAN(removed signalp:1-27) Neurexin-3-alpha OS=Homo sapiens GN=NRXN3 PE=2 SV=4 (Range: 1-300)  ali follow..  31  177ERPCENGGICFLL---DGHPTCDCSTGYGGKLCSEDVSQD 214
42 -13.100sp|P51864|TDGF2_HUMAN(removed signalp:1-22) Putative teratocarcinoma-derived growth factor 2 OS=Homo sapiens GN=TDGF3 PE=5 SV=1  ali follow..  47  58RTCCLNGGTCML------ESFCACPPSFYGRNCEHDVRKE 91
43 -13.000sp|Q9NZR2|LRP1B_HUMAN(removed signalp:1-20) Low-density lipoprotein receptor-related protein 1B OS=Homo sapiens GN=LRP1B PE=1 SV=2 (Range: 4351-4579)  ali follow..  33  25DGYCYNGGTCQLD-PETNVPVCLCSTNWSGTQCERPAPKS 63
44 -13.000sp|P46531|NOTC1_HUMAN(removed signalp:1-18) Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4 (Range: 1051-1350)  ali follow..  35  245GKPCKNGGTCAVASNTARGFICKCPAGFEGATCENDART. 283
45 -13.000sp|Q63HQ2|EGFLA_HUMAN(removed signalp:1-24) Pikachurin OS=Homo sapiens GN=EGFLAM PE=1 SV=2 (Range: 751-993)  ali follow..  29  16RAPCAHGGSCRPR---KEGYDCDCPLGFEGLHCQKECGNY 52
46 -12.900sp|O14594|NCAN_HUMAN(removed signalp:1-22) Neurocan core protein OS=Homo sapiens GN=NCAN PE=2 SV=3 (Range: 901-1200)  ali follow..  38  130CSPCENGGTCIDEV---NGFVCLCLPSYGGSFCEKDTEG. 165
47 -12.900sp|Q5T1H1|EYS_HUMAN(removed signalp:1-21) Protein eyes shut homolog OS=Homo sapiens GN=EYS PE=1 SV=4 (Range: 1951-2250)  ali follow..  37  134QDVCHNGGTCHAIFLSSVSFQCDCPLHFTGRFCEKDAGLF 175
48 -12.900sp|Q6V0I7|FAT4_HUMAN(removed signalp:1-38) Protocadherin Fat 4 OS=Homo sapiens GN=FAT4 PE=2 SV=2 (Range: 3901-4200)  ali follow..  27  230RSPCQHGGTCMD---YWSWQQCHCKEGLTGKYCEKSVTPD 266
49 -12.900sp|Q96NU0|CNT3B_HUMAN(removed signalp:1-25) Contactin-associated protein-like 3B OS=Homo sapiens GN=CNTNAP3B PE=2 SV=2 (Range: 751-1050)  ali follow..  26  191GHLCRNGGRCREK---RRGVTCDCASAYDGPFCSNEISAY 228
50 -12.800sp|P35354|PGH2_HUMAN(removed signalp:1-23) Prostaglandin G/H synthase 2 OS=Homo sapiens GN=PTGS2 PE=1 SV=2  ali follow..  31  2..PCQNRGVCMS--VGFDQYKCDCTTGFYGENCST..... 33
51 -12.800sp|Q02505|MUC3A_HUMAN Mucin-3A OS=Homo sapiens GN=MUC3A PE=2 SV=2 (Range: 2101-2400)  ali follow..  33  101QTRCQNGGQW-------DGLKCQCPSTFYGSSCEFAVEQV 133
52 -12.700sp|Q9C0A0|CNTP4_HUMAN(removed signalp:1-25) Contactin-associated protein-like 4 OS=Homo sapiens GN=CNTNAP4 PE=1 SV=3 (Range: 751-1050)  ali follow..  26  191GKLCRNGGKCRER---PIGFFCDCTSAYTGPFCSNEISAY 228
53 -12.700sp|Q14766|LTBP1_HUMAN(removed signalp:1-23) Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens GN=LTBP1 PE=1 SV=4 (Range: 1-300)  ali follow..  29  169VPPCQNGGMCL------RPQLCVCKPGTKGKACETIAAQD 202
54 -12.700sp|Q63HQ2|EGFLA_HUMAN(removed signalp:1-24) Pikachurin OS=Homo sapiens GN=EGFLAM PE=1 SV=2 (Range: 151-450)  ali follow..  23  175ETLCSADSFCVNDYT-WGGSRCQCTLGKGGESCSEDIVIQ 213
55 -12.700sp|Q99466|NOTC4_HUMAN(removed signalp:1-23) Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 (Range: 901-1200)  ali follow..  30  129SQPCFHGGTCEATAGSPLGFICHCPKGFEGPTCSHRAPS. 167
56 -12.700sp|O14511|NRG2_HUMAN Pro-neuregulin-2, membrane-bound isoform OS=Homo sapiens GN=NRG2 PE=2 SV=1 (Range: 301-600)  ali follow..  33  50KSYCVNGGVCY-YIEGINQLSCKCPNGFFGQRCLEKLPLR 88
57 -12.600sp|Q9H195|MUC3B_HUMAN Mucin-3B (Fragment) OS=Homo sapiens GN=MUC3B PE=2 SV=1 (Range: 301-600)  ali follow..  34  261QTRCQNGGQW-------DGLKCQCPSTFYGSSCEFAVEQ. 292
58 -12.600sp|Q6V0I7|FAT4_HUMAN(removed signalp:1-38) Protocadherin Fat 4 OS=Homo sapiens GN=FAT4 PE=2 SV=2 (Range: 4051-4350)  ali follow..  28  80RSPCQHGGTCMDY---WSWQQCHCKEGLTGKYCEKSVT.. 114
59 -12.600sp|O75093|SLIT1_HUMAN(removed signalp:1-32) Slit homolog 1 protein OS=Homo sapiens GN=SLIT1 PE=2 SV=4 (Range: 751-1050)  ali follow..  30  188SGPCENGGTCHAQEGEDAPFTCSCPTGFEGPTCGVNTDD. 226
60 -12.500sp|Q5T1H1|EYS_HUMAN(removed signalp:1-21) Protein eyes shut homolog OS=Homo sapiens GN=EYS PE=1 SV=4 (Range: 2101-2400)  ali follow..  34  256NNPCGNGATCVP--KSGTDIVCLCPYGRSGPLCTDAINIT 293
61 -12.500sp|Q9BZ76|CNTP3_HUMAN(removed signalp:1-25) Contactin-associated protein-like 3 OS=Homo sapiens GN=CNTNAP3 PE=2 SV=3 (Range: 751-1050)  ali follow..  26  191GHLCRNGGRCREK---RRGVTCDCASAYDGPFCSNEISAY 228
62 -12.500sp|Q9NYQ6|CELR1_HUMAN(removed signalp:1-20) Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens GN=CELSR1 PE=1 SV=1 (Range: 1201-1500)  ali follow..  32  149SDPCGANGRCRSR---EGGYTCECFEDFTGEHCEVDARSG 185
63 -12.500sp|Q9NYQ7|CELR3_HUMAN(removed signalp:1-31) Cadherin EGF LAG seven-pass G-type receptor 3 OS=Homo sapiens GN=CELSR3 PE=1 SV=2 (Range: 1201-1500)  ali follow..  32  210SNPCRNGGACARR---EGGYTCVCRPRFTGEDCELDTEAG 246
64 -12.400sp|Q8WYK1|CNTP5_HUMAN(removed signalp:1-24) Contactin-associated protein-like 5 OS=Homo sapiens GN=CNTNAP5 PE=2 SV=1 (Range: 751-1050)  ali follow..  31  190GSICHNGGKCVEK---HNGYLCDCTSPYEGPFCKKEVSAV 227
65 -12.400sp|P13611|CSPG2_HUMAN(removed signalp:1-20) Versican core protein OS=Homo sapiens GN=VCAN PE=1 SV=3 (Range: 3001-3300)  ali follow..  36  113SNPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDTET. 148
66 -12.400sp|Q5IJ48|CRUM2_HUMAN(removed signalp:1-28) Crumbs homolog 2 OS=Homo sapiens GN=CRB2 PE=1 SV=2 (Range: 751-1050)  ali follow..  37  35PDPCFNGGTCLVT---WNDFHCTCPANFTGPTCAQQLW.. 69
67 -12.400sp|Q9UHC6|CNTP2_HUMAN(removed signalp:1-27) Contactin-associated protein-like 2 OS=Homo sapiens GN=CNTNAP2 PE=1 SV=1 (Range: 751-1050)  ali follow..  26  194GTNCENGGKCLER---YHGYSCDCSTAYDGTFCNKDVGAF 231
68 -12.300sp|O00548|DLL1_HUMAN(removed signalp:1-21) Delta-like protein 1 OS=Homo sapiens GN=DLL1 PE=2 SV=2 (Range: 451-702)  ali follow..  27  16HAPCHNGATCHERG---HRYVCECARGYGGPNCQFLLPE. 51
69 -12.300sp|P13611|CSPG2_HUMAN(removed signalp:1-20) Versican core protein OS=Homo sapiens GN=VCAN PE=1 SV=3 (Range: 2851-3150)  ali follow..  36  263SNPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDTET. 298
70 -12.300sp|Q5IJ48|CRUM2_HUMAN(removed signalp:1-28) Crumbs homolog 2 OS=Homo sapiens GN=CRB2 PE=1 SV=2 (Range: 1-300)  ali follow..  28  45TQPCHHGALCVPQGPDPTGFRCYCVPGFQGPRCELDIDE. 83
71 -12.300sp|Q9P2S2|NRX2A_HUMAN(removed signalp:1-28) Neurexin-2-alpha OS=Homo sapiens GN=NRXN2 PE=2 SV=1 (Range: 451-750)  ali follow..  31  218SAPCRNGGVCREG---WNRFICDCIGGFLGRVCEREATVL 255
72 -12.200sp|Q6V0I7|FAT4_HUMAN(removed signalp:1-38) Protocadherin Fat 4 OS=Homo sapiens GN=FAT4 PE=2 SV=2 (Range: 4351-4650)  ali follow..  33  44SHPCQNGGSCEPGL--HSGFTCSCPDSHTGRTCEM..... 76
73 -12.200sp|Q04756|HGFA_HUMAN(removed signalp:1-35) Hepatocyte growth factor activator OS=Homo sapiens GN=HGFAC PE=1 SV=1 (Range: 1-300)  ali follow..  35  212SSPCLNGGTCHL-IVATGTTVCACPPGFAGRLCNIEPDER 250
74 -12.200sp|Q9ULB1|NRX1A_HUMAN(removed signalp:1-30) Neurexin-1-alpha OS=Homo sapiens GN=NRXN1 PE=1 SV=1 (Range: 451-750)  ali follow..  26  202SNPCKNNGMCRDG---WNRYVCDCSTGYLGRSCEREATVL 239
75 -12.200sp|Q9HCU4|CELR2_HUMAN(removed signalp:1-31) Cadherin EGF LAG seven-pass G-type receptor 2 OS=Homo sapiens GN=CELSR2 PE=1 SV=1 (Range: 1051-1350)  ali follow..  27  213SRPCGPHGRCRSR---EGGYTCLCRDGYTGEHCEVSARS. 248

FFAS is supported by the NIH grant R01-GM087218-01
9 9 7 8 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ye Y, Godzik A. FATCAT: a web server for flexible structure comparison and structure similarity searching. Nucleic Acids Res. 2004 Jul 1;32(Web Server issue):W582-5.