current user: public




Query: d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}, from SCOP206

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# E-value Template Links and tools%idFirst NCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTLast
1 2.000e-13gi|694846944|ref|XP_009464527.1| PREDICTED: neurocan core protein [Nipponia nippon]  clstr ali  45  919NNPCLHGGTCHANGTVCG---CSCAPGFTGENCEIDID.. 953
2 6.000e-13gi|762141456|ref|XP_011453914.1| PREDICTED: von Willebrand factor A domain-containing protein 2-like [Crassostrea gigas]  clstr ali  40  114.NSCQNGGTCHNG---NNQYTCSCLPGWTGTNCEIDIDE. 148
3 7.000e-13gi|511899771|ref|XP_004769430.1| PREDICTED: urokinase-type plasminogen activator [Mustela putorius furo]  clstr ali  80  32NCHCLNGGTCVSYKYFSNIHRCNCPKKFQGEHCEIDTTET 71
4 8.000e-13gi|405973659|gb|EKC38360.1| Cartilage matrix protein, partial [Crassostrea gigas]  clstr ali  40  143.NPCQNGGTCSNG---NNQYTCTCLPGWTGSNCEIDIDE. 177
5 9.000e-13gi|686603500|ref|XP_009278125.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Aptenodytes forsteri]  clstr ali  45  928NNPCLHGGTCRANGTVCG---CSCAPGFTGENCEIDID.. 962
6 2.000e-12gi|731467950|ref|XP_010587642.1| PREDICTED: urokinase-type plasminogen activator [Loxodonta africana]  clstr ali  82  145NCSCLNGGTCVSYKYFSNIQRCNCPKKFQGEHCEIDTSKT 184
7 2.000e-12gi|992179461|ref|XP_007234607.2| PREDICTED: serine-rich adhesin for platelets-like [Astyanax mexicanus]  clstr ali  44 4859DNPCLNGGTCVDGV---NSFSCVCLPSYTGALCEQDT-ET 4894
8 4.000e-12gi|961725784|ref|XP_014923206.1| PREDICTED: LOW QUALITY PROTEIN: urokinase-type plasminogen activator [Acinonyx jubatus]  clstr ali  80  32NCGCLNGGTCVSYKYFSNIQRCSCPKKFQGEHCEIDTSKT 71
9 5.000e-12gi|641709029|ref|XP_008143586.1| PREDICTED: urokinase-type plasminogen activator [Eptesicus fuscus]  clstr ali  82  32NCGCLNGGTCVSYKYFSNIHRCNCPKKFQGEHCEIDTSAT 71
10 9.000e-12gi|675418418|ref|XP_008922575.1| PREDICTED: urokinase-type plasminogen activator [Manacus vitellinus]  clstr ali  50  36ECSCLNGGTCITYYLFSGISRCICPEGYTGIHCELDTDST 75
11 1.000e-11gi|585665263|ref|XP_006887626.1| PREDICTED: urokinase-type plasminogen activator [Elephantulus edwardii]  clstr ali  72  44DCGCLNGGTCVSYKYFSGIQRCHCPTKFQGEHCEIDTSKT 83
12 1.000e-11gi|634847512|ref|XP_007938789.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Orycteropus afer afer]  clstr ali  80  32NCGCLNGGTCVSYKYFSNIQRCKCPKKFQGEHCEIDTSKT 71
13 1.000e-11gi|759105975|ref|XP_011353584.1| PREDICTED: urokinase-type plasminogen activator [Pteropus vampyrus]  clstr ali  82  32NCGCLNGGTCVSYKYFSNIQRCNCPKKFQGEHCEIDTSKT 71
14 1.000e-11gi|507617972|ref|XP_004624442.1| PREDICTED: urokinase-type plasminogen activator [Octodon degus]  clstr ali  80  31NCGCLNGGTCVSYKYFSNMQRCNCPKKFQGEHCEIDTSKT 70
15 1.000e-11gi|667288023|ref|XP_008576689.1| PREDICTED: urokinase-type plasminogen activator [Galeopterus variegatus]  clstr ali  80  32NCGCLNGGTCVSYKYFSNIRRCNCPRKFQGEHCEIDTSKT 71
16 1.000e-11gi|1016719145|ref|XP_016079485.1| PREDICTED: urokinase-type plasminogen activator, partial [Miniopterus natalensis]  clstr ali  80  25NCVCLNGGTCVSYKYFSHIQRCNCPKKFSGEHCEIDKSAT 64
17 2.000e-11gi|529419880|ref|XP_005229802.1| PREDICTED: urokinase-type plasminogen activator [Falco peregrinus]  clstr ali  47  39ECHCLNGGTCITYYLFRGIIRCICPEGYTGTHCELDVD.. 76
18 2.000e-11gi|562885273|ref|XP_006170097.1| PREDICTED: urokinase-type plasminogen activator [Tupaia chinensis]  clstr ali  80  36NCGCLNGGTCVSYKFFSNIRRCNCPKKFQGEHCEIDTSKT 75
19 2.000e-11gi|914908553|ref|XP_013214312.1| PREDICTED: urokinase-type plasminogen activator [Ictidomys tridecemlineatus]  clstr ali  80  31NCGCLNGGTCVSYKYFSNIRRCICPKKFQGEHCEIDTSKT 70
20 2.000e-11gi|594057035|ref|XP_006052703.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Bubalus bubalis]  clstr ali  75  78NCGCLNGGKCVTYKYFSNIQRCSCPKKFQGEHCEIDTSKT 117
21 2.000e-11gi|642924126|ref|XP_008194016.1| PREDICTED: neural-cadherin isoform X3 [Tribolium castaneum]  clstr ali  44 2796DLPCLNGGTCVNLEPRFR-YRCHCPDGFWGENCEL..... 2829
22 3.000e-11gi|999983662|gb|KXJ22803.1| Protocadherin gamma-A4 [Exaiptasia pallida]  clstr ali  42 1371NCPCSNGGTCQDDI---GSYSCACPAGYTGEHCEVDIN.. 1412
23 3.000e-11gi|507942138|ref|XP_004681118.1| PREDICTED: urokinase-type plasminogen activator [Condylura cristata]  clstr ali  77  32NCGCQNGGTCVHYKYFSNIHRCNCPKRFEGEHCEIDRSKT 71
24 3.000e-11gi|637319501|ref|XP_008112480.1| PREDICTED: urokinase-type plasminogen activator [Anolis carolinensis]  clstr ali  54  41.CNCLNGGTCITYHLFSRMKRCVCPEGYSGDHCEID.... 75
25 3.000e-11gi|704293650|ref|XP_010160573.1| PREDICTED: urokinase-type plasminogen activator-like [Caprimulgus carolinensis]  clstr ali  43  39ECHCLNGGICIAYYLFSRVSRCVCPEGYTGIHCELDTDS. 77
26 3.000e-11gi|795191204|ref|XP_011846550.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Mandrillus leucophaeus]  clstr ali  90  29DCGCLNGGTCMSNKYFSSIHWCNCPKKFGGQHCEIDKSKT 68
27 3.000e-11gi|968116148|ref|XP_002047200.2| uncharacterized protein Dvir_GJ13308 [Drosophila virilis]  clstr ali  54  581NNHCFHGGTCML-LPFLNIYYCNCPEGFTGQRCE...... 613
28 4.000e-11gi|395820478|ref|XP_003783592.1| PREDICTED: urokinase-type plasminogen activator isoform X3 [Otolemur garnettii]  clstr ali  72  30NCGCLNGGTCVTYKHFSNIRRCICPKKFQGEHCEIDTAKT 69
29 4.000e-11gi|852776518|ref|XP_012881141.1| PREDICTED: urokinase-type plasminogen activator [Dipodomys ordii]  clstr ali  82  31NCGCLNGGTCVSYKYFSNIRRCSCPKKFQGKHCEIDKSKT 70
30 4.000e-11gi|432106779|gb|ELK32431.1| Urokinase-type plasminogen activator [Myotis davidii]  clstr ali  82  30.CGCLNGGTCVSYKYFSNIHRCNCPKKFQGEHCEIDTSAT 68
31 4.000e-11gi|677833527|ref|XP_009067782.1| PREDICTED: urokinase-type plasminogen activator-like [Acanthisitta chloris]  clstr ali  50  39DCHCLNGGTCITYYLFSGISRCVCPEGYTGIHCELDSD.. 76
32 5.000e-11gi|674056554|ref|XP_008834769.1| PREDICTED: urokinase-type plasminogen activator [Nannospalax galili]  clstr ali  72  31NCGCQNGGICVSYKYFSNIRRCSCPKRFQGEHCEIDTSKT 70
33 5.000e-11gi|351714573|gb|EHB17492.1| Urokinase-type plasminogen activator [Heterocephalus glaber]  clstr ali  69  32.CGCLNGGSCVTYKYFSGIRRCNCPKRFQGEHCEIDAWKT 70
34 5.000e-11gi|530564439|ref|XP_005278798.1| PREDICTED: urokinase-type plasminogen activator [Chrysemys picta bellii]  clstr ali  59  40DCNCVNGGTCISYQLFSRINRCLCPKGYSGQHCEIDT... 76
35 5.000e-11gi|960992357|ref|XP_014811644.1| PREDICTED: urokinase-type plasminogen activator [Calidris pugnax]  clstr ali  52  67DCRCLNGGTCITYYFTSGINRCVCPKGYFGIHCEIDTAST 106
36 5.000e-11gi|768188566|gb|KJH45106.1| cadherin domain protein [Dictyocaulus viviparus]  clstr ali  40 2267EAPCENGGTC---YVVDRTYQCSCPARYSGKNCEIDTD.. 2301
37 6.000e-11gi|731198046|ref|XP_010605510.1| PREDICTED: urokinase-type plasminogen activator [Fukomys damarensis]  clstr ali  72  31NCGCLNGGRCVTYKYFSKMLRCNCPKKFQGEHCEIDASKT 70
38 6.000e-11gi|852784379|ref|XP_012883765.1| PREDICTED: neurocan core protein [Dipodomys ordii]  clstr ali  47  442NNPCLHGGSCSAN---SSTYGCSCAQGFAGENCEIDT... 475
39 7.000e-11gi|514728917|ref|XP_005015757.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Anas platyrhynchos]  clstr ali  57  35DCHCLNGGTCVTYYLFSRINRCLCPEGYGGLHCEIDDDST 74
40 7.000e-11gi|504142458|ref|XP_004583665.1| PREDICTED: urokinase-type plasminogen activator [Ochotona princeps]  clstr ali  72  32HCSCLNGGKCVSYKYFSNIWRCDCPKNFQGEHCEIDKSTT 71
41 7.000e-11gi|694653623|ref|XP_009483133.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Pelecanus crispus]  clstr ali  48 1097.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 1136
42 8.000e-11gi|719762238|ref|XP_010216521.1| PREDICTED: urokinase-type plasminogen activator [Tinamus guttatus]  clstr ali  50  39DCNCLNGGTCITYHLFHRISRCLCPDGYTGIHCEIDTDNT 78
43 8.000e-11gi|884926967|ref|XP_013012439.1| PREDICTED: urokinase-type plasminogen activator [Cavia porcellus]  clstr ali  75  31NCGCLNGGTCVSYKYFSSMQRCSCPKKFQGEHCEIDASKT 70
44 9.000e-11gi|723537873|ref|XP_010305281.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Balearica regulorum gibbericeps]  clstr ali  48  912.CGCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 951
45 1.000e-10gi|944210682|gb|KQK77490.1| urokinase-type plasminogen activator [Amazona aestiva]  clstr ali  48  99ECHCLNGGTCITYYLFSGINRCICPEGYTGINCELDT... 135
46 1.000e-10gi|699695563|ref|XP_009890012.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Charadrius vociferus]  clstr ali  48 1087.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 1126
47 1.000e-10gi|938065194|gb|KPP65804.1| hypothetical protein Z043_115746 [Scleropages formosus]  clstr ali  44 1099.CGCLNGGTCITDVSFSGRYLCVCPGGFEGSRCQDDVDE. 1139
48 1.000e-10gi|1016631070|ref|XP_016042461.1| PREDICTED: urokinase-type plasminogen activator [Erinaceus europaeus]  clstr ali  75  62NCYCLNGGTCVFYKYFSNIHRCNCPRNFEGEHCEIESSKT 101
49 2.000e-10gi|678212427|gb|KFV79406.1| Urokinase-type plasminogen activator, partial [Struthio camelus australis]  clstr ali  52  1DCNCLNGGTCITYYLFSRINRCLCPEGYSGIHCEIDTD.. 38
50 2.000e-10gi|488568418|ref|XP_004473837.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Dasypus novemcinctus]  clstr ali  76  33.CGCLNGGTCVSYKYFSNIQRCNCPKNFQGEHCEIDASQT 71
51 2.000e-10gi|557261616|ref|XP_006016364.1| PREDICTED: urokinase-type plasminogen activator [Alligator sinensis]  clstr ali  58  40DCNCLNGGTCISYLLFSGISRCSCPNGYSGNHCEID-SET 78
52 2.000e-10gi|696961454|ref|XP_009569031.1| PREDICTED: urokinase-type plasminogen activator [Cuculus canorus]  clstr ali  52  39ECHCLNGGTCISYYLFSRINRCVCPEGYTGIHCELDTEST 78
53 2.000e-10gi|313676|emb|CAA25806.1| pot. pro-plasminogen activator [Sus scrofa]  clstr ali  75  32NCGCLNGGKCVSYKYFSNIQRCSCPKKFQGEHCEIDTSQT 71
54 2.000e-10gi|632961858|ref|XP_007896991.1| PREDICTED: neurocan core protein [Callorhinchus milii]  clstr ali  39 1446.NPCQNGATCVDGI---NSFTCLCLPSYTGSLCEEDT... 1478
55 2.000e-10gi|675606377|ref|XP_008947026.1| PREDICTED: urokinase-type plasminogen activator [Merops nubicus]  clstr ali  47  40.CHCLNGGTCITYYYFTGINRCICPKGYTGTYCELETDS. 77
56 2.000e-10gi|821451441|ref|XP_012409216.1| PREDICTED: urokinase-type plasminogen activator [Sarcophilus harrisii]  clstr ali  60  30DCGCLNNGVCISYKYF-KIHRCSCPENFIGEHCEIDISQ. 67
57 3.000e-10gi|677426995|gb|KFQ28766.1| Urokinase-type plasminogen activator, partial [Mesitornis unicolor]  clstr ali  50  1DCHCLNGGTCISYYFFSRINRCICPEGYTGVYCELDTDST 40
58 3.000e-10gi|705697712|ref|XP_010124699.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Chlamydotis macqueenii]  clstr ali  48  958.CGCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDTN.. 997
59 3.000e-10gi|558177120|ref|XP_006126415.1| PREDICTED: urokinase-type plasminogen activator [Pelodiscus sinensis]  clstr ali  63  40DCNCLNGGTCISYQLFSRINRCLCPKEYTGQHCEID.... 75
60 3.000e-10gi|768945396|ref|XP_011612208.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 2 [Takifugu rubripes]  clstr ali  54 1465NNPCLNGGTCVN---LWGSFSCDCPLGFGGNNCE...... 1495
61 4.000e-10gi|641658202|ref|XP_008180635.1| PREDICTED: cubilin-like [Acyrthosiphon pisum]  clstr ali  45  51.NPCQNGGTCVDLY---NGFQCNCPNNWQGKMCELDVDE. 85
62 4.000e-10gi|836710739|ref|XP_012789703.1| PREDICTED: urokinase-type plasminogen activator [Sorex araneus]  clstr ali  70  32DCGCLNGGTCVSYKHFSYIRGCLCPSKFEGEHCEIDTSKT 71
63 4.000e-10gi|1003889370|ref|XP_015722037.1| PREDICTED: urokinase-type plasminogen activator [Coturnix japonica]  clstr ali  52  39ECHCLNGGTCITYRFFSQIKRCLCPEGYSGLHCEIDTD.. 76
64 4.000e-10gi|537270935|gb|ERE91955.1| urokinase-type plasminogen activator-like protein [Cricetulus griseus]  clstr ali  70  48NCGCQNGGICVSYKYFSSIRRCSCPKRFQGEHCEIDTSKT 87
65 4.000e-10gi|959064527|ref|XP_014735434.1| PREDICTED: urokinase-type plasminogen activator [Sturnus vulgaris]  clstr ali  47  38ECPCLNGGVCITYYLFSGIGRCVCPDGYTGLHCELDTVST 77
66 5.000e-10gi|254692796|ref|NP_001157065.1| urokinase-type plasminogen activator precursor [Ovis aries]  clstr ali  72  32DCGCLNGGKCVSYKYFSNIQRCSCPKKFQGEYCEIDTSKT 71
67 5.000e-10gi|507548357|ref|XP_004658004.1| PREDICTED: urokinase-type plasminogen activator [Jaculus jaculus]  clstr ali  77  31NCGCLNGGTCVTYKYFSHILRCSCPKKFQGEHCEIDKSKT 70
68 5.000e-10gi|704489544|ref|XP_010075200.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Pterocles gutturalis]  clstr ali  48 1087.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDVN.. 1126
69 5.000e-10gi|927161310|ref|XP_013919535.1| PREDICTED: urokinase-type plasminogen activator [Thamnophis sirtalis]  clstr ali  55  36.CDCLNGGSCLIYGLFSQIKTCLCPEGYEGDHCEIDV-ET 73
70 6.000e-10gi|602714709|ref|XP_007467567.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Lipotes vexillifer]  clstr ali  79  33.CGCLNGGKCVSYKYFSNIQRCNCPKKFQGEHCEIDTSKT 71
71 6.000e-10gi|874452229|ref|XP_012947812.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Anas platyrhynchos]  clstr ali  47 1177.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDINE. 1217
72 6.000e-10gi|704290327|ref|XP_010175952.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Caprimulgus carolinensis]  clstr ali  48 1064.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 1103
73 6.000e-10gi|560133881|emb|CDJ85880.1| Cadherin and Laminin G and EGF domain containing protein, partial [Haemonchus contortus]  clstr ali  40 2194EAPCRNGGTC---QVIDKTYQCTCPPRYSGANCEIDMD.. 2228
74 7.000e-10gi|975108978|ref|XP_015270009.1| PREDICTED: urokinase-type plasminogen activator [Gekko japonicus]  clstr ali  52  41DCKCLHGGTCISYQLFSRVKRCLCPPGYSGDHCEID.... 76
75 7.000e-10gi|723147665|ref|XP_010291115.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Phaethon lepturus]  clstr ali  45 1121.CSCLNAGTCVTNIKFPGEYLCLCPNGFDGEFCQEDID.. 1160
76 7.000e-10gi|565313756|gb|ETE66008.1| Urokinase-type plasminogen activator, partial [Ophiophagus hannah]  clstr ali  55  1.CGCLNGGTCLTYGLFSQIKFCLCPEGYDGDHCEIDV-ET 38
77 7.000e-10gi|637357393|ref|XP_008119511.1| PREDICTED: tissue-type plasminogen activator [Anolis carolinensis]  clstr ali  51  91...CFNGGRCQQPLYSSNLFICLCPPGFSGKHCEIDAKAT 127
78 7.000e-10gi|704590597|ref|XP_010191453.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Mesitornis unicolor]  clstr ali  45  977.CSCLHGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDTN.. 1016
79 7.000e-10gi|597885280|gb|EYC34639.1| hypothetical protein Y032_0001g68 [Ancylostoma ceylanicum]  clstr ali  40 3937EAPCTNGGTC---HVIGRTYQCTCPARYTGANCEIDSD.. 3971
80 7.000e-10gi|510857104|gb|EPB72808.1| cadherin domain protein [Ancylostoma ceylanicum]  clstr ali  40 2892EAPCTNGGTC---HVIGRTYQCTCPARYTGANCEIDSD.. 2926
81 8.000e-10gi|6679377|ref|NP_032899.1| urokinase-type plasminogen activator precursor [Mus musculus]  clstr ali  70  31NCGCQNGGVCVSYKYFSRIRRCSCPRKFQGEHCEIDASKT 70
82 8.000e-10gi|149414214|ref|XP_001510562.1| PREDICTED: urokinase-type plasminogen activator [Ornithorhynchus anatinus]  clstr ali  71  36.CHCQNGGECVSYKLFSRIHRCNCPKGFEGEHCEID.... 70
83 8.000e-10gi|929290448|ref|XP_014022383.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 2-like isoform X7 [Salmo salar]  clstr ali  51 1448NNPCMNGGTCVN---LWGSFSCDCPLGFGGRNCE...... 1478
84 8.000e-10gi|972960888|ref|XP_015197920.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 2 [Lepisosteus oculatus]  clstr ali  53 1675.NPCLNGGTCVNR---WGSFSCDCPLGFGGRNCE...... 1704
85 9.000e-10gi|471415775|ref|XP_004389413.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Trichechus manatus latiro  clstr ali  52 1181.CDCLNGGSCVSDINFSGVYLCVCLPGFQGGLCEVDISE. 1221
86 9.000e-10gi|195344746|ref|XP_002038940.1| GM17110 [Drosophila sechellia]  clstr ali  35 1696DLPCLNGATCINLEPRLR-YRCICPEGYWGENCEL..... 1729
87 1.000e-09gi|119608837|gb|EAW88431.1| coagulation factor IX (plasma thromboplastic component, Christmas disease, hemophilia B), isoform CRA_a [Homo sapiens] :_  clstr ali  45  100.NPCLNGGSCKDDI---NSYECWCPFGFEGKNCELDV... 132
88 1.000e-09gi|532049887|ref|XP_005367711.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Microtus ochrogaster]  clstr ali  75  35NCGCLNGGICVSYKYFSSIRRCNCPKRFQGEHCEIDTSKT 74
89 1.000e-09gi|397482274|ref|XP_003812356.1| PREDICTED: coagulation factor IX [Pan paniscus]  clstr ali  45  100.NPCLNGGSCKDDI---NSYECWCPFGFEGKNCELDV... 132
90 1.000e-09gi|1002586626|ref|XP_015671944.1| PREDICTED: urokinase-type plasminogen activator [Protobothrops mucrosquamatus]  clstr ali  57  42.CGCLNGGTCLTYGLFSQIKSCVCPEGFDGDHCEIDV-ET 79
91 1.000e-09gi|47226544|emb|CAG08560.1| unnamed protein product, partial [Tetraodon nigroviridis]  clstr ali  47  8..HCYNGGTCKEAVYTSD-YICQCPPGFSGTHCEINTQE. 43
92 1.000e-09gi|557007638|ref|XP_006005097.1| PREDICTED: urokinase-type plasminogen activator [Latimeria chalumnae]  clstr ali  58  39.CDCLNGGSCVRHEYFPTYSYCLCPKGFSGRHCETDT... 74
93 1.000e-09gi|686584708|ref|XP_009278249.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Aptenodytes forsteri]  clstr ali  44 1085.CSCLSGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDINE. 1125
94 1.000e-09gi|902912014|ref|XP_013044693.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein-like [Anser cygnoides dome  clstr ali  47 1140.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDVNE. 1180
95 1.000e-09gi|807044520|ref|XP_004537828.2| PREDICTED: putative neural-cadherin 2 [Ceratitis capitata]  clstr ali  35 1544DLPCLNGATCINLEPRLR-YRCICPEGYWGENCEL..... 1577
96 1.000e-09gi|968017058|ref|XP_001974422.2| uncharacterized protein Dere_GG21727, isoform B [Drosophila erecta]  clstr ali  35 1504DLPCLNGATCINLEPRLR-YRCICPEGYWGENCEL..... 1537
97 1.000e-09gi|929290430|ref|XP_014022373.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 2-like isoform X1 [Salmo salar]  clstr ali  51 1684NNPCMNGGTCVN---LWGSFSCDCPLGFGGRNCE...... 1714
98 1.000e-09gi|829829311|ref|XP_012632910.1| PREDICTED: tissue-type plasminogen activator [Microcebus murinus]  clstr ali  50  231...CFNSGTCLQALYFSD-FVCQCPEGFAGKRCEIDTRAT 266
99 2.000e-09gi|156345300|ref|XP_001621318.1| hypothetical protein NEMVEDRAFT_v1g145311 [Nematostella vectensis]  clstr ali  47  78.CPCQNGGTCYPHPYYSGQYECACPKGFNGSRCEINIDE. 118
100 2.000e-09gi|701413527|ref|XP_009999053.1| PREDICTED: urokinase-type plasminogen activator [Chaetura pelagica]  clstr ali  56  39ECPCLNGGTCITY-YFSKISRCMCPEGYAGIHCEIDTTST 77
101 2.000e-09gi|938056409|gb|KPP61016.1| protein delta1-like [Scleropages formosus]  clstr ali  41  143..PCQNGGTCMDDDGWAAHSTCLCPPGFAGDFCEIDID.. 178
102 2.000e-09gi|1020979654|ref|XP_016153664.1| PREDICTED: LOW QUALITY PROTEIN: coagulation factor IX [Ficedula albicollis]  clstr ali  40  93.NPCQNGAVCKDQI---NSYVCWCPAGYEGKNCEID.... 124
103 2.000e-09gi|850280828|ref|XP_012859700.1| PREDICTED: urokinase-type plasminogen activator [Echinops telfairi]  clstr ali  70  30NCTCLNGGTCVSYKHFSHIQRCHCPKNFQGEHCEIDT... 66
104 2.000e-09gi|919013676|ref|XP_013391345.1| PREDICTED: collagen alpha-1(XXVIII) chain-like [Lingula anatina]  clstr ali  28  194.NPCQNGGSCRDDYK---SFVCTCAPGYEGERCQYDIDE. 228
105 2.000e-09gi|831547931|ref|XP_012727125.1| PREDICTED: neurocan core protein isoform X1 [Fundulus heteroclitus]  clstr ali  42 1080.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDI... 1112
106 2.000e-09gi|537228294|gb|ERE83561.1| versican core protein-like isoform 1 [Cricetulus griseus]  clstr ali  40 3110.NPCRNGATCVDGF---NTFRCLCLPSYTGALCEQDT-ET 3144
107 2.000e-09gi|972952992|ref|XP_015216137.1| PREDICTED: versican core protein [Lepisosteus oculatus]  clstr ali  40 2717.NPCRNGGTCIDSL---NSFTCVCLPSYAGALCEQDT-ET 2751
108 2.000e-09gi|929485752|ref|XP_014139913.1| PREDICTED: versican core protein [Falco cherrug]  clstr ali  37 3213.NPCRNGATCIDGL---NTFTCLCLPSYTGALCEQDT-ET 3247
109 2.000e-09gi|744563349|ref|XP_010977983.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Camelus dromedarius]  clstr ali  50 1184.CDCLNGGSCVSDTKFSGAYLCVCLPGFQGSLCEVDITE. 1224
110 2.000e-09gi|513195368|ref|XP_004943061.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Gallus gallus]  clstr ali  47 1142.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGGFCQEDINE. 1182
111 2.000e-09gi|817321339|ref|XP_012331357.1| PREDICTED: tissue-type plasminogen activator [Aotus nancymaae]  clstr ali  52  142...CFNGGTCRQALYFSD-FVCQCPEGFTGKRCEIDTKAT 177
112 2.000e-09gi|632957377|ref|XP_007894443.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Callorhinchus milii]  clstr ali  47 1193.CGCLNGGTCVTNINFSGEYLCVCPVGFEGEVCQENIDE. 1233
113 2.000e-09gi|47226546|emb|CAG08562.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  47  39..HCYNGGTCKEAVYTSD-YICQCPPGFSGTHCEINTQE. 74
114 2.000e-09gi|637311416|ref|XP_008110901.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Anolis carolinensis]  clstr ali  44 1201.CNCLNGGSCVTNTNFSGKYLCVCLPGFEGRYCQEDIDE. 1241
115 2.000e-09gi|928037192|ref|XP_013867241.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Austrofundulus limnaeus]  clstr ali  48  114...CYNGGTCKEALY-SSEYVCQCPPGFSGAHCEINMNE. 148
116 2.000e-09gi|755865427|ref|XP_005180180.2| PREDICTED: uncharacterized protein LOC101896163 [Musca domestica]  clstr ali  50  405...CQNGGTCT------GHDSCSCPAGFTGRYCEIDIDE. 434
117 2.000e-09gi|537273593|gb|ERE92477.1| tissue-type plasminogen activator [Cricetulus griseus]  clstr ali  50  165...CFNGGTCQQALYFSD-FVCQCPDGFVGKRCDIDTRAT 200
118 2.000e-09gi|505796193|ref|XP_004606976.1| PREDICTED: tissue-type plasminogen activator [Sorex araneus]  clstr ali  50  110...CFNGGTCWQPLYFSD-FVCQCPDGFAGKYCEVDTRTT 145
119 2.000e-09gi|1020592162|ref|XP_016116366.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 2-like [Sinocyclocheilus grahami]  clstr ali  50 1585.NPCLNGGSCVD---LWGSFRCDCPLGFGGRNCE...... 1614
120 2.000e-09gi|1005490115|ref|XP_015747775.1| PREDICTED: mucin-5AC-like, partial [Acropora digitifera]  clstr ali  39  173..PCFNGGTCKIDVDEPRGYRCVCPEGFAGLQCEL..... 205
121 3.000e-09gi|768430294|ref|XP_011556368.1| PREDICTED: protein crumbs-like [Plutella xylostella]  clstr ali  36  310..PCLNNGSC-SVPPGQDSYVCECPPGFTGRNCETNIDE. 345
122 3.000e-09gi|974103819|ref|XP_015250781.1| PREDICTED: neurocan core protein-like [Cyprinodon variegatus]  clstr ali  42 1064.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDI... 1096
123 3.000e-09gi|909807497|ref|XP_013158650.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Falco peregrinus]  clstr ali  48 1147.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 1186
124 3.000e-09gi|657558042|ref|XP_008283120.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Stegastes partitus]  clstr ali  45  115...CYNGGTCKEAVYTSD-YICQCPPGFSGTQCEINTNE. 149
125 3.000e-09gi|915550458|ref|XP_013224632.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Columba livia]  clstr ali  48 1143.CGCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 1182
126 3.000e-09gi|612045201|ref|XP_007501313.1| PREDICTED: coagulation factor VII isoform X2 [Monodelphis domestica]  clstr ali  45  93.NPCQNGGTCVDQFQ---SYICFCPARFEGRNCETDKDS. 127
127 3.000e-09gi|927179979|ref|XP_013835187.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein isoform X1 [Sus scrofa]  clstr ali  50 1186.CDCLNGGSCVSDIQFSGAYLCVCLPGFQGDLCEEDVTE. 1226
128 3.000e-09gi|960963749|ref|XP_014796616.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Calidris pugnax]  clstr ali  48 1148.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 1187
129 3.000e-09gi|537273594|gb|ERE92478.1| tissue-type plasminogen activator [Cricetulus griseus]  clstr ali  50  165...CFNGGTCQQALYFSD-FVCQCPDGFVGKRCDIDTRAT 200
130 3.000e-09gi|676283119|gb|KFO36418.1| Tissue-type plasminogen activator [Fukomys damarensis]  clstr ali  50  192...CFNGGICRQALYFSD-FVCQCPQGFMGKRCEIDTRAT 227
131 3.000e-09gi|637333400|ref|XP_008115094.1| PREDICTED: uncharacterized protein LOC103279860 [Anolis carolinensis]  clstr ali  36  119ENLCQNGGTCHQMYLRGGVFRCDCPLHFTGRFCEKDTT.. 158
132 3.000e-09gi|529449036|ref|XP_005244206.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Falco peregrinus]  clstr ali  46 1029NNPCLHGGTCRAN---GTVCGCSCTPGFTGENCEI..... 1060
133 4.000e-09gi|669302602|gb|KFD46252.1| hypothetical protein M513_12870, partial [Trichuris suis]  clstr ali  33  300NNPCRHGGLCMETY---GGYTCQCPPGWNGHNCEKDIDE. 335
134 4.000e-09gi|119608840|gb|EAW88434.1| coagulation factor IX (plasma thromboplastic component, Christmas disease, hemophilia B), isoform CRA_d [Homo sapiens] :_  clstr ali  45  100.NPCLNGGSCKDDI---NSYECWCPFGFEGKNCELDV... 132
135 4.000e-09gi|830031324|ref|XP_004682333.2| PREDICTED: tissue-type plasminogen activator [Condylura cristata]  clstr ali  52  91...CFNGGTCWQALYFSD-FVCQCPEGFVGKRCEIDTRAT 126
136 4.000e-09gi|334346827|ref|XP_001374277.2| PREDICTED: coagulation factor VII isoform X1 [Monodelphis domestica]  clstr ali  45  93.NPCQNGGTCVDQFQ---SYICFCPARFEGRNCETDKDS. 127
137 4.000e-09gi|700421870|ref|XP_009949206.1| PREDICTED: uncharacterized protein LOC104346213, partial [Leptosomus discolor]  clstr ali  48  101.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGELCQEDTN.. 140
138 4.000e-09gi|831244910|ref|XP_012667679.1| PREDICTED: tissue-type plasminogen activator [Otolemur garnettii]  clstr ali  52  88...CFNGGTCWQALYFS-HFVCQCPEGFTGTRCEIDARAT 123
139 4.000e-09gi|617436128|ref|XP_007563499.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Poecilia formosa]  clstr ali  48  114...CYNGGTCKEAVYSSN-YICQCPPGFSGAQCEINTNE. 148
140 4.000e-09gi|431902225|gb|ELK08726.1| Tissue-type plasminogen activator [Pteropus alecto]  clstr ali  55  110...CFNGGTCRQALYFSD-FVCQCPEGFSGKLCEIDASAT 145
141 4.000e-09gi|47229646|emb|CAG06842.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  53 1588.NPCLNGGTCVN---LWGSFSCDCPLGFGGKSCE...... 1617
142 4.000e-09gi|992220952|ref|XP_015463195.1| PREDICTED: LOW QUALITY PROTEIN: cadherin EGF LAG seven-pass G-type receptor 2-like [Astyanax mexicanus]  clstr ali  51 1615NNPCLNGGTCAS---LWGSFRCDCALGFGGRNCE...... 1645
143 5.000e-09gi|512850564|ref|XP_002939057.2| PREDICTED: von Willebrand factor D and EGF domain-containing protein isoform X1 [Xenopus tropicalis]  clstr ali  39 1186.CGCINGGSCVTNINFPGEYLCLCPNGFEGDNCQVNIDE. 1226
144 5.000e-09gi|831298177|ref|XP_012680944.1| PREDICTED: tissue-type plasminogen activator [Clupea harengus]  clstr ali  48  65...CYNGGTCKEAVYSSD-YLCQCPPGFTGSQCEINTSE. 99
145 5.000e-09gi|742119511|ref|XP_010874793.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Esox lucius]  clstr ali  48  110...CYNGGTCKEAVYSSD-YLCQCPPGFTGAQCEINTSE. 144
146 5.000e-09gi|683907030|ref|XP_009086484.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Serinus canaria]  clstr ali  45 1079.CSCLSGGTCVTNIKYPGEYLCLCPNGFGGEFCQEDIR.. 1118
147 6.000e-09gi|164419019|gb|ABY54817.1| c-type lectin [Branchiostoma japonicum]  clstr ali  38  149..PCHNGATCQDG---ANSLTCRCAPGYTGIHCETDIDE. 182
148 6.000e-09gi|465984463|gb|EMP36560.1| Fibulin-7 [Chelonia mydas]  clstr ali  43  193.NPCQNGGTCVDGI---NQYKCTCPQGWTGENCQ...... 222
149 6.000e-09gi|260791920|ref|XP_002590975.1| hypothetical protein BRAFLDRAFT_69474 [Branchiostoma floridae]  clstr ali  38  275.NPCQNGGMCSDGL---NSYVCHCTAGFEGDNCETDMD.. 308
150 6.000e-09gi|696999584|ref|XP_009565960.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Cuculus canorus]  clstr ali  48 1344.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQKDVN.. 1383
151 6.000e-09gi|974080552|ref|XP_015238031.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Cyprinodon variegatus]  clstr ali  45  87...CYNGGTCKEAVYSSD-YICQCPPGFSGTQCEINTNE. 121
152 6.000e-09gi|973147770|ref|XP_015214145.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like isoform X1 [Lepisosteus oculatus]  clstr ali  42 1198.CGCHNGGTCVTNINFSGRYLCVCAPGFKGDLCQENVDE. 1238
153 6.000e-09gi|584036621|ref|XP_006765598.1| PREDICTED: tissue-type plasminogen activator [Myotis davidii]  clstr ali  58  92...CFNGGTCRQALYFSN-FVCQCPEGFSGQLCEIDARAT 127
154 6.000e-09gi|667266766|ref|XP_008569429.1| PREDICTED: tissue-type plasminogen activator [Galeopterus variegatus]  clstr ali  55  92...CFNGGTCRQALYFSD-FVCQCPEGFVGKRCEIDASAT 127
155 6.000e-09gi|731462193|ref|XP_010585743.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Loxodonta africana]  clstr ali  52  703.CDCLNGGSCVSDTSFSGAYLCVCLPGFQGDLCEEDISE. 743
156 6.000e-09gi|1351380|sp|P15638.2|URT2_DESRO RecName: Full=Salivary plasminogen activator alpha 2; AltName: Full=BAT-PA; AltName: Full=DSPA alpha-2; AltName: Fu  clstr ali  47  92...CFNGGTCWQAASFSD-FVCQCPKGYTGKQCEVDTHAT 127
157 7.000e-09gi|405974181|gb|EKC38847.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Crassostrea gigas]  clstr ali  38  61.NPCQNGATCVDEL---NRYSCTCQPGYQGTNCET..... 91
158 7.000e-09gi|929065948|ref|XP_014020519.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like isoform X2 [Salmo salar]  clstr ali  48 1158.CDCLNGASCVTNINLSGEYLCVCPAGFTGDRCEEDID.. 1197
159 7.000e-09gi|1003926284|ref|XP_015724669.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like isoform X1 [Coturnix japonica]  clstr ali  44 1181.CSCLNGGSCVTNIKFPGEYLCLCPSGFDGGLCQEDINE. 1221
160 7.000e-09gi|929065946|ref|XP_014020514.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like isoform X1 [Salmo salar]  clstr ali  48 1158.CDCLNGASCVTNINLSGEYLCVCPAGFTGDRCEEDID.. 1197
161 7.000e-09gi|768949964|ref|XP_011614089.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Takifugu rubripes]  clstr ali  48  112...CYNGGTCKEAVYTSD-YICQCPTGFSGTHCEINTNE. 146
162 7.000e-09gi|966706120|gb|KTG38361.1| hypothetical protein cypCar_00016130, partial [Cyprinus carpio]  clstr ali  40 1883.NPCHNGGTCIDGL---NSFTCVCLPSYSGALCEQDT-ET 1917
163 7.000e-09gi|1020560148|ref|XP_016111498.1| PREDICTED: versican core protein-like [Sinocyclocheilus grahami]  clstr ali  44  310DAVCLNGGSCV---KIVGAQICSCPPGYSGDQCEIDT... 343
164 7.000e-09gi|507652465|ref|XP_004633125.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Octodon degus]  clstr ali  52  88...CFNGGTCRQALYFSD-FVCQCPEGFMGKRCEIDSRVT 123
165 7.000e-09gi|488596122|ref|XP_004483245.1| PREDICTED: tissue-type plasminogen activator [Dasypus novemcinctus]  clstr ali  52  92...CFNGGTCLQALYFSD-FVCQCPEGFVGKSCEIEASAT 127
166 8.000e-09gi|719755065|ref|XP_010214361.1| PREDICTED: versican core protein-like [Tinamus guttatus]  clstr ali  37 1897.NPCRNGATCIDGL---NTFTCVCLPSYIGTLCEQDT-ET 1931
167 8.000e-09gi|675421298|ref|XP_008924173.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein, partial [Manacus vitellinus]  clstr ali  47 1067.CSCLNGGTCVTNIKHPGEYLCLCPNGFDGEFCQEDI... 1105
168 8.000e-09gi|545878910|ref|XP_005657704.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Sus scrofa]  clstr ali  52  107...CFNGGTCLQAVYFSD-FVCQCPVGFIGRQCEIDARAT 142
169 8.000e-09gi|130492452|ref|NP_001076238.1| tissue-type plasminogen activator precursor [Oryctolagus cuniculus]  clstr ali  51  92...CLNGGTCSQALYFSD-FVCQCPEGFVGKRCEVDTRA. 126
170 9.000e-09gi|669319418|gb|KFD59834.1| hypothetical protein M514_13293 [Trichuris suis]  clstr ali  33  440NNPCRHGGLCMETY---GGYTCQCPPGWNGHNCEKDIDE. 475
171 9.000e-09gi|449275177|gb|EMC84120.1| von Willebrand factor D and EGF domain-containing protein, partial [Columba livia]  clstr ali  48 1131.CGCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 1170
172 9.000e-09gi|632963508|ref|XP_007897921.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Callorhinchus milii]  clstr ali  48 1196.CNCLNGGSCVINIHFSGEYLCVCPLGFEGKYCEVNID.. 1235
173 9.000e-09gi|938047839|gb|KPP57797.1| hypothetical protein Z043_124442, partial [Scleropages formosus]  clstr ali  54  468NSPCLNGGTCVNR---WGSYSCDCPLGFGGRNCE...... 498
174 1.000e-08gi|919002970|ref|XP_013415168.1| PREDICTED: fibropellin-3-like [Lingula anatina]  clstr ali  44  108..PCLNGGTCKDEV---NKFTCVCLPGYAGRRCEIDIDE. 141
175 1.000e-08gi|308453821|ref|XP_003089596.1| hypothetical protein CRE_30572 [Caenorhabditis remanei]  clstr ali  32  857..PCQNGGECEDIIGPPNSYNCTCTPQWTGTNCTIDVDE. 893
176 1.000e-08gi|405973660|gb|EKC38361.1| Versican core protein [Crassostrea gigas]  clstr ali  40  21.NSCQNGGTCHNG---NNQYTCSCLPGWTGTNCEIDIDE. 55
177 1.000e-08gi|669327331|gb|KFD67533.1| hypothetical protein M514_20210 [Trichuris suis]  clstr ali  33  793NNPCRHGGLCMETY---GSYTCQCPPGWNGHNCEKDIDE. 828
178 1.000e-08gi|736303918|ref|XP_010794083.1| PREDICTED: neurocan core protein-like [Notothenia coriiceps]  clstr ali  42 1023.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1055
179 1.000e-08gi|1007779565|ref|XP_015827106.1| PREDICTED: neurocan core protein [Nothobranchius furzeri]  clstr ali  42 1065.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1097
180 1.000e-08gi|765116722|ref|XP_011471889.1| PREDICTED: neurocan core protein [Oryzias latipes]  clstr ali  39 1056.NPCQNGGTCIDEI---NSFVCLCLPSYSGATCEKDT... 1088
181 1.000e-08gi|642123698|emb|CDQ62744.1| unnamed protein product [Oncorhynchus mykiss]  clstr ali  45  87...CYNGGTCKEAVYSSD-FLCQCPPGFTGAQCEINTNE. 121
182 1.000e-08gi|675625023|ref|XP_008940771.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein, partial [Merops nubicus]  clstr ali  47  899.CSCLNGGTCVTNITFPGEYLCLCPNGFDGEFCQEDTNA. 939
183 1.000e-08gi|931575219|ref|XP_008975163.2| PREDICTED: tissue-type plasminogen activator isoform X1 [Pan paniscus]  clstr ali  52  178...CFNGGTCQQALYFSD-FVCQCPEGFAGKCCEIDTRAT 213
184 1.000e-08gi|931575221|ref|XP_008975164.2| PREDICTED: tissue-type plasminogen activator isoform X2 [Pan paniscus]  clstr ali  52  132...CFNGGTCQQALYFSD-FVCQCPEGFAGKCCEIDTRAT 167
185 1.000e-08gi|472351818|ref|XP_004395590.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Odobenus rosmarus diverge  clstr ali  47 1381.CDCLNGGSCVSDRKFSGMYLCVCLPGFQGVLCEVNVTE. 1421
186 1.000e-08gi|532039651|ref|XP_005362683.1| PREDICTED: tissue-type plasminogen activator [Microtus ochrogaster]  clstr ali  50  88...CFNGGTCQQAMYFSD-FVCQCPDGFVGKRCDIDTRAT 123
187 1.000e-08gi|907680015|ref|XP_013106209.1| PREDICTED: putative neural-cadherin 2 [Stomoxys calcitrans]  clstr ali  35  16DMPCLNGATCINLEPRLR-YRCICPEGYWGENCEL..... 49
188 1.000e-08gi|674085457|ref|XP_008850515.1| PREDICTED: tissue-type plasminogen activator isoform X3 [Nannospalax galili]  clstr ali  50  42...CFNGGTCWQALYFSD-FVCQCPDGFVGKRCDIDTGAT 77
189 1.000e-08gi|1000738722|ref|XP_015591920.1| PREDICTED: uncharacterized protein LOC107266189 [Cephus cinctus]  clstr ali  54  217..PCLNGGTCTSPG------RCTCPKGFTGNQCETDVDE. 247
190 1.000e-08gi|545878907|ref|XP_005657703.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Sus scrofa]  clstr ali  52  107...CFNGGTCLQAVYFSD-FVCQCPVGFIGRQCEIDARAT 142
191 1.000e-08gi|701411752|ref|XP_009998690.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Chaetura pelagica]  clstr ali  48 1080.CSCLNGGTCVTNIKFPGEYLCLCPNAFDGDFCQEDTN.. 1119
192 2.000e-08gi|260826540|ref|XP_002608223.1| hypothetical protein BRAFLDRAFT_87876 [Branchiostoma floridae]  clstr ali  42  296..PCQNGGQCIDDV---NSFRCRCPTGYSGDLCEIDID.. 328
193 2.000e-08gi|669302141|gb|KFD45828.1| hypothetical protein M513_13293 [Trichuris suis]  clstr ali  33  405NNPCRHGGLCMETY---GGYTCQCPPGWNGHNCEKDIDE. 440
194 2.000e-08gi|795228718|ref|XP_011806972.1| PREDICTED: protein delta homolog 1 [Colobus angolensis palliatus]  clstr ali  42  236..PCQHGGTCVDDEGRASHASCLCPPGFSGNFCEI..... 268
195 2.000e-08gi|156350060|ref|XP_001622124.1| predicted protein [Nematostella vectensis]  clstr ali  37  143.NPCKNGGTCH--FKSPGVFSCTCAAGFSGNQCETDID.. 177
196 2.000e-08gi|617455395|ref|XP_007570093.1| PREDICTED: neurocan core protein-like isoform X1 [Poecilia formosa]  clstr ali  43 1084.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKD.... 1115
197 2.000e-08gi|919062301|ref|XP_013412803.1| PREDICTED: uncharacterized protein LOC106175385 [Lingula anatina]  clstr ali  46  212..PCQNGGKCQDDI---NGYSCMCPGGFQGKNCEI..... 241
198 2.000e-08gi|657530701|ref|XP_008298822.1| PREDICTED: neurocan core protein [Stegastes partitus]  clstr ali  42 1103.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1135
199 2.000e-08gi|657740904|ref|XP_008305518.1| PREDICTED: neurocan core protein [Cynoglossus semilaevis]  clstr ali  42 1077.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1109
200 2.000e-08gi|499001277|ref|XP_004554940.1| PREDICTED: neurocan core protein [Maylandia zebra]  clstr ali  42 1093.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1125
201 2.000e-08gi|928046499|ref|XP_013872220.1| PREDICTED: neurocan core protein [Austrofundulus limnaeus]  clstr ali  42 1056.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1088
202 2.000e-08gi|874455117|ref|XP_012948783.1| PREDICTED: LOW QUALITY PROTEIN: versican core protein [Anas platyrhynchos]  clstr ali  37 3291.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 3325
203 2.000e-08gi|704478013|ref|XP_010072761.1| PREDICTED: versican core protein-like [Pterocles gutturalis]  clstr ali  37 1905.NPCRNGATCIDGL---NTFTCLCLPSYVGALCEQDT-ET 1939
204 2.000e-08gi|768398013|ref|XP_011594830.1| PREDICTED: neurocan core protein isoform X1 [Aquila chrysaetos canadensis]  clstr ali  43 1105..PCQNGGTCIDEV---NSFVCLCLPSYGGSRCEKDT... 1136
205 2.000e-08gi|960947138|ref|XP_014793523.1| PREDICTED: neurocan core protein [Calidris pugnax]  clstr ali  43 1084..PCQNGGTCIDEV---NSFVCLCLPSYGGSRCEKDT... 1115
206 2.000e-08gi|671027596|ref|XP_008704598.1| PREDICTED: versican core protein isoform X5 [Ursus maritimus]  clstr ali  40 3142.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 3176
207 2.000e-08gi|410948928|ref|XP_003981179.1| PREDICTED: versican core protein isoform X4 [Felis catus]  clstr ali  40 3133.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 3167
208 2.000e-08gi|589935513|ref|XP_006980528.1| PREDICTED: versican core protein isoform X1 [Peromyscus maniculatus bairdii]  clstr ali  40 3110.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 3144
209 2.000e-08gi|532027206|ref|XP_005356579.1| PREDICTED: versican core protein isoform X1 [Microtus ochrogaster]  clstr ali  40 3105.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 3139
210 2.000e-08gi|852747907|ref|XP_012871389.1| PREDICTED: versican core protein [Dipodomys ordii]  clstr ali  40 3083.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 3117
211 2.000e-08gi|585201609|ref|XP_006751712.1| PREDICTED: versican core protein-like [Leptonychotes weddellii]  clstr ali  40 1879.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 1913
212 2.000e-08gi|929488383|ref|XP_014113716.1| PREDICTED: versican core protein isoform X1 [Pseudopodoces humilis]  clstr ali  37 3204.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 3238
213 2.000e-08gi|971440063|ref|XP_015136070.1| PREDICTED: versican core protein isoform X1 [Gallus gallus]  clstr ali  37 3307.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 3341
214 2.000e-08gi|694835102|ref|XP_009475037.1| PREDICTED: versican core protein isoform X1 [Nipponia nippon]  clstr ali  37 3299.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 3333
215 2.000e-08gi|697493374|ref|XP_009676801.1| PREDICTED: LOW QUALITY PROTEIN: versican core protein [Struthio camelus australis]  clstr ali  37 3250.NPCRNGATCIDGL---NTFTCVCLPSYIGALCEQDT-ET 3284
216 2.000e-08gi|768373828|ref|XP_011584386.1| PREDICTED: versican core protein isoform X1 [Aquila chrysaetos canadensis]  clstr ali  37 2351.NPCRNGATCIDGL---NTFTCLCLPSYVGALCEQDT-ET 2385
217 2.000e-08gi|700438509|ref|XP_009958420.1| PREDICTED: versican core protein-like, partial [Leptosomus discolor]  clstr ali  37 1859.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 1893
218 2.000e-08gi|704560924|ref|XP_010182696.1| PREDICTED: versican core protein-like, partial [Mesitornis unicolor]  clstr ali  37 1885.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 1919
219 2.000e-08gi|965929859|ref|XP_014950584.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein isoform X1 [Ovis aries] :_  clstr ali  47  854.CDCLNGGSCVSDTKFSGAYLCVCLPGFHGDLCEKNVTE. 894
220 2.000e-08gi|391330169|ref|XP_003739536.1| PREDICTED: crumbs homolog 1-like [Metaseiulus occidentalis]  clstr ali  48  14NNPCKNGGTCSPLDDFS-EYQCICPPGFRGGQCE...... 46
221 2.000e-08gi|998703577|ref|XP_015489497.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Parus major]  clstr ali  47 1145.CSCLNGGTCVTNIKYPGEYLCLCPNGFDGEFCQEDI... 1183
222 2.000e-08gi|973139039|ref|XP_015213244.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Lepisosteus oculatus]  clstr ali  42 1191.CECLNGGSCVTDINFSGEYLCVCPPGLEGERCAVDTDE. 1231
223 2.000e-08gi|194374979|dbj|BAG62604.1| unnamed protein product [Homo sapiens]  clstr ali  52  91...CFNGGTCQQALYFSD-FVCQCPEGFAGKCCEIDTRAT 126
224 2.000e-08gi|542233937|ref|XP_005455174.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Oreochromis niloticus]  clstr ali  43 1142.CECLNGASCVASVNLSGEYVCVCPDGFTGKRCEVDID.. 1181
225 2.000e-08gi|734645271|ref|XP_010751717.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Larimichthys crocea]  clstr ali  42 1179.CGCQNGGTCVTDINFSGKYLCVCPEGTLGDLCDEDVDE. 1219
226 2.000e-08gi|823464226|ref|XP_012430473.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein-like [Taeniopygia guttata]  clstr ali  47 1096.CSCLNGGTCVTNIKYPGEYLCLCPNGFDGEFCQEDI... 1134
227 2.000e-08gi|767944974|ref|XP_011513477.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein isoform X2 [Homo sapiens]  clstr ali  54 1181.CDCLNGGSCVSDRNFSGVYLCVCLPGFHGSLCEVDIS.. 1220
228 2.000e-08gi|208879560|gb|ACI31317.1| plasminogen activator [Carollia perspicillata]  clstr ali  50  92...CFNGGTCRQLLYFSD-FVCQCPEGYTGKLCEVDASAT 127
229 2.000e-08gi|1016706539|ref|XP_016074252.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Miniopterus natalensis]  clstr ali  50 1183.CDCLNGGSCVSDTKFSAAYMCVCLPGFQGSLCEVDVTE. 1223
230 2.000e-08gi|742103139|ref|XP_010869875.1| PREDICTED: neurocan core protein [Esox lucius]  clstr ali  39 1104.NPCQNGGTCIDEI---NSFVCLCLPSYSGATCEKDT... 1136
231 2.000e-08gi|808874232|gb|KKF23394.1| Versican core protein [Larimichthys crocea]  clstr ali  40 3810.NPCRNGGTCVDGLASV---TCLCLPSYSGEYCEEDT-ET 3844
232 2.000e-08gi|734627718|ref|XP_010742058.1| PREDICTED: versican core protein [Larimichthys crocea]  clstr ali  40 2412.NPCRNGGTCVDGLASV---TCLCLPSYSGEYCEEDT-ET 2446
233 2.000e-08gi|808876154|gb|KKF24815.1| Tissue-type plasminogen activator [Larimichthys crocea]  clstr ali  45  87...CYNGGTCKEAVYTSD-YICQCPPGFSGTQCEINTKE. 121
234 2.000e-08gi|555979796|ref|XP_005901828.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Bos mutus]  clstr ali  50  92...CFNGGTCRQALYSSD-FVCQCPEGFMGKLCEIDATAT 127
235 2.000e-08gi|671027438|ref|XP_008704516.1| PREDICTED: tissue-type plasminogen activator [Ursus maritimus]  clstr ali  52  45...CFNGGMCRQALYFSD-FVCQCPEGFLGKRCEIDASAT 80
236 2.000e-08gi|562823864|ref|XP_006141725.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Tupaia chinensis]  clstr ali  47  88...CFNGGACRQALYFSD-FVCQCPEGFVGKRCEVDTRAT 123
237 2.000e-08gi|966714844|gb|KTG47082.1| hypothetical protein cypCar_00028987, partial [Cyprinus carpio]  clstr ali  50  104.NPCLNGGSCVN---LWGLFRCDCPLGFGGRNCE...... 133
238 2.000e-08gi|640793626|ref|XP_008052797.1| PREDICTED: tissue-type plasminogen activator [Tarsius syrichta]  clstr ali  47  88...CFNGGTCWQALYFSD-FVCQCPEGYLGKRCEVDARVT 123
239 2.000e-08gi|919091355|ref|XP_013382664.1| PREDICTED: coagulation factor X-like [Lingula anatina]  clstr ali  52  119..PCLNGSTC---YVFSGNVWCECVSGFGGKHCEKDLDN. 152
240 2.000e-08gi|537257597|gb|ERE89283.1| von Willebrand factor D and EGF domain-containing protein [Cricetulus griseus]  clstr ali  54 1211.CDCLNGGSCVSDRKFSGAYLCVCLPGFHGNLCEVDAS.. 1250
241 2.000e-08gi|821460924|ref|XP_003758079.2| PREDICTED: tissue-type plasminogen activator [Sarcophilus harrisii]  clstr ali  56  87...CFNGGTCQQALYFSD-FICQCPRGFSGKQCEID.... 118
242 2.000e-08gi|1002586795|ref|XP_015672016.1| PREDICTED: tissue-type plasminogen activator [Protobothrops mucrosquamatus]  clstr ali  44  95...CLHGGRCQQALYSPNLFICFCPPGFSGKFCEIDTRA. 130
243 3.000e-08gi|1005442066|ref|XP_015758363.1| PREDICTED: uncharacterized protein LOC107337665 [Acropora digitifera]  clstr ali  35  107.NPCMNNGTCQTGFTEKGR-RCSCPVGFNGENCENDIDE. 143
244 3.000e-08gi|156353169|ref|XP_001622947.1| predicted protein [Nematostella vectensis]  clstr ali  39  93ECPCQHGGTCHPHPYVSGQYECAFPAGFNGSRCESDID.. 133
245 3.000e-08gi|542207765|ref|XP_005477188.1| PREDICTED: protein delta homolog 1 isoform X1 [Oreochromis niloticus]  clstr ali  38  153..PCQNGGTCMDAEGSAAFSSCLCPPGFSGDFCEIGID.. 188
246 3.000e-08gi|431839286|gb|ELK01213.1| Protein delta like protein 1 [Pteropus alecto]  clstr ali  42  60..PCQHGGTCVDEDGRASHASCLCPPGFSGNFCEI..... 92
247 3.000e-08gi|919039301|ref|XP_013403153.1| PREDICTED: macrophage receptor MARCO-like [Lingula anatina]  clstr ali  35  199..PCQNGGTCLDDYR---SFFCTCLSGFTGDRCQHDINE. 232
248 3.000e-08gi|742088447|ref|XP_010886411.1| PREDICTED: neurocan core protein [Esox lucius]  clstr ali  39  887.NPCLNGGTCIDKI---DSFICLCLPSYSGHSCEKDV... 919
249 3.000e-08gi|752431297|ref|XP_011233686.1| PREDICTED: versican core protein isoform X1 [Ailuropoda melanoleuca]  clstr ali  40 2140.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 2174
250 3.000e-08gi|880972110|ref|XP_005087966.2| PREDICTED: versican core protein-like, partial [Mesocricetus auratus]  clstr ali  40 1823.NPCRNGATCVDGF---NTFRCLCLPSYIGALCEQDT-ET 1857
251 3.000e-08gi|704157752|ref|XP_010140278.1| PREDICTED: versican core protein-like [Buceros rhinoceros silvestris]  clstr ali  37 3071.NPCRNGATCIDGF---NTFTCLCLPSYVGVLCEQDT-ET 3105
252 3.000e-08gi|426230094|ref|XP_004009116.1| PREDICTED: versican core protein isoform X1 [Ovis aries]  clstr ali  37 3113.NPCRNGATCIDGF---NTFRCLCLPSYVGALCEQDT-ET 3147
253 3.000e-08gi|525027791|ref|XP_005061318.1| PREDICTED: versican core protein isoform X2 [Ficedula albicollis]  clstr ali  37 2684.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 2718
254 3.000e-08gi|560904684|ref|XP_006178701.1| PREDICTED: versican core protein isoform X1 [Camelus ferus]  clstr ali  40 3134.NPCRNGATCVDGF---NTFRCLCLPSYIGALCERDT-ET 3168
255 3.000e-08gi|826277096|ref|XP_012493926.1| PREDICTED: versican core protein isoform X1 [Propithecus coquereli]  clstr ali  37 3123.NPCRNGATCIDGF---NTFRCLCLPSYVGALCEQDT-ET 3157
256 3.000e-08gi|998742144|ref|XP_015470576.1| PREDICTED: versican core protein isoform X2 [Parus major]  clstr ali  37 2711.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 2745
257 3.000e-08gi|530589042|ref|XP_005288216.1| PREDICTED: versican core protein isoform X1 [Chrysemys picta bellii]  clstr ali  37 3214.NPCRNGATCIDGL---NLFTCLCLPSYAGALCEQDT-ET 3248
258 3.000e-08gi|701304749|ref|XP_010013057.1| PREDICTED: versican core protein-like [Nestor notabilis]  clstr ali  37 1888.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 1922
259 3.000e-08gi|971440067|ref|XP_015136072.1| PREDICTED: versican core protein isoform X2 [Gallus gallus]  clstr ali  37 2380.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 2414
260 3.000e-08gi|729758935|ref|XP_010576355.1| PREDICTED: versican core protein [Haliaeetus leucocephalus]  clstr ali  37 3278.NPCRNGATCIDGL---NTFTCLCLPSYVGALCEQDT-ET 3312
261 3.000e-08gi|727058934|ref|XP_010408162.1| PREDICTED: versican core protein isoform X1 [Corvus cornix cornix]  clstr ali  37 3224.NPCRNGATCIDGL---NTFTCLCLPSYVGALCEQDT-ET 3258
262 3.000e-08gi|699586658|ref|XP_009864862.1| PREDICTED: versican core protein-like, partial [Apaloderma vittatum]  clstr ali  37 3006.NPCRNGATCIDGL---NTFTCLCLPSYVGALCEQDT-ET 3040
263 3.000e-08gi|830009701|ref|XP_012612630.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Microcebus murinus]  clstr ali  51 1108.CDCLNGGSCVSDMKFPGMYSCVCLPGFQGNLCEVDVS.. 1147
264 3.000e-08gi|1016643745|ref|XP_016043477.1| PREDICTED: tissue-type plasminogen activator [Erinaceus europaeus]  clstr ali  47  88...CFNGGTCQQALYFPD-FVCQCPEGFTGKLCEVDATAT 123
265 3.000e-08gi|742181473|ref|XP_010888223.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Esox lucius]  clstr ali  45 1115.CDCLNGASCVPNIPGSGGYLCVCPAGFRGDRCEVNID.. 1154
266 3.000e-08gi|667241686|ref|XP_008568333.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Galeopterus variegatus]  clstr ali  54 1256.CDCLNGGSCVSDMKFSGVYLCVCLPGFQGGLCEVDVS.. 1295
267 3.000e-08gi|664753528|ref|XP_008534227.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Equus przewalskii]  clstr ali  47 1203.CDCLNGGSCVSDIKFSGAYLCVCLPGFQGGLCEVEVTE. 1243
268 3.000e-08gi|694919915|ref|XP_009450940.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein isoform X2 [Pan troglodytes]  clstr ali  54 1184.CDCLNGGSCVSDRNFSGVYLCVCLPGFHGSLCEVDIS.. 1223
269 3.000e-08gi|564389724|ref|XP_003751671.2| PREDICTED: tissue-type plasminogen activator-like [Rattus norvegicus]  clstr ali  50  88...CFNGGTCQQALYFSD-FVCQCPDGFVGKRCDIDTRAT 123
270 3.000e-08gi|852730135|ref|XP_012881939.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Dipodomys ordii]  clstr ali  48  91...CFNAGTCWQALYFSD-FVCQCPEGFVGKRCEIDTRA. 125
271 3.000e-08gi|926531647|ref|XP_013815136.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Apteryx australis mantelli]  clstr ali  45 1161.CSCSNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 1200
272 3.000e-08gi|345781617|ref|XP_539955.3| PREDICTED: tissue-type plasminogen activator [Canis lupus familiaris]  clstr ali  50  92...CFNGGTCRQALYFAD-FVCQCPEGFLGKRCEIDAGAT 127
273 4.000e-08gi|852727684|ref|XP_012868532.1| PREDICTED: protein delta homolog 1 [Dipodomys ordii]  clstr ali  42  197..PCQHGGTCVDDEGRASHASCLCPPGFSGNFCEI..... 229
274 4.000e-08gi|762121051|ref|XP_011443441.1| PREDICTED: integrin beta-like protein A [Crassostrea gigas]  clstr ali  37  466.NPCENQATCNDLVNFFN---CTCLPGFTGDRCQIDINE. 500
275 4.000e-08gi|688609294|ref|XP_009294615.1| PREDICTED: neurocan core protein [Danio rerio]  clstr ali  42  994.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1026
276 4.000e-08gi|525027795|ref|XP_005061320.1| PREDICTED: versican core protein isoform X4 [Ficedula albicollis]  clstr ali  37 2351.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 2385
277 4.000e-08gi|1003995324|ref|XP_015742251.1| PREDICTED: neurocan core protein isoform X1 [Coturnix japonica]  clstr ali  43 1052..PCQNGGTCIDEV---NAFVCLCLPSYGGSRCEKDT... 1083
278 4.000e-08gi|973202792|ref|XP_015221289.1| PREDICTED: neurocan core protein [Lepisosteus oculatus]  clstr ali  43 1502..PCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1533
279 4.000e-08gi|727058938|ref|XP_010408164.1| PREDICTED: versican core protein isoform X3 [Corvus cornix cornix]  clstr ali  37 2375.NPCRNGATCIDGL---NTFTCLCLPSYVGALCEQDT-ET 2409
280 4.000e-08gi|641796653|ref|XP_008161681.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Chrysemys picta bellii]  clstr ali  45 1198.CDCLNGGSCVTNIHFSGKYLCVCLPGFEGDLCQVNFD.. 1237
281 4.000e-08gi|730046979|gb|AIZ07946.1| chimeric truncated tPA, partial [synthetic construct]  clstr ali  52  56...CFNGGTCQQALYFSD-FVCQCPEGFAGKCCEIDTRAT 91
282 4.000e-08gi|583995728|ref|XP_006792987.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Neolamprologus brichardi]  clstr ali  39 1178.CGCQNGGSCVTDINFSGKYLCVCPEGTQGELCADDIDE. 1218
283 4.000e-08gi|831213658|ref|XP_012666532.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Otolemur garnettii]  clstr ali  51 1182.CDCLNGGSCVSDIKFPGMYLCVCLPGFQGSLCEVD.... 1219
284 4.000e-08gi|908559250|ref|XP_005466557.2| PREDICTED: versican core protein-like [Oreochromis niloticus]  clstr ali  40  870.NPCRNGGTCVDGLA---SFTCVCLPSYAGLFCEEDT-ET 904
285 4.000e-08gi|831280056|ref|XP_012671039.1| PREDICTED: neurocan core protein [Clupea harengus]  clstr ali  42 1122.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1154
286 4.000e-08gi|585700002|ref|XP_006897052.1| PREDICTED: tissue-type plasminogen activator [Elephantulus edwardii]  clstr ali  50  88...CFNGGICWQAVYFSD-FVCQCPEGFFGKSCEIDAKAT 123
287 4.000e-08gi|926637784|ref|XP_013784884.1| PREDICTED: EGF, latrophilin seven transmembrane domain-containing protein 1-like [Limulus polyphemus]  clstr ali  47  250..PCHNGGTC---HNTSNQFTCQCSLGYGGEHCEVDVNE. 283
288 4.000e-08gi|507570942|ref|XP_004669074.1| PREDICTED: tissue-type plasminogen activator [Jaculus jaculus]  clstr ali  50  88...CFNGGTCWQALYFSD-FVCQCPDGFVGKRCDIDTGVT 123
289 4.000e-08gi|669287308|ref|XP_008636484.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Corvus brachyrhynchos]  clstr ali  43 1093.CSCLSGGTCVTNIKYPGEYLCLCPNGFDGEFCQEDTR.. 1132
290 4.000e-08gi|562823862|ref|XP_006141724.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Tupaia chinensis]  clstr ali  47  88...CFNGGACRQALYFSD-FVCQCPEGFVGKRCEVDTRAT 123
291 5.000e-08gi|260824241|ref|XP_002607076.1| hypothetical protein BRAFLDRAFT_68133 [Branchiostoma floridae]  clstr ali  35  444.NPCQHGGTCHDRI---NSYVCHCQSGYTGDNCET..... 474
292 5.000e-08gi|640785443|ref|XP_008048442.1| PREDICTED: protein delta homolog 1 [Tarsius syrichta]  clstr ali  42  206..PCQHGGTCVDDEGRASHASCLCPPGFSGNFCEI..... 238
293 5.000e-08gi|919099874|ref|XP_013386377.1| PREDICTED: cubilin-like, partial [Lingula anatina]  clstr ali  40  98.NPCQNGGTCVDLY---NGYTCRCPSAWQGTRCNEDVNE. 132
294 5.000e-08gi|829864210|ref|XP_012639837.1| PREDICTED: versican core protein isoform X2 [Microcebus murinus]  clstr ali  37 2150.NPCRNGATCIDGF---NTFRCLCLPSYVGALCEQDT-ET 2184
295 5.000e-08gi|955519407|ref|XP_004431485.2| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein, partial [Ceratotherium si  clstr ali  47 1192.CDCLNGGSCVSDVKFSGAYLCVCLPGFQSGLCEVDVTE. 1232
296 5.000e-08gi|831560620|ref|XP_012731439.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Fundulus heteroclitus]  clstr ali  43 1133.CGCLNAASCITNVNFPGEYICVCPDGFTGQRCEVDID.. 1172
297 6.000e-08gi|944210547|gb|KQK77370.1| hypothetical protein AAES_126968 [Amazona aestiva]  clstr ali  43  648..PCQNGGTCIDEV---NSFVCLCLPSYGGNRCEKDT... 679
298 6.000e-08gi|465961939|gb|EMP29546.1| Versican core protein [Chelonia mydas]  clstr ali  37 3419.NPCRNGATCIDGL---NLFTCLCLPSYVGALCEQDT-ET 3453
299 6.000e-08gi|635114531|ref|XP_007980216.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein isoform X1 [Chlorocebus sabaeus]  clstr ali  51 1271.CDCLNGGSCVSDRNFSGVYLCVCLPGFHGSLCEVNIS.. 1310
300 6.000e-08gi|831303676|ref|XP_012683947.1| PREDICTED: versican core protein-like [Clupea harengus]  clstr ali  45  485.NPCLNGGTCVDGL---NSYTCVCLPSYAGTLCEEDT... 517
301 6.000e-08gi|504165749|ref|XP_004592804.1| PREDICTED: tissue-type plasminogen activator [Ochotona princeps]  clstr ali  47  79...CLNGGTCWQAQHFSD-FVCQCPEGFVGKRCDVDTR.. 112
302 6.000e-08gi|208879564|gb|ACI31319.1| plasminogen activator [Diaemus youngi]  clstr ali  44  92...CFNGGTCWEALHFS-EFVCQCPERYTGKWCEVDTHAT 127
303 6.000e-08gi|831288588|ref|XP_012675700.1| PREDICTED: neurocan core protein-like [Clupea harengus]  clstr ali  45  265..PCLHGGTCL---PEGEGYGCFCPQGFSGESCEIDVD.. 297
304 7.000e-08gi|671027592|ref|XP_008704596.1| PREDICTED: versican core protein isoform X3 [Ursus maritimus]  clstr ali  40 1399.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 1433
305 7.000e-08gi|780026668|ref|XP_011666105.1| PREDICTED: mucin-19 isoform X10 [Strongylocentrotus purpuratus]  clstr ali  40  194..PCLNGGTCMN---TNGSYDCQCDRGWTGLNCET..... 223
306 7.000e-08gi|780026627|ref|XP_011666096.1| PREDICTED: mucin-19 isoform X1 [Strongylocentrotus purpuratus]  clstr ali  40  194..PCLNGGTCMN---TNGSYDCQCDRGWTGLNCET..... 223
307 7.000e-08gi|780026631|ref|XP_011666097.1| PREDICTED: mucin-19 isoform X2 [Strongylocentrotus purpuratus]  clstr ali  40  194..PCLNGGTCMN---TNGSYDCQCDRGWTGLNCET..... 223
308 7.000e-08gi|929255761|ref|XP_014004218.1| PREDICTED: neurocan core protein [Salmo salar]  clstr ali  42 1109.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1141
309 7.000e-08gi|927150983|ref|XP_013916170.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein, partial [Thamnophis sirtalis]  clstr ali  51 1140.CGCLNGGTCITNINFPGEYLCICPSEFEGDHCQ...... 1175
310 7.000e-08gi|926652907|ref|XP_013793033.1| PREDICTED: agrin-like, partial [Limulus polyphemus]  clstr ali  43  2..PCQNGGTCMAASEDS--YRCSCPLGYSGEQCE...... 31
311 8.000e-08gi|597778159|ref|XP_007252721.1| PREDICTED: neurocan core protein [Astyanax mexicanus]  clstr ali  43 1105..PCQNGGTCIDEI---NSYVCLCLPSYGGATCEKDT... 1136
312 8.000e-08gi|1008760145|ref|XP_015854455.1| PREDICTED: versican core protein isoform X4 [Peromyscus maniculatus bairdii]  clstr ali  40 1363.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 1397
313 8.000e-08gi|780026673|ref|XP_011666106.1| PREDICTED: mucin-19 isoform X11 [Strongylocentrotus purpuratus]  clstr ali  40  194..PCLNGGTCMN---TNGSYDCQCDRGWTGLNCET..... 223
314 8.000e-08gi|780026649|ref|XP_011666101.1| PREDICTED: mucin-19 isoform X6 [Strongylocentrotus purpuratus]  clstr ali  40  194..PCLNGGTCMN---TNGSYDCQCDRGWTGLNCET..... 223
315 8.000e-08gi|507535312|ref|XP_004651697.1| PREDICTED: versican core protein isoform X1 [Jaculus jaculus]  clstr ali  36 3116.NPCRNGATCIDGF---NTFRCLCLPSYVGALCEQDT... 3148
316 8.000e-08gi|929120257|ref|XP_014071753.1| PREDICTED: neurocan core protein-like [Salmo salar]  clstr ali  42 1098.NPCQNGGTCIDEI---NSFVCLCLPSYGGAACEKDT... 1130
317 8.000e-08gi|632936980|ref|XP_007896862.1| PREDICTED: urokinase-type plasminogen activator [Callorhinchus milii]  clstr ali  41  83.NKCFHGGRCASQLH-SEHYLCLCPAGYRGKHCEIDVD.. 118
318 9.000e-08gi|512813782|ref|XP_002935750.2| PREDICTED: versican core protein [Xenopus tropicalis]  clstr ali  36 3464.NPCRNGAACVDGI---NSFSCICLPSYAGSLCEQDT... 3496
319 9.000e-08gi|675622650|ref|XP_008939456.1| PREDICTED: versican core protein-like, partial [Merops nubicus]  clstr ali  37 3275.NPCRNGATCIDG---PNTFACLCLPSYVGALCEQDT-ET 3309
320 9.000e-08gi|585640453|ref|XP_006880440.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Elephantulus edwardii]  clstr ali  51 1184.CDCLNGGSCVSDINSSGGNLCVCLPGFQGDLCEVDIS.. 1223
321 9.000e-08gi|966710601|gb|KTG42839.1| hypothetical protein cypCar_00020642, partial [Cyprinus carpio]  clstr ali  42 1039.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1071
322 9.000e-08gi|465989184|gb|EMP37951.1| von Willebrand factor D and EGF domain-containing protein, partial [Chelonia mydas]  clstr ali  40 1166.CSCMNGGSCVTNINFPGEYLCICPSGFDGNFCQENIN.. 1205
323 1.000e-07gi|808860379|gb|KKF12387.1| Neurocan core protein [Larimichthys crocea]  clstr ali  42 1180.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1212
324 1.000e-07gi|405974833|gb|EKC39446.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  31  795.NPCQNSATCVDEV---NKYSCTCQPGYQGSQCETETNE. 829
325 1.000e-07gi|532055745|ref|XP_005370585.1| PREDICTED: neurocan core protein [Microtus ochrogaster]  clstr ali  43  995..PCENGGTCIDGV---NGFTCLCLPSYGGSLCEKDT... 1026
326 1.000e-07gi|663274091|ref|XP_008495951.1| PREDICTED: neurocan core protein [Calypte anna]  clstr ali  43  892..PCQNGGTCIDEV---NSFICLCLPSYGGSRCEKDT... 923
327 1.000e-07gi|826277102|ref|XP_012493928.1| PREDICTED: versican core protein isoform X3 [Propithecus coquereli]  clstr ali  37 1365.NPCRNGATCIDGF---NTFRCLCLPSYVGALCEQDT-ET 1399
328 1.000e-07gi|780026678|ref|XP_011666107.1| PREDICTED: mucin-2 isoform X12 [Strongylocentrotus purpuratus]  clstr ali  40  194..PCLNGGTCMN---TNGSYDCQCDRGWTGLNCET..... 223
329 1.000e-07gi|637260072|ref|XP_008101214.1| PREDICTED: versican core protein [Anolis carolinensis]  clstr ali  38 2901..PCRNGATCIDGV---NTFTCLCLPSYVGALCEKDT-ET 2934
330 1.000e-07gi|641759768|ref|XP_008165700.1| PREDICTED: versican core protein isoform X3 [Chrysemys picta bellii]  clstr ali  37 1369.NPCRNGATCIDGL---NLFTCLCLPSYAGALCEQDT-ET 1403
331 1.000e-07gi|359720333|gb|AEV54351.1| chondroitin sulfate proteoglycan 2 isoform 2 [Xenopus laevis]  clstr ali  33 3593.NPCRNGAACVDGI---DSFKCICLPSYTGSLCEQDT... 3625
332 1.000e-07gi|159024138|gb|ABW87311.1| chondroitin sulfate proteoglycan 2 variant V1a [Xenopus laevis]  clstr ali  33 2685.NPCRNGAACVDGI---DSFKCICLPSYTGSLCEQDT... 2717
333 1.000e-07gi|686757986|ref|XP_009251331.1| PREDICTED: neurocan core protein, partial [Pongo abelii]  clstr ali  43 1573..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1604
334 1.000e-07gi|699241980|ref|XP_009858422.1| PREDICTED: ficolin-2-like [Ciona intestinalis]  clstr ali  50  159..PCLNGGTCSR---GPNAYTCFCPLGYTGRNCEI..... 188
335 1.000e-07gi|498969091|ref|XP_004547069.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Maylandia zebra]  clstr ali  45  114...CYNGGTCKEAVYTSD-YICQCPRGFTGAQCEINTNE. 148
336 1.000e-07gi|537257598|gb|ERE89284.1| von Willebrand factor D and EGF domain-containing protein [Cricetulus griseus]  clstr ali  54 1273.CDCLNGGSCVSDRKFSGAYLCVCLPGFHGNLCEVDAS.. 1312
337 1.000e-07gi|260811932|ref|XP_002600675.1| hypothetical protein BRAFLDRAFT_67738 [Branchiostoma floridae]  clstr ali  50 3647.CDCHNGGTCDYNNTIERVNVCQCLPGFGGEHCEIDIDA. 3689
338 1.000e-07gi|585649367|ref|XP_006814375.1| PREDICTED: uncharacterized protein LOC102805267 [Saccoglossus kowalevskii]  clstr ali  41  113.NPCQNNGTCLEDY---GYYRCQCPYGFTGYDCETDIS.. 146
339 1.000e-07gi|405969700|gb|EKC34654.1| Deleted in malignant brain tumors 1 protein [Crassostrea gigas]  clstr ali  36  285.NPCQNAATCSRDYYYSTNYYCSCPRGYSGRNCE...... 317
340 1.000e-07gi|565313393|gb|ETE65746.1| von Willebrand factor D and EGF domain-containing protein, partial [Ophiophagus hannah]  clstr ali  51 1019.CGCLNGGTCITNINFPGEYLCICPSEFEGDHCQ...... 1054
341 1.000e-07gi|466083807|ref|XP_004285111.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Orcinus orca]  clstr ali  50  45...CFNRGTCWQALY-SSEFVCQCPEGFIGKRCEIDASAT 80
342 1.000e-07gi|611981376|ref|XP_007476457.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Monodelphis domestica]  clstr ali  48  87...CFNGGTCKQALYFPD-FICHCPRGFAGKQCEIDSNS. 121
343 1.000e-07gi|998496063|ref|XP_015523729.1| PREDICTED: low-density lipoprotein receptor-related protein 4 [Neodiprion lecontei]  clstr ali  54  182.CPCLNGGSCVASG------KCSCPKQFTGKQCEIDVDE. 214
344 2.000e-07gi|260836180|ref|XP_002613084.1| hypothetical protein BRAFLDRAFT_125704 [Branchiostoma floridae]  clstr ali  38  227..PCLNSAACQDNV---NYYTCDCTPGYRGVHCEEDIDE. 260
345 2.000e-07gi|585652617|ref|XP_006814952.1| PREDICTED: uncharacterized protein LOC102801595 [Saccoglossus kowalevskii]  clstr ali  43  653..PCQNGGTCTDLIA---AYKCNCTDGYNGTNCEI..... 682
346 2.000e-07gi|594058009|ref|XP_006053172.1| PREDICTED: versican core protein isoform X4 [Bubalus bubalis]  clstr ali  37 1383.NPCRNGATCIDGF---NTFRCLCLPSYVGALCEQDT-ET 1417
347 2.000e-07gi|560904688|ref|XP_006178703.1| PREDICTED: versican core protein isoform X3 [Camelus ferus]  clstr ali  40 1391.NPCRNGATCVDGF---NTFRCLCLPSYIGALCERDT-ET 1425
348 2.000e-07gi|1011571433|gb|KYO25658.1| neurocan core protein isoform A [Alligator mississippiensis]  clstr ali  43  726..PCQNGGTCIDEI---NSFVCLCLPSYGGSLCEKDT... 757
349 2.000e-07gi|1011571434|gb|KYO25659.1| neurocan core protein isoform B [Alligator mississippiensis]  clstr ali  43  787..PCQNGGTCIDEI---NSFVCLCLPSYGGSLCEKDT... 818
350 2.000e-07gi|632963651|ref|XP_007898000.1| PREDICTED: versican core protein [Callorhinchus milii]  clstr ali  39 2964.NPCRNGATCIDGI---NCFNCVCLPSYGGALCERDT... 2996
351 2.000e-07gi|1020482122|ref|XP_016146556.1| PREDICTED: neurocan core protein-like [Sinocyclocheilus grahami]  clstr ali  42  934.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 966
352 2.000e-07gi|768951690|ref|XP_011614805.1| PREDICTED: neurocan core protein-like [Takifugu rubripes]  clstr ali  37  871..PCENGGTCIDKI---DSFLCLCLPSYEGDRCEKDI... 902
353 2.000e-07gi|21431624|sp|Q9ERB4.2|CSPG2_RAT RecName: Full=Versican core protein; AltName: Full=Chondroitin sulfate proteoglycan core protein 2; Short=Chondroit  clstr ali  40 2476.NPCRNGATCVDGL---NTFRCLCLPSYVGALCEQDT-ET 2510
354 2.000e-07gi|640834304|ref|XP_008072858.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein-like [Tarsius syrichta]  clstr ali  43  857..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 888
355 2.000e-07gi|677990794|ref|XP_009075203.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Acanthisitta chloris]  clstr ali  47  559.CSCLNGGTCVTNIKYPGEYLCLCPNGFDGEFCQDDI... 597
356 2.000e-07gi|355560795|gb|EHH17481.1| von Willebrand factor D and EGF domain-containing protein, partial [Macaca mulatta]  clstr ali  51 1242.CDCLNGGSCVSDRNFSGVYLCVCLPGFHGSLCEVNTS.. 1281
357 2.000e-07gi|1007783216|ref|XP_015828615.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Nothobranchius furzeri]  clstr ali  48  113...CYNGGTCKEAVYSSD-YICQCPSGFSGAQCEINTSE. 147
358 2.000e-07gi|946616207|ref|XP_014424049.1| PREDICTED: tissue-type plasminogen activator [Pelodiscus sinensis]  clstr ali  40  83DQKCYNGGRCKQALYSPLHFICQCHAGFSGKHCEIDMEAT 122
359 2.000e-07gi|941798566|ref|XP_014327341.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Xiphophorus maculatus]  clstr ali  44 1169.CGCLNGGTCVTDVSFSGKYLCVCPEGKQGELCGKDMDQ. 1209
360 2.000e-07gi|602677601|ref|XP_007444246.1| PREDICTED: tissue-type plasminogen activator-like, partial [Python bivittatus]  clstr ali  46  90...CFNGGRCQQALYSPNFFICFCPPGFTGKYCEI..... 121
361 2.000e-07gi|345306462|ref|XP_003428469.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Ornithorhynchus anatinus]  clstr ali  48  84...CYNGGTCYQALYFSD-FICSCPSGFDGKQCEINVNA. 118
362 2.000e-07gi|929258365|ref|XP_014005571.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like isoform X1 [Salmo salar]  clstr ali  51 1215.CGCLNGGTCVTNVAFSGEYLCACPRGVGGVLCQEDID.. 1254
363 2.000e-07gi|354468247|ref|XP_003496578.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Cricetulus griseus]  clstr ali  54 1237.CDCLNGGSCVSDRKFSGAYLCVCLPGFHGNLCEVDAS.. 1276
364 3.000e-07gi|755879430|ref|XP_011293162.1| PREDICTED: protein eyes shut [Musca domestica]  clstr ali  37  485..PCQNGGMCVDKLA---SYVCACPMGYTGTNCEEEI... 516
365 3.000e-07gi|931605262|ref|XP_014198032.1| PREDICTED: neurocan core protein [Pan paniscus]  clstr ali  43 1028..PCENGGTCIDEV---NGFVCLCLPSYGGSFCEKDT... 1059
366 3.000e-07gi|655900774|ref|XP_008251641.1| PREDICTED: neurocan core protein [Oryctolagus cuniculus]  clstr ali  46 1168..PCENGGTCVDEV---NGFVCLCLPSYGGSLCEKDT... 1199
367 3.000e-07gi|56122258|gb|AAV74280.1| chondroitin sulfate proteoglycan 3 [Saimiri boliviensis]  clstr ali  43  930..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 961
368 3.000e-07gi|731492594|ref|XP_003413290.2| PREDICTED: neurocan core protein [Loxodonta africana]  clstr ali  43 1076..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1107
369 3.000e-07gi|634861215|ref|XP_007943679.1| PREDICTED: neurocan core protein [Orycteropus afer afer]  clstr ali  43 1077..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1108
370 3.000e-07gi|327290489|ref|XP_003229955.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Anolis carolinensis]  clstr ali  43 1059..PCQNGGTCIDEI---NAFVCLCLPSYGGNLCERDT... 1090
371 3.000e-07gi|507535316|ref|XP_004651699.1| PREDICTED: versican core protein isoform X3 [Jaculus jaculus]  clstr ali  36 1378.NPCRNGATCIDGF---NTFRCLCLPSYVGALCEQDT... 1410
372 3.000e-07gi|1709255|sp|P55066.1|NCAN_MOUSE RecName: Full=Neurocan core protein; AltName: Full=Chondroitin sulfate proteoglycan 3; Flags: Precursor  clstr ali  43 1006..PCENGGTCIDEV---NGFICLCLPSYGGSLCEKDT... 1037
373 3.000e-07gi|831518932|ref|XP_012716750.1| PREDICTED: versican core protein [Fundulus heteroclitus]  clstr ali  42  399.NPCHNGGTCVDSL---NSFTCVCLPSYSGLYCEEDT-ET 433
374 3.000e-07gi|1020507770|ref|XP_016092902.1| PREDICTED: neurocan core protein-like [Sinocyclocheilus grahami]  clstr ali  42 1093.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1125
375 3.000e-07gi|532059655|ref|XP_005315718.1| PREDICTED: versican core protein isoform X1 [Ictidomys tridecemlineatus]  clstr ali  40 3136.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 3170
376 3.000e-07gi|984123179|ref|XP_015353353.1| PREDICTED: versican core protein isoform X1 [Marmota marmota marmota]  clstr ali  40 2139.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 2173
377 3.000e-07gi|431907884|gb|ELK11491.1| Versican core protein [Pteropus alecto]  clstr ali  40 3082.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 3116
378 3.000e-07gi|148668663|gb|EDL00982.1| mCG116562, isoform CRA_b, partial [Mus musculus]  clstr ali  40 3151.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 3185
379 3.000e-07gi|667286264|ref|XP_008576087.1| PREDICTED: versican core protein isoform X3 [Galeopterus variegatus]  clstr ali  40 3142.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 3176
380 3.000e-07gi|478492167|ref|XP_004420448.1| PREDICTED: versican core protein isoform X1 [Ceratotherium simum simum]  clstr ali  37 3138.NPCRNGATCIDGF---NTFRCLCLPSYVGALCEQD-NET 3172
381 3.000e-07gi|674087306|ref|XP_008851510.1| PREDICTED: versican core protein isoform X1 [Nannospalax galili]  clstr ali  40 3134.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 3168
382 3.000e-07gi|593721994|ref|XP_007107224.1| PREDICTED: versican core protein isoform X1 [Physeter catodon]  clstr ali  40 3134.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 3168
383 3.000e-07gi|330340395|ref|NP_001193358.1| versican core protein precursor [Sus scrofa]  clstr ali  40 3120.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 3154
384 3.000e-07gi|562827883|ref|XP_006143545.1| PREDICTED: versican core protein isoform X2 [Tupaia chinensis]  clstr ali  40 3114.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 3148
385 3.000e-07gi|731244733|ref|XP_010635510.1| PREDICTED: versican core protein [Fukomys damarensis]  clstr ali  40 3114.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 3148
386 3.000e-07gi|402872034|ref|XP_003899948.1| PREDICTED: LOW QUALITY PROTEIN: versican core protein [Papio anubis]  clstr ali  40 3062.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 3096
387 3.000e-07gi|507934504|ref|XP_004678485.1| PREDICTED: versican core protein [Condylura cristata]  clstr ali  40 2982.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 3016
388 3.000e-07gi|316980676|dbj|BAJ51987.1| green fluorescnet protein-PG-M/versican (V1) fusion protein [Cloning vector pInSRT-GFPV1]  clstr ali  40 2409.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 2443
389 3.000e-07gi|602732749|ref|XP_007451766.1| PREDICTED: versican core protein isoform X2 [Lipotes vexillifer]  clstr ali  40 2139.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 2173
390 3.000e-07gi|348587520|ref|XP_003479515.1| PREDICTED: LOW QUALITY PROTEIN: versican core protein [Cavia porcellus]  clstr ali  40 3089.NPCRNGATCVDGF---NTFRCLCLPSYIGALCEQDT-ET 3123
391 3.000e-07gi|260819590|ref|XP_002605119.1| hypothetical protein BRAFLDRAFT_84207 [Branchiostoma floridae]  clstr ali  35 1261.CECENGGSCVTYPAGSGMYMCVCPPGYQGERCQDNVD.. 1300
392 3.000e-07gi|586458540|ref|XP_006859989.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Chrysochloris asiatica]  clstr ali  42  45...CFNGGICRQALYFPD-FVCQCPEGYMGKRCEIDAKA. 79
393 3.000e-07gi|548339759|ref|XP_005722472.1| PREDICTED: versican core protein [Pundamilia nyererei]  clstr ali  42  378...CLNGGSCLR---IGSTYTCHCAPGFSGHQCEIDIDE. 410
394 3.000e-07gi|929280159|ref|XP_014016949.1| PREDICTED: tissue-type plasminogen activator-like isoform X1 [Salmo salar]  clstr ali  45  113...CYNGGTCKEAVY-SADYLCQCPPGFTGAQCEINTTE. 147
395 3.000e-07gi|847110146|ref|XP_012814580.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Xenopus tropicalis]  clstr ali  50  124...CYNGGRCQQAVY-STHHLCRCPSGFKGEHCETDTKET 159
396 3.000e-07gi|645026521|ref|XP_008214058.1| PREDICTED: uncharacterized protein LOC100119261 [Nasonia vitripennis]  clstr ali  48  252..PCQNGGVC------SSPGRCTCPKGFTGNYCQIDVDE. 282
397 4.000e-07gi|984107475|ref|XP_015345098.1| PREDICTED: neurocan core protein [Marmota marmota marmota]  clstr ali  43 1053..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1084
398 4.000e-07gi|471404796|ref|XP_004384417.1| PREDICTED: neurocan core protein [Trichechus manatus latirostris]  clstr ali  43 1018..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1049
399 4.000e-07gi|795435114|ref|XP_011949932.1| PREDICTED: neurocan core protein isoform X1 [Cercocebus atys]  clstr ali  43 1083..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1114
400 4.000e-07gi|914917874|ref|XP_013217323.1| PREDICTED: neurocan core protein [Ictidomys tridecemlineatus]  clstr ali  43 1073..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1104
401 4.000e-07gi|513024541|ref|XP_004873483.1| PREDICTED: neurocan core protein [Heterocephalus glaber]  clstr ali  43 1042..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1073
402 4.000e-07gi|677608344|ref|XP_009068154.1| PREDICTED: LOW QUALITY PROTEIN: versican core protein-like, partial [Acanthisitta chloris]  clstr ali  36 1868.NPCRNGATCIDGL---NTFTCLCLPSYIGALCE...... 1897
403 4.000e-07gi|405958595|gb|EKC24707.1| Deleted in malignant brain tumors 1 protein [Crassostrea gigas]  clstr ali  37  321HNPCNNGGTCYHNYGYPGYY-CTCPSGYSGRNC....... 352
404 4.000e-07gi|829935400|ref|XP_012596867.1| PREDICTED: neurocan core protein [Microcebus murinus]  clstr ali  43 1046..PCENGGTCIDEV---NGFVCLCLPSYGGTLCEKDT... 1077
405 4.000e-07gi|831491109|ref|XP_012707139.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Fundulus heteroclitus]  clstr ali  42 1168.CGCLNGGSCVTDVAFSGKYLCVCPEGKRGELCDEDVDQ. 1208
406 4.000e-07gi|332241010|ref|XP_003269681.1| PREDICTED: tissue-type plasminogen activator isoform X3 [Nomascus leucogenys]  clstr ali  54  91...CFNGGTCQQALYFSD-FVCQCPEGFAGKCCEI..... 121
407 4.000e-07gi|344238919|gb|EGV95022.1| Salivary plasminogen activator alpha 2 [Cricetulus griseus]  clstr ali  47  291...CFNGGACQQALYFSD-FVCQCPDGFVGKRCDIDTRAT 326
408 4.000e-07gi|831531175|ref|XP_012721093.1| PREDICTED: tissue-type plasminogen activator isoform X3 [Fundulus heteroclitus]  clstr ali  45  42...CYNGGTCKEAVYSSD-YICQCPAGFSGAQCEINTNE. 76
409 4.000e-07gi|1004399591|gb|KYB27321.1| Neural-cadherin-like Protein [Tribolium castaneum]  clstr ali  36 2585..PCINGGLCKDYEP-PKRYECSCPSGYTGGHCELE.... 2617
410 5.000e-07gi|30580855|sp|Q28858.1|CSPG2_MACNE RecName: Full=Versican core protein; AltName: Full=Chondroitin sulfate proteoglycan core protein 2; Short=Chondro  clstr ali  37  763.NPCRNGATCADGF---NTFRCLCLPSYVGALCEQDI-ET 797
411 5.000e-07gi|795435125|ref|XP_011949935.1| PREDICTED: neurocan core protein isoform X4 [Cercocebus atys]  clstr ali  43 1015..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1046
412 5.000e-07gi|524972710|ref|XP_005086204.1| PREDICTED: neurocan core protein [Mesocricetus auratus]  clstr ali  43 1006..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1037
413 5.000e-07gi|585186286|ref|XP_006744636.1| PREDICTED: neurocan core protein [Leptonychotes weddellii]  clstr ali  43 1079..PCKNGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1110
414 5.000e-07gi|586482595|ref|XP_006871809.1| PREDICTED: neurocan core protein, partial [Chrysochloris asiatica]  clstr ali  43 1026..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1057
415 5.000e-07gi|465951085|gb|EMP24104.1| Neurocan core protein [Chelonia mydas]  clstr ali  40 1308..PCQNGGTCIDEI---NSFVCLCLPSYGDSLCEKDT... 1339
416 5.000e-07gi|641771429|ref|XP_008169767.1| PREDICTED: neurocan core protein [Chrysemys picta bellii]  clstr ali  40 1409..PCQNGGTCIDEI---NSFVCLCLPSYGDSLCEKDT... 1440
417 5.000e-07gi|586480267|ref|XP_006870659.1| PREDICTED: versican core protein isoform X1 [Chrysochloris asiatica]  clstr ali  40 3119.NPCRNGATCVDGF---NTFTCLCLPSYIGALCEQDT-ET 3153
418 5.000e-07gi|395825586|ref|XP_003786008.1| PREDICTED: versican core protein isoform X1 [Otolemur garnettii]  clstr ali  37 3091.NPCRNGATCIDGF---NTFRCLCLPSYVGALCEQDT-ET 3125
419 5.000e-07gi|817324647|ref|XP_012333024.1| PREDICTED: versican core protein isoform X1 [Aotus nancymaae]  clstr ali  40 3153.NPCRNGATCVDGF---NTFRCLCLPSYVGALCERDT-ET 3187
420 5.000e-07gi|640802839|ref|XP_008057762.1| PREDICTED: versican core protein isoform X1 [Tarsius syrichta]  clstr ali  37 3133.NPCRNGATCIDGF---NTFRCLCLPSYVGALCEQDT-ET 3167
421 5.000e-07gi|488596647|ref|XP_004483499.1| PREDICTED: versican core protein [Dasypus novemcinctus]  clstr ali  40 3108.NPCRNGATCVDGF---NTFRCLCLPSYVGALCERDT-ET 3142
422 5.000e-07gi|617548474|ref|XP_007518883.1| PREDICTED: versican core protein isoform X1 [Erinaceus europaeus]  clstr ali  37 3028.NPCRNGATCIDGF---NTFRCLCLPSYVGALCEQDT-ET 3062
423 5.000e-07gi|545185442|ref|XP_005599641.1| PREDICTED: versican core protein isoform X2 [Equus caballus]  clstr ali  37 2141.NPCRNGATCIDGF---NTFRCLCLPSYIGALCEQDT-ET 2175
424 5.000e-07gi|542179783|ref|XP_005495991.1| PREDICTED: tissue-type plasminogen activator [Zonotrichia albicollis]  clstr ali  38  89.NKCYNGGRCSQAYYSPQLFVCQCHPGFSGKQCEIDT... 124
425 5.000e-07gi|1004399590|gb|KYB27320.1| Neural-cadherin-like Protein [Tribolium castaneum]  clstr ali  36 2530..PCINGGLCKDYEP-PKRYECSCPSGYTGGHCELE.... 2562
426 6.000e-07gi|585643771|ref|XP_006811418.1| PREDICTED: mucin-2-like, partial [Saccoglossus kowalevskii]  clstr ali  42  53.NPCQNGGTCENMI---NQYVCGCTSGFSGNSCEIDARE. 87
427 6.000e-07gi|694973757|ref|XP_009433315.1| PREDICTED: neurocan core protein isoform X2 [Pan troglodytes]  clstr ali  43  920..PCENGGTCIDEV---NGFVCLCLPSYGGSFCEKDT... 951
428 6.000e-07gi|817346836|ref|XP_012298899.1| PREDICTED: neurocan core protein [Aotus nancymaae]  clstr ali  43  717..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 748
429 6.000e-07gi|970705238|ref|XP_015090477.1| PREDICTED: neurocan core protein [Vicugna pacos]  clstr ali  40 1099..PCENGGTCIDEV---NAFVCLCLPSYAGSLCEKDT... 1130
430 6.000e-07gi|743751319|ref|XP_010970499.1| PREDICTED: neurocan core protein [Camelus bactrianus]  clstr ali  40 1078..PCENGGTCIDEV---NAFVCLCLPSYAGSLCEKDT... 1109
431 6.000e-07gi|585659430|ref|XP_006886026.1| PREDICTED: neurocan core protein [Elephantulus edwardii]  clstr ali  43 1122..PCENGGTCIDEV---NGFVCLCLPSYGGNLCEKDT... 1153
432 6.000e-07gi|532059657|ref|XP_005315719.1| PREDICTED: versican core protein isoform X2 [Ictidomys tridecemlineatus]  clstr ali  40 1389.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 1423
433 6.000e-07gi|344272704|ref|XP_003408171.1| PREDICTED: versican core protein isoform X1 [Loxodonta africana]  clstr ali  40 3125.NPCRNGATCVDGF---NTFTCLCLPSYVGALCEQDT-ET 3159
434 6.000e-07gi|850286392|ref|XP_012860350.1| PREDICTED: versican core protein [Echinops telfairi]  clstr ali  37 3129.NPCRNGATCIDGL---NTFSCLCLPSYVGALCEQDT-ET 3163
435 6.000e-07gi|585673837|ref|XP_006889930.1| PREDICTED: versican core protein precursor isoform X1 [Elephantulus edwardii]  clstr ali  40 3095.NPCRNGATCVDGF---NTFTCLCLPSYVGALCEQDT-ET 3129
436 6.000e-07gi|821113213|ref|XP_004485076.2| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Dasypus novemcinctus]  clstr ali  52 1008.CDCLNGGSCVSDIKFSGAYLCVCLPGFWGGLCEV..... 1044
437 6.000e-07gi|966933815|ref|XP_014989496.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein, partial [Macaca mulatta]  clstr ali  51 1182.CDCLNGGSCVSDRNFSGVYLCVCLPGFHGSLCEVNTS.. 1221
438 7.000e-07gi|929379857|ref|XP_014100282.1| PREDICTED: protein eyes shut-like, partial [Bactrocera oleae]  clstr ali  37  94..PCQNGGVCVDKLA---SYVCACPMGYTGNNCEEEI... 125
439 7.000e-07gi|344241310|gb|EGV97413.1| Neurocan core protein [Cricetulus griseus]  clstr ali  43  972..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1003
440 7.000e-07gi|507710503|ref|XP_004646932.1| PREDICTED: neurocan core protein [Octodon degus]  clstr ali  43 1051..PCENGGTCIDEV---NSFVCLCLPSYGGSLCEKDT... 1082
441 7.000e-07gi|926694776|ref|XP_013820359.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Capra hircus]  clstr ali  43 1029..PCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 1060
442 7.000e-07gi|1012280112|ref|XP_015987902.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Rousettus aegyptiacus]  clstr ali  43 1091..PCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 1122
443 7.000e-07gi|759139131|ref|XP_011365016.1| PREDICTED: neurocan core protein [Pteropus vampyrus]  clstr ali  43 1073..PCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 1104
444 7.000e-07gi|664759833|ref|XP_008537493.1| PREDICTED: neurocan core protein [Equus przewalskii]  clstr ali  43 1049..PCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 1080
445 7.000e-07gi|826321428|ref|XP_012509554.1| PREDICTED: neurocan core protein [Propithecus coquereli]  clstr ali  43 1048..PCENGGTCIDEV---NGFVCLCLPSYGGTLCEKDT... 1079
446 7.000e-07gi|551530093|ref|XP_005816505.1| PREDICTED: versican core protein-like, partial [Xiphophorus maculatus]  clstr ali  43  533..PCENGGTCVDKI---DSFLCLCLPSYGGDTCEKDV... 564
447 7.000e-07gi|667262435|ref|XP_008567951.1| PREDICTED: neurocan core protein [Galeopterus variegatus]  clstr ali  43 1072..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1103
448 7.000e-07gi|674087308|ref|XP_008851511.1| PREDICTED: versican core protein isoform X2 [Nannospalax galili]  clstr ali  40 1390.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 1424
449 7.000e-07gi|505839401|ref|XP_004613227.1| PREDICTED: versican core protein isoform X1 [Sorex araneus]  clstr ali  37 2112.NPCRNGATCIDGF---NTFRCLCLPSYVGALCEQDT-ET 2146
450 7.000e-07gi|987423315|ref|XP_015398319.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1-like [Panthera tigris altaica]  clstr ali  60  531...CQNGGTCVSR---WNTYVCECPLRFGGKNCE...... 558
451 7.000e-07gi|930230039|ref|XP_014167834.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein-like [Geospiza fortis]  clstr ali  43 1108.CSCLSGGTCVTNIKYPGEYLCLCPNGFDGEFCQEDVR.. 1147
452 7.000e-07gi|795077287|ref|XP_011847929.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Mandrillus leucophaeus]  clstr ali  48 1219.CDCLNGGSCVSDRNFPGVYLCVCLPGFHGSLCEVNTS.. 1258
453 8.000e-07gi|555972697|ref|XP_005898350.1| PREDICTED: neurocan core protein [Bos mutus]  clstr ali  43 1080..PCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 1111
454 8.000e-07gi|511882078|ref|XP_004760925.1| PREDICTED: neurocan core protein isoform X1 [Mustela putorius furo]  clstr ali  43 1119..PCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1150
455 8.000e-07gi|1002572871|ref|XP_015688044.1| PREDICTED: versican core protein [Protobothrops mucrosquamatus]  clstr ali  35 2852..PCRNGATCIDGVST---FTCLCLPSYVGALCEKDT-ET 2885
456 8.000e-07gi|281604094|ref|NP_001164031.1| versican core protein isoform 3 precursor [Rattus norvegicus]  clstr ali  40 1359.NPCRNGATCVDGL---NTFRCLCLPSYVGALCEQDT-ET 1393
457 8.000e-07gi|471414722|ref|XP_004388895.1| PREDICTED: versican core protein isoform X1 [Trichechus manatus latirostris]  clstr ali  37 3144.NPCRNGATCIDGF---NTFTCLCLPSYVGALCEQDT-ET 3178
458 8.000e-07gi|752887719|ref|XP_011261745.1| PREDICTED: protein eyes shut [Camponotus floridanus]  clstr ali  50  73NHPCLNNGTCVDYDGI----ICQCPEGYSGDYCEIDAS.. 106
459 8.000e-07gi|973192838|ref|XP_015219956.1| PREDICTED: coagulation factor VII [Lepisosteus oculatus]  clstr ali  38  134.NPCQNNGTCVNSQ---DAYTCFCPEGFNGRNCEEAIEDT 169
460 8.000e-07gi|765146972|ref|XP_011484231.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Oryzias latipes]  clstr ali  43  882.CDCLNGARCVPDASIPAGFRCACPEGFTGRRCEADAD.. 918
461 8.000e-07gi|974060116|ref|XP_015227189.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like isoform X1 [Cyprinodon variegatus]  clstr ali  43 1154.CGCLNGGTCVTDVSFSGKYLCVCPEGKQGKFCGEEVD.. 1193
462 9.000e-07gi|533193837|ref|XP_005409679.1| PREDICTED: neurocan core protein [Chinchilla lanigera]  clstr ali  43 1046..PCENGGTCIDEV---NSFVCLCLPSYGGSLCEKDT... 1077
463 9.000e-07gi|987415087|ref|XP_015395836.1| PREDICTED: neurocan core protein [Panthera tigris altaica]  clstr ali  43 1019..PCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1050
464 9.000e-07gi|521030642|gb|EPQ12428.1| Neurocan core protein [Myotis brandtii]  clstr ali  43  992..PCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 1023
465 9.000e-07gi|830088057|ref|XP_012584590.1| PREDICTED: neurocan core protein isoform X1 [Condylura cristata]  clstr ali  43 1071..PCENGGTCIDEI---NAFICLCLPSYGGSLCEKDT... 1102
466 9.000e-07gi|884885136|ref|XP_013002862.1| PREDICTED: neurocan core protein [Cavia porcellus]  clstr ali  43 1066..PCENGGTCIDEV---NSFVCLCLPSYGGNLCEKDT... 1097
467 9.000e-07gi|992221424|ref|XP_015463302.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Astyanax mexicanus]  clstr ali  43 1147.CGCMNGGTCVTNVERPGEYLCVCPSGFGGDLCQEETD.. 1186
468 9.000e-07gi|972948885|ref|XP_015197397.1| PREDICTED: tissue-type plasminogen activator [Lepisosteus oculatus]  clstr ali  45  86...CYNGGTCKEAVYSSD-FICQCPPGFTGPQCEINTTE. 120
469 9.000e-07gi|664706335|ref|XP_008504968.1| PREDICTED: hyaluronan-binding protein 2 isoform X2 [Equus przewalskii]  clstr ali  41  116.NPCQNGGTCSRHRRRSK-FICTCPDGFQGRLCEIGSD.. 151
470 1.000e-06gi|919012252|ref|XP_013390582.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Lingula anatina]  clstr ali  36 1195..PCENGGICTDGV---NSYTCSCPPGFSGPNCGQNID.. 1227
471 1.000e-06gi|1007745147|ref|XP_015812622.1| PREDICTED: neurocan core protein-like [Nothobranchius furzeri]  clstr ali  40 1042..PCENGGTCIDKI---DSFLCLCLPSYGGDTCEKDI... 1073
472 1.000e-06gi|940761536|ref|XP_014321325.1| PREDICTED: neurocan core protein isoform X1 [Myotis lucifugus]  clstr ali  43 1090..PCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 1121
473 1.000e-06gi|545534045|ref|XP_005632716.1| PREDICTED: neurocan core protein isoform X2 [Canis lupus familiaris]  clstr ali  43  982..PCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1013
474 1.000e-06gi|955499560|ref|XP_014637186.1| PREDICTED: neurocan core protein [Ceratotherium simum simum]  clstr ali  43 1098..PCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1129
475 1.000e-06gi|671023147|ref|XP_008702389.1| PREDICTED: neurocan core protein [Ursus maritimus]  clstr ali  43  995..PCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1026
476 1.000e-06gi|504172493|ref|XP_004595823.1| PREDICTED: neurocan core protein [Ochotona princeps]  clstr ali  43  984..PCENGGTCIDEV---NGFVCLCLPSYGGSQCEKDT... 1015
477 1.000e-06gi|847033335|ref|XP_012805967.1| PREDICTED: neurocan core protein [Jaculus jaculus]  clstr ali  43  955..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 986
478 1.000e-06gi|562827881|ref|XP_006143544.1| PREDICTED: versican core protein isoform X1 [Tupaia chinensis]  clstr ali  40 1377.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 1411
479 1.000e-06gi|640802843|ref|XP_008057764.1| PREDICTED: versican core protein isoform X3 [Tarsius syrichta]  clstr ali  37 1381.NPCRNGATCIDGF---NTFRCLCLPSYVGALCEQDT-ET 1415
480 1.000e-06gi|987974843|ref|XP_015413192.1| PREDICTED: neurocan core protein [Myotis davidii]  clstr ali  43 1027..PCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 1058
481 1.000e-06gi|982929505|ref|XP_015327358.1| PREDICTED: neurocan core protein isoform X1 [Bos taurus]  clstr ali  43 1118..PCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 1149
482 1.000e-06gi|634875255|ref|XP_007948735.1| PREDICTED: versican core protein isoform X1 [Orycteropus afer afer]  clstr ali  37 3136.NPCRNGATCIDGF---NTFTCLCLPSYVGALCERDT-ET 3170
483 1.000e-06gi|1011561364|gb|KYO18069.1| von Willebrand factor D and EGF domain-containing protein precursor [Alligator mississippiensis]  clstr ali  41 1182.CSCMHGGTCVTNINFPGEYLCICPNGFDGELCQENI... 1220
484 1.000e-06gi|727016059|ref|XP_010397407.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Corvus cornix cornix]  clstr ali  45 1126.CDCLNNGSCVTNINFSGRYLCVCVAGFEGDLCEVNTD.. 1165
485 1.000e-06gi|951534358|ref|XP_014470812.1| PREDICTED: protein eyes shut-like [Dinoponera quadriceps]  clstr ali  52  93NHPCLNNGTCVDDDGF----ICQCPDGYSGDYCEIDAS.. 126
486 1.000e-06gi|972185779|ref|XP_015174399.1| PREDICTED: protein eyes shut [Polistes dominula]  clstr ali  50  118NQPCLNNGTCLDYDGF----ICQCPDGYSGDYCEIDAS.. 151
487 1.000e-06gi|1020520379|ref|XP_016099578.1| PREDICTED: tissue-type plasminogen activator-like [Sinocyclocheilus grahami]  clstr ali  48  88...CYNGGTCKEAVY-SNDFICLCPPGFTGTQCEINTAE. 122
488 1.000e-06gi|556949778|ref|XP_005987458.1| PREDICTED: epidermal growth factor-like protein 7 isoform X1 [Latimeria chalumnae]  clstr ali  45  111..PCQNGGTC------SKPNRCDCPPGWNGKHCQTDVDE. 141
489 1.000e-06gi|808870587|gb|KKF20408.1| Zonadhesin [Larimichthys crocea]  clstr ali  44 2785..PCLNGGTC--KEGSNNTYTCQCPEGFEGKACEVEITQT 2820
490 1.000e-06gi|556769916|ref|XP_005980158.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Pantholops hodgsonii]  clstr ali  50  798.CDCLNGGSCVSDTKFSGAHLCVCLPGFHGDLCEKNVTE. 838
491 1.000e-06gi|564263491|ref|XP_006270607.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Alligator mississippiensis]  clstr ali  41  904.CSCMHGGTCVTNINFPGEYLCICPNGFDGELCQENI... 942
492 1.000e-06gi|944214188|gb|KQK80754.1| von Willebrand factor D and EGF [Amazona aestiva]  clstr ali  43 1049.CDCLNNGSCVTNINFSGRYLCVCVSGFEGDLCQVNTD.. 1088
493 1.000e-06gi|591365353|ref|XP_007057545.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Chelonia mydas]  clstr ali  40  876.CSCMNGGSCVTNINFPGEYLCICPSGFDGNFCQENIN.. 915
494 1.000e-06gi|913509827|ref|XP_013207885.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Microtus ochrogaster]  clstr ali  50 1172.CDCLNGGSCESDRKFSGAYLCVCLPGFHGRLCEVDA... 1210
495 1.000e-06gi|954554756|ref|XP_014600919.1| PREDICTED: protein eyes shut isoform X1 [Polistes canadensis]  clstr ali  50  118NQPCLNNGTCLDYDGF----ICQCPDGYSGDYCEIDAS.. 151
496 1.000e-06gi|641766290|ref|XP_008167998.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Chrysemys picta bellii]  clstr ali  40  788.CSCMNGGSCVTNINFPGEYLCICPNGFDGNFCQENIN.. 827
497 1.000e-06gi|637249575|ref|XP_008111251.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Anolis carolinensis]  clstr ali  51  171.CGCLNGGTCITNVNFPGKYLCICPNEFEGEHCQ...... 206
498 1.000e-06gi|568257236|gb|ETN65566.1| hypothetical protein AND_002660 [Anopheles darlingi]  clstr ali  39  90..PCQNGGRCRDYNP-PRRYECICPLGFTGAHCELE.... 122
499 1.000e-06gi|543377105|ref|XP_005531758.1| PREDICTED: neurocan core protein [Pseudopodoces humilis]  clstr ali  40 1144DCPCQNGGTCIDEV---NSFVCLCLPSYGGSRCEKDT... 1180
500 2.000e-06gi|260817936|ref|XP_002603841.1| hypothetical protein BRAFLDRAFT_101343 [Branchiostoma floridae]  clstr ali  46  624..PCQNGGQCQDG---DNSYTCDCPDGFLGERCEI..... 653
501 2.000e-06gi|316980673|dbj|BAJ51985.1| green fluorescnet protein-PG-M/versican (V3) fusion protein [Cloning vector pInSRT-GFPV3]  clstr ali  40  655.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 689
502 2.000e-06gi|779986051|ref|XP_011679776.1| PREDICTED: receptor-type tyrosine-protein phosphatase delta [Strongylocentrotus purpuratus]  clstr ali  40  71..PCKNNGTCFDA---TNYYNCTCLPGFIGTYCET..... 100
503 2.000e-06gi|657552193|ref|XP_008280457.1| PREDICTED: neurocan core protein-like [Stegastes partitus]  clstr ali  40  996..PCENGGTCIDKI---DSFLCLCLPSYGGDTCEKDI... 1027
504 2.000e-06gi|961000489|ref|XP_014816003.1| PREDICTED: versican core protein isoform X2 [Calidris pugnax]  clstr ali  37  531.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 565
505 2.000e-06gi|431922043|gb|ELK19216.1| Neurocan core protein [Pteropus alecto]  clstr ali  43  778..PCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 809
506 2.000e-06gi|953882651|ref|XP_014590320.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Equus caballus]  clstr ali  43  892..PCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 923
507 2.000e-06gi|821466785|ref|XP_012397589.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Sarcophilus harrisii]  clstr ali  43 1096..PCLNGGTCIDEV---NSFICLCLPSYGGSLCDKDT... 1127
508 2.000e-06gi|1004677901|ref|XP_015743871.1| PREDICTED: versican core protein [Python bivittatus]  clstr ali  35 2117..PCRNGATCIDGVST---FTCLCLPSYVGALCEKDT-ET 2150
509 2.000e-06gi|762071663|ref|XP_011426214.1| PREDICTED: deleted in malignant brain tumors 1 protein-like [Crassostrea gigas]  clstr ali  45  428...CYNGGTCIAYNNGYPGYYCNCPSGFTGLHCQ...... 458
510 2.000e-06gi|562835694|ref|XP_006147156.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Tupaia chinensis]  clstr ali  43 1079..PCDNGGTCIDQV---NGFVCLCLPSYGGSLCEKDT... 1110
511 2.000e-06gi|731271334|ref|XP_010604853.1| PREDICTED: neurocan core protein [Fukomys damarensis]  clstr ali  43 1158..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1189
512 2.000e-06gi|586480271|ref|XP_006870661.1| PREDICTED: versican core protein isoform X3 [Chrysochloris asiatica]  clstr ali  40 1386.NPCRNGATCVDGF---NTFTCLCLPSYIGALCEQDT-ET 1420
513 2.000e-06gi|585673845|ref|XP_006889932.1| PREDICTED: versican core protein precursor isoform X3 [Elephantulus edwardii]  clstr ali  40 1361.NPCRNGATCVDGF---NTFTCLCLPSYVGALCEQDT-ET 1395
514 2.000e-06gi|817324655|ref|XP_012333028.1| PREDICTED: versican core protein isoform X5 [Aotus nancymaae]  clstr ali  40 1382.NPCRNGATCVDGF---NTFRCLCLPSYVGALCERDT-ET 1416
515 2.000e-06gi|929755176|ref|XP_014152570.1| hypothetical protein SARC_08905, partial [Sphaeroforma arctica JP610]  clstr ali  46  268..PCLNGGTCQSSSINSTAYTCECPEGYVGTNCE...... 299
516 2.000e-06gi|338716565|ref|XP_001916629.2| PREDICTED: LOW QUALITY PROTEIN: hyaluronan-binding protein 2 [Equus caballus]  clstr ali  41  155.NPCQNGGTCSRHRRRSK-FICTCPDGFQGRLCEIGSD.. 190
517 2.000e-06gi|974099101|ref|XP_015248179.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Cyprinodon variegatus]  clstr ali  43 1148.CDCLNMASCITNRIFSGEYVCVCPDGFTGRRCDVDID.. 1187
518 2.000e-06gi|529421617|ref|XP_005230664.1| PREDICTED: protein delta homolog 1 [Falco peregrinus]  clstr ali  41  223..PCQNGGTCIDDNGFAPHASCLCPSGFAGNFCELDRD.. 258
519 2.000e-06gi|719737171|ref|XP_010226194.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Tinamus guttatus]  clstr ali  42 1165.CDCLNNGSCVTNVNFSGRYLCACVPGFEGDLCQVNADE. 1205
520 2.000e-06gi|672018235|ref|XP_008773934.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Rattus norvegicus]  clstr ali  45 1168.CDCLNGGSCVTDRKFPGAYLCDCLPGFSGDLCEVEAS.. 1207
521 2.000e-06gi|999980513|gb|KXJ19687.1| Oncoprotein-induced transcript 3 protein [Exaiptasia pallida]  clstr ali  41 1070.CSCSNGGTC---YTTPSGYRCSCPRGYTGKNC....... 1098
522 2.000e-06gi|959077986|ref|XP_014742658.1| PREDICTED: neurocan core protein [Sturnus vulgaris]  clstr ali  43 1051..PCQNGGTCIDEI---NSFVCLCLPSYGGSRCEKDT... 1082
523 2.000e-06gi|998744016|ref|XP_015471493.1| PREDICTED: neurocan core protein isoform X1 [Parus major]  clstr ali  43 1112..PCQNGGTCIDEV---NSFVCLCLPSYGGSRCEKDT... 1143
524 2.000e-06gi|939310069|ref|XP_012772836.2| PREDICTED: versican core protein [Maylandia zebra]  clstr ali  39 2665.NPCRNGGTCVDGL---SSFTCVCLPSYAGLFCEEDT... 2697
525 3.000e-06gi|919000082|ref|XP_013402401.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC106168022 [Lingula anatina]  clstr ali  32  89..PCQNNGQCVDGTFCNATYECQCQSGFTGINCEINIDE. 134
526 3.000e-06gi|795435135|ref|XP_011949937.1| PREDICTED: neurocan core protein isoform X6 [Cercocebus atys]  clstr ali  43  631..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 662
527 3.000e-06gi|612011870|ref|XP_007489259.1| PREDICTED: neurocan core protein isoform X2 [Monodelphis domestica]  clstr ali  43 1106..PCLNGGTCIDEV---NSFICLCLPSYGGSLCDKDT... 1137
528 3.000e-06gi|928014288|ref|XP_013876875.1| PREDICTED: neurocan core protein-like [Austrofundulus limnaeus]  clstr ali  43 1050..PCENGGTCVDKI---DSFLCLCLPSYGGDMCEKDV... 1081
529 3.000e-06gi|734617833|ref|XP_010736630.1| PREDICTED: neurocan core protein-like [Larimichthys crocea]  clstr ali  40 1014..PCENGGTCIDKI---DSFLCLCLPSYGGDMCEKDI... 1045
530 3.000e-06gi|974088190|ref|XP_015242218.1| PREDICTED: neurocan core protein [Cyprinodon variegatus]  clstr ali  43  957..PCENGGTCVDKI---DSFLCLCLPSYGGDTCEKDV... 988
531 3.000e-06gi|765149321|ref|XP_011485220.1| PREDICTED: neurocan core protein-like [Oryzias latipes]  clstr ali  43  943..PCENGGTCVDKI---DSFLCLCLPSYGGDTCEKDV... 974
532 3.000e-06gi|961971686|ref|XP_014822872.1| PREDICTED: neurocan core protein-like isoform X1 [Poecilia mexicana]  clstr ali  43  984..PCENGGTCVDKI---DSFLCLCLPSYGGDTCEKDV... 1015
533 3.000e-06gi|657809549|ref|XP_008332060.1| PREDICTED: neurocan core protein-like [Cynoglossus semilaevis]  clstr ali  40 1027..PCENGGTCIDKI---DSFLCLCLPSYGGDTCEKDI... 1058
534 3.000e-06gi|444726601|gb|ELW67125.1| Neurocan core protein [Tupaia chinensis]  clstr ali  43  963..PCDNGGTCIDQV---NGFVCLCLPSYGGSLCEKDT... 994
535 3.000e-06gi|507657471|ref|XP_004705572.1| PREDICTED: neurocan core protein [Echinops telfairi]  clstr ali  43 1022..PCANGGTCIDEV---NGFGCLCLPSYGGSFCEKDT... 1053
536 3.000e-06gi|634875261|ref|XP_007948737.1| PREDICTED: versican core protein isoform X3 [Orycteropus afer afer]  clstr ali  37 1393.NPCRNGATCIDGF---NTFTCLCLPSYVGALCERDT-ET 1427
537 3.000e-06gi|705663192|ref|XP_010127906.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Chlamydotis macqueenii]  clstr ali  43 1222.CDCLNNGSCVTNINFSGRYLCVCVAGFEGDLCQVNTD.. 1261
538 3.000e-06gi|852759502|ref|XP_012875373.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Dipodomys ordii]  clstr ali  50 1174.CDCLNGGLCESDRSFSGAYLCVCLPGFQGGRCEEDVSQ. 1214
539 4.000e-06gi|762113748|ref|XP_011439637.1| PREDICTED: latrophilin-3-like [Crassostrea gigas]  clstr ali  34  246..PCQNNGTCIDLI---NEYKCSCTNGYSGKNCTNDT... 277
540 4.000e-06gi|919038830|ref|XP_013402904.1| PREDICTED: integrin beta-like protein A [Lingula anatina]  clstr ali  40  562.NPCVNSGTCNNLL---NGFNCTCPVGFIGDMCETDIDE. 596
541 4.000e-06gi|927139750|ref|XP_013912720.1| PREDICTED: versican core protein isoform X2 [Thamnophis sirtalis]  clstr ali  38 1352..PCRNGATCIDGV---NTFACLCLPSYVGALCEKDT-ET 1385
542 4.000e-06gi|617468454|ref|XP_007574543.1| PREDICTED: neurocan core protein-like isoform X2 [Poecilia formosa]  clstr ali  43  912..PCENGGTCVDKI---DSFLCLCLPSYGGDTCEKDV... 943
543 4.000e-06gi|936703917|ref|XP_014229922.1| PREDICTED: neural-cadherin [Trichogramma pretiosum]  clstr ali  38 2303NNPCYNGGRCIEGAYGLT---CQCPAGYNGPRCQ...... 2333
544 4.000e-06gi|928147664|ref|XP_013972893.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Canis lupus familiaris]  clstr ali  60 1738...CQNGGTCVSR---WNMYLCECPLRFGGKNCE...... 1765
545 5.000e-06gi|928164458|ref|XP_013977766.1| PREDICTED: neurocan core protein isoform X3 [Canis lupus familiaris]  clstr ali  43  669..PCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 700
546 5.000e-06gi|512814844|ref|XP_002936378.2| PREDICTED: neurocan core protein isoform X1 [Xenopus tropicalis]  clstr ali  41 1326.NPCQNGGTCIDEI---NSFLCLCLSSYGGSTC....... 1354
547 5.000e-06gi|927139753|ref|XP_013912721.1| PREDICTED: versican core protein isoform X3 [Thamnophis sirtalis]  clstr ali  38 1123..PCRNGATCIDGV---NTFACLCLPSYVGALCEKDT-ET 1156
548 5.000e-06gi|645002338|ref|XP_008209926.1| PREDICTED: LOW QUALITY PROTEIN: neural-cadherin [Nasonia vitripennis]  clstr ali  38 2331NNPCHNGGRCVEGRFGLT---CQCPAGYNGPRCQ...... 2361
549 5.000e-06gi|762160188|ref|XP_011418305.1| PREDICTED: cell wall protein DAN4-like isoform X1 [Crassostrea gigas]  clstr ali  48  56...CKNGGTCVESAPCSNSGSCICPENYSGEHCQ...... 86
550 5.000e-06gi|602683785|ref|XP_007454150.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Lipotes vexillifer]  clstr ali  60 1676...CQNGGTCVSG---WNTYLCECPLRFGGKNCE...... 1703
551 6.000e-06gi|817716253|gb|AKF85454.1| hypothetical protein MFUL124B02_12890 [Myxococcus fulvus 124B02]  clstr ali  36  289.NPCQNGGTCTDGI---NSYTCTCAPTYEGPNCQ...... 318
552 6.000e-06gi|1020474466|ref|XP_016142465.1| PREDICTED: neurocan core protein-like [Sinocyclocheilus grahami]  clstr ali  36  729.NPCENGGTCIDKE---DSFVCLCLPSYSGDRCERDT... 761
553 6.000e-06gi|966671873|gb|KTG05254.1| hypothetical protein cypCar_00028840 [Cyprinus carpio]  clstr ali  39 1396.NPCRNGGTCIDGL---NSFTCVCLPSYAGALCEQDT... 1428
554 6.000e-06gi|954369954|gb|KRY36190.1| Protocadherin Fat 1 [Trichinella spiralis]  clstr ali  48 4315...CLNGGSCVGRGSFG--FTCLCPARYFGTYCEIDRT.. 4347
555 6.000e-06gi|954393907|gb|KRY56227.1| Protocadherin Fat 1 [Trichinella britovi]  clstr ali  48 4261...CLNGGSCVGRGSFG--FTCLCPARYFGTYCEIDRT.. 4293
556 6.000e-06gi|954444513|gb|KRY92575.1| Protocadherin Fat 1 [Trichinella pseudospiralis]  clstr ali  48 4228...CLNGGSCVGRGSFG--FTCLCPARYFGTYCEIDRT.. 4260
557 6.000e-06gi|954423519|gb|KRY74853.1| Protocadherin Fat 1 [Trichinella pseudospiralis]  clstr ali  48 4179...CLNGGSCVGRGSFG--FTCLCPARYFGTYCEIDRT.. 4211
558 6.000e-06gi|954475543|gb|KRZ05675.1| Protocadherin Fat 1, partial [Trichinella zimbabwensis]  clstr ali  48 4164...CLNGGSCVGRGSFG--FTCLCPARYFGTYCEIDRT.. 4196
559 6.000e-06gi|954516268|gb|KRZ44216.1| Protocadherin Fat 1 [Trichinella pseudospiralis]  clstr ali  48 4110...CLNGGSCVGRGSFG--FTCLCPARYFGTYCEIDRT.. 4142
560 7.000e-06gi|999977933|gb|KXJ17107.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Exaiptasia pallida]  clstr ali  39  243..PCQNGGTCSDRV---NGYSCTCATGYSGTNC....... 270
561 7.000e-06gi|148668664|gb|EDL00983.1| mCG116562, isoform CRA_c, partial [Mus musculus]  clstr ali  40  452.NPCRNGATCVDGF---NTFRCLCLPSYVGALCEQDT-ET 486
562 7.000e-06gi|348500902|ref|XP_003438010.1| PREDICTED: neurocan core protein-like [Oreochromis niloticus]  clstr ali  40 1044..PCANGGTCIDKI---DSFLCLCLPSYGGDMCEKDV... 1075
563 7.000e-06gi|260785516|ref|XP_002587807.1| hypothetical protein BRAFLDRAFT_92256 [Branchiostoma floridae]  clstr ali  43 3910..PCLNNGTCTDGQT---SYSCQC--GFKGDNCEI..... 3939
564 7.000e-06gi|674098529|ref|XP_008822706.1| PREDICTED: neurocan core protein, partial [Nannospalax galili]  clstr ali  40 1002..PCENGGTCIDEV---NGFVCLCLPSYGGSLCQKDT... 1033
565 7.000e-06gi|1020524139|ref|XP_016101586.1| PREDICTED: versican core protein-like isoform X1 [Sinocyclocheilus grahami]  clstr ali  39 2870.NPCRNGGTCIDGL---NSFTCVCLPSYAGALCEQDT... 2902
566 7.000e-06gi|918291062|gb|KOF69304.1| hypothetical protein OCBIM_22005285mg, partial [Octopus bimaculoides]  clstr ali  43  666.NPCLNGGKCVNYPF---TYKCECKRGFTGENCE...... 695
567 7.000e-06gi|961131284|ref|XP_014786071.1| PREDICTED: collagen alpha-4(VI) chain-like, partial [Octopus bimaculoides]  clstr ali  43  890.NPCLNGGKCVNYPF---TYKCECKRGFTGENCE...... 919
568 7.000e-06gi|965866016|ref|XP_014964382.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 isoform X2 [Ovis aries musimon]  clstr ali  60 1735...CQNGGTCVSG---WNTYLCECPLRFGGKNCE...... 1762
569 8.000e-06gi|823474697|ref|XP_012433247.1| PREDICTED: versican core protein [Taeniopygia guttata]  clstr ali  37  392.NPCRNGATCIDSL---NTFTCLCLPSYVGALCEQDT-ET 426
570 8.000e-06gi|528472382|ref|XP_002661027.3| PREDICTED: neurocan core protein [Danio rerio]  clstr ali  36  873.NPCENGGTCIDKE---DSFVCLCLPSYSGDRCERDT... 905
571 8.000e-06gi|926693287|ref|XP_013819868.1| PREDICTED: LOW QUALITY PROTEIN: cadherin EGF LAG seven-pass G-type receptor 1, partial [Capra hircus]  clstr ali  60 1268...CQNGGTCVSG---WNTYLCECPLRFGGKNCE...... 1295
572 8.000e-06gi|61162130|dbj|BAD91054.1| Af1-cadherin [Artemia franciscana]  clstr ali  53 1148...CFNGGTCILNGLFP---RCECPDNFEGPRCE...... 1175
573 9.000e-06gi|736301031|ref|XP_010793113.1| PREDICTED: protein crumbs homolog 1 isoform X5 [Notothenia coriiceps]  clstr ali  35  196..PCFNSATCQDN---QGDYSCDCWPGFEGRQCDIDINE. 229
574 9.000e-06gi|583983562|ref|XP_006787067.1| PREDICTED: neurocan core protein-like [Neolamprologus brichardi]  clstr ali  40  955..PCANGGTCIDKI---DSFLCLCLPSYGGDMCEKDV... 986
575 1.000e-05gi|260826500|ref|XP_002608203.1| hypothetical protein BRAFLDRAFT_90357 [Branchiostoma floridae]  clstr ali  42  141...CENGGTCRDGI---NEYSCDCADGFNGDTCQIDTNE. 173
576 1.000e-05gi|505768687|ref|XP_004600512.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Sorex araneus]  clstr ali  28 1314.NPCFHNAICEDQV---GGFLCKCPPGFLGTLCEKDLDE. 1348
577 1.000e-05gi|351712034|gb|EHB14953.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Heterocephalus glaber]  clstr ali  38 1299.NPCRNQATCVDGL---NSYSCKCRPGFSGSRCET..... 1329
578 1.000e-05gi|950950608|ref|XP_014451816.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Alligator mississippi  clstr ali  32 1256..PCLNNGVCKDGIA---AFICQCQPGYTGSLCEEDVNE. 1289
579 1.000e-05gi|955500888|ref|XP_014637400.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Ceratotherium simum s  clstr ali  38 1324.NPCRNQATCVDEL---NSYSCKCLPGFSGSRCET..... 1354
580 1.000e-05gi|405970071|gb|EKC35006.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  37  554..PCQNNGTCIDQV---NHFQCECVPGYNGTTCE...... 582
581 1.000e-05gi|537245548|gb|ERE87808.1| protocadherin Fat 4 [Cricetulus griseus]  clstr ali  30 3780..PCKNGAVCQN---FPGGFNCVCKTGYTGKMCESSVN.. 3812
582 1.000e-05gi|625270788|ref|XP_007626942.1| PREDICTED: protocadherin Fat 4 isoform X2 [Cricetulus griseus]  clstr ali  30 4263..PCKNGAVCQN---FPGGFNCVCKTGYTGKMCESSVN.. 4295
583 1.000e-05gi|762071645|ref|XP_011426104.1| PREDICTED: deleted in malignant brain tumors 1 protein-like [Crassostrea gigas]  clstr ali  45  299...CYNGGTCIAYNNGYPGYYCNCPSGFTGLHCQ...... 329
584 1.000e-05gi|966645337|gb|KTF80249.1| hypothetical protein cypCar_00021597 [Cyprinus carpio]  clstr ali  57 1444...CQNGGVCVNR---WNTHTCNCPLGYGGKNCE...... 1471
585 1.000e-05gi|931610867|ref|XP_014198829.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Pan paniscus]  clstr ali  57 1518...CQNGGTCVNR---WNMYLCECPLRFGGKNCE...... 1545
586 1.000e-05gi|537238524|gb|ERE86463.1| cadherin EGF LAG seven-pass G-type receptor [Cricetulus griseus]  clstr ali  57 1701...CQNGGTCVNK---WNTYLCECPLRFGGKNCE...... 1728
587 1.000e-05gi|970734377|ref|XP_015101858.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Vicugna pacos]  clstr ali  60 1763...CQNGGTCVSG---WNTYVCECPLRFGGKNCE...... 1790
588 1.000e-05gi|724795973|ref|XP_010378668.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Rhinopithecus roxellana]  clstr ali  57 1767...CQNGGTCVNR---WNMYLCECPLRFGGKNCE...... 1794
589 1.000e-05gi|1009341157|emb|CTP81333.1| BMA-CDH-1 [Brugia malayi]  clstr ali  36 3739...CRNGGTCIKYRHFTHTGTCLCTKGYTGKFCQNDIDE. 3775
590 1.000e-05gi|1012269233|ref|XP_015982205.1| PREDICTED: LOW QUALITY PROTEIN: cadherin EGF LAG seven-pass G-type receptor 1 [Rousettus aegyptiacus]  clstr ali  57 1811...CQNGGTCVSR---WSTYLCECPLRFGGKNCE...... 1838
591 1.000e-05gi|820991347|ref|XP_012363042.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1, partial [Nomascus leucogenys]  clstr ali  48 1552...CQNGGTCVNR---WNMYLCECPLRFGGKNCEQEATS. 1584
592 1.000e-05gi|751453761|ref|XP_011181320.1| PREDICTED: homeobox protein 2 isoform X1 [Bactrocera cucurbitae]  clstr ali  56  897...CLNGGTC---KFFSEIYSCICPEGFIGERCD...... 926
593 2.000e-05gi|946635188|ref|XP_006118909.2| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1, partial [Pelodiscus s  clstr ali  32 1228..PCLNSGVCKDGI---GVFICQCQPGYTGLLCEEDINE. 1261
594 2.000e-05gi|585650438|ref|XP_006814579.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Saccoglossus kow  clstr ali  31  816.NSCYNNATCMDKV---NGFSCHCMQGYSGILCDIDINE. 850
595 2.000e-05gi|507672269|ref|XP_004638163.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Octodon degus]  clstr ali  38 1381.NPCRNQATCVD---ETNSYSCKCQPGFSGSRCET..... 1411
596 2.000e-05gi|537228073|gb|ERE83520.1| sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Cricetulus griseus]  clstr ali  38 1464.NPCRNQATCVDEL---NSYSCKCRPGFSGHRCET..... 1494
597 2.000e-05gi|321466601|gb|EFX77596.1| hypothetical protein DAPPUDRAFT_30003, partial [Daphnia pulex]  clstr ali  29 1149..PCHQGATCLDKIL---GYVCVCPPGMAGSRCELEVDE. 1182
598 2.000e-05gi|470618392|ref|XP_004317818.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like, partial [Tursiop  clstr ali  38 1369.NPCRNQATCVDEL---NSYSCKCQPGFSGSRCET..... 1399
599 2.000e-05gi|444730184|gb|ELW70574.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Tupaia chinensis]  clstr ali  38 1448.NPCKNQATCVDEL---NSYSCKCRPGFSGSQCET..... 1478
600 2.000e-05gi|591384083|ref|XP_007066499.1| PREDICTED: versican core protein [Chelonia mydas]  clstr ali  37  394.NPCRNGATCIDGL---NLFTCLCLPSYVGALCEQDT-ET 428
601 2.000e-05gi|795380063|ref|XP_011937484.1| PREDICTED: LOW QUALITY PROTEIN: protocadherin Fat 4 [Cercocebus atys]  clstr ali  34 4099..PCQHGGTCMDYWSWQ---QCHCKEGLTGKYCE...... 4127
602 2.000e-05gi|982250738|ref|XP_015306294.1| PREDICTED: protocadherin Fat 4 isoform X3 [Macaca fascicularis]  clstr ali  36 4392..PCQNGGSCEPGLH--SGFTCSCPDSHTGRTCE...... 4421
603 2.000e-05gi|987944028|ref|XP_015418846.1| PREDICTED: LOW QUALITY PROTEIN: protocadherin Fat 4 [Myotis davidii]  clstr ali  30 3954..PCKNGAVCQN---FPGSFHCVCKTGYTGKMCESSVN.. 3986
604 2.000e-05gi|675385360|gb|KFM78257.1| Basement membrane-specific heparan sulfate proteoglycan core protein, partial [Stegodyphus mimosarum]  clstr ali  48  921..PCKNGGTC---SGSGNSYKCNCPLAYKGTNCE...... 949
605 2.000e-05gi|1020968256|ref|XP_016159906.1| PREDICTED: neurocan core protein [Ficedula albicollis]  clstr ali  43  597..PCQNGGTCIDEV---NSFVCLCLPSYGGSRCEKDT... 628
606 2.000e-05gi|929074424|ref|XP_014047484.1| PREDICTED: neurocan core protein-like [Salmo salar]  clstr ali  39  894.NPCLNGGTCIDKI---DSFVCLCLPSYAGDTCEKDV... 926
607 2.000e-05gi|512810567|ref|XP_002938236.2| PREDICTED: pikachurin [Xenopus tropicalis]  clstr ali  33  816NIPCANGGSCRPQH---DSYECDCPLGFDGKNCQKVITE. 851
608 2.000e-05gi|769843610|ref|XP_011633027.1| PREDICTED: LOW QUALITY PROTEIN: neural-cadherin-like [Pogonomyrmex barbatus]  clstr ali  38 2237NSPCYNGGRCVEDRFGLS---CQCPSGYNGPRCQ...... 2267
609 2.000e-05gi|749781445|ref|XP_011145007.1| PREDICTED: neural-cadherin isoform X4 [Harpegnathos saltator]  clstr ali  38 2205NSPCYNGGRCVEDRFGLS---CQCPSGYNGPRCQ...... 2235
610 2.000e-05gi|989980696|ref|XP_015449494.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1, partial [Pteropus alecto]  clstr ali  60 1416...CQNGGTCVSR---WSTHLCECPLRFGGKNCE...... 1443
611 2.000e-05gi|725580200|ref|XP_010341864.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1, partial [Saimiri boliviensis boliviensis]  clstr ali  57 1396...CQNGGTCVNR---WNMYLCECPLQFGGKNCE...... 1423
612 2.000e-05gi|982271401|ref|XP_015312450.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Macaca fascicularis]  clstr ali  57 1674...CQNGGTCVNR---WNMYLCECPLRFGGKNCE...... 1701
613 2.000e-05gi|742082679|ref|XP_010857895.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Bison bison bison]  clstr ali  60  123...CQNGGTCVSG---WNTYLCECPLRFGGKNCE...... 150
614 2.000e-05gi|744575155|ref|XP_010981914.1| PREDICTED: LOW QUALITY PROTEIN: cadherin EGF LAG seven-pass G-type receptor 1 [Camelus dromedarius]  clstr ali  60 1479...CQNGGTCVSG---WNTYICECPLRFGGKNCE...... 1506
615 2.000e-05gi|795390518|ref|XP_011753197.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 isoform X1 [Macaca nemestrina]  clstr ali  57 1659...CQNGGTCVNR---WNMYLCECPLRFGGKNCE...... 1686
616 2.000e-05gi|795390537|ref|XP_011753201.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 isoform X5 [Macaca nemestrina]  clstr ali  57 1412...CQNGGTCVNR---WNMYLCECPLRFGGKNCE...... 1439
617 2.000e-05gi|946612367|ref|XP_014407780.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Camelus ferus]  clstr ali  60 1448...CQNGGTCVSG---WNTYVCECPLRFGGKNCE...... 1475
618 3.000e-05gi|405966781|gb|EKC32021.1| Fibropellin-3, partial [Crassostrea gigas]  clstr ali  38  122..PCQNYGTCTDLL---NDYNCSCVPGFNGTNCENN.... 152
619 3.000e-05gi|999989325|gb|KXJ28367.1| Fibropellin-1 [Exaiptasia pallida]  clstr ali  40  493.NPCRNGATCINNF---GGYRCKCTAEFQGKHCDIDVNE. 527
620 3.000e-05gi|260782454|ref|XP_002586302.1| hypothetical protein BRAFLDRAFT_82908 [Branchiostoma floridae]  clstr ali  43  255.NICQNGGICTSCFNDSAAF-CDCPAGFDGKTCEIDIDE. 291
621 3.000e-05gi|743714690|ref|XP_010950943.1| PREDICTED: protocadherin Fat 4 [Camelus bactrianus]  clstr ali  34 4193..PCQHGGTCTDYWSWQ---QCHCREGLTGKYCE...... 4221
622 3.000e-05gi|957837017|ref|XP_014668701.1| PREDICTED: uncharacterized protein LOC106809975 [Priapulus caudatus]  clstr ali  30  199DRPCRNGAICQDDGF--GGFSCHCPFNYKGVRCET..... 231
623 3.000e-05gi|537217432|gb|ERE82041.1| sushi, nidogen and EGF-like domain-containing protein 1 [Cricetulus griseus]  clstr ali  41 2223DCECRNGGRCL----GTNTTLCQCPPGFFGLLCEFEVTAT 2258
624 3.000e-05gi|655838081|ref|XP_008260129.1| PREDICTED: versican core protein isoform X1 [Oryctolagus cuniculus]  clstr ali  39 3158.NPCRNGATCVDGF---NTFRCLCLPSYVGVLCEQDT... 3190
625 3.000e-05gi|1020460964|ref|XP_016135256.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1-like [Sinocyclocheilus grahami]  clstr ali  57 1638...CQNGGVCVNR---WNTHTCNCPLGYGGKNCE...... 1665
626 3.000e-05gi|808853613|gb|KKF09194.1| Cadherin EGF LAG seven-pass G-type receptor 1 [Larimichthys crocea]  clstr ali  53 1515...CQNGGVCVSK---WNTYSCDCPTGYGGKNCE...... 1542
627 3.000e-05gi|928050352|ref|XP_013874296.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 isoform X1 [Austrofundulus limnaeus]  clstr ali  57 1668...CLNGGVCVSK---WNTYSCDCPTGYGGKNCE...... 1695
628 3.000e-05gi|1007707649|ref|XP_015812119.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 isoform X3 [Nothobranchius furzeri]  clstr ali  57 1676...CLNGGVCVSK---WNTYSCDCPTGYGGKNCE...... 1703
629 3.000e-05gi|617372597|ref|XP_007577899.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 isoform X1 [Poecilia formosa]  clstr ali  57 1645...CLNGGVCVSR---WNTYSCDCPTGYGGKNCE...... 1672
630 3.000e-05gi|759180116|ref|XP_011379033.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1, partial [Pteropus vampyrus]  clstr ali  60 1363...CQNGGTCVSR---WSTHLCECPLRFGGKNCE...... 1390
631 3.000e-05gi|919045687|ref|XP_013406055.1| PREDICTED: uncharacterized protein LOC106170630 isoform X1 [Lingula anatina]  clstr ali  47  409ECGCKNGGICVQSNDLSSQRTCTCPYPYGGLHCE...... 442
632 3.000e-05gi|961900181|ref|XP_014902897.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 isoform X2 [Poecilia latipinna]  clstr ali  57 1672...CLNGGVCVSR---WNTYSCDCPTGYGGKNCE...... 1699
633 3.000e-05gi|292628237|ref|XP_001920772.2| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Danio rerio]  clstr ali  57 1636...CQNGGVCVNR---WNTHTCNCPLGYGGKNCE...... 1663
634 3.000e-05gi|954309487|gb|KRX97335.1| Protocadherin Fat 1, partial [Trichinella pseudospiralis]  clstr ali  48 1348...CLNGGSCVGRGSFG--FTCLCPARYFGTYCEIDRT.. 1380
635 3.000e-05gi|564309130|ref|XP_006226250.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 isoform X1 [Rattus norvegicus]  clstr ali  57 1673...CQNGGTCVNR---WNTYLCECPLRFGGKNCE...... 1700
636 3.000e-05gi|149065690|gb|EDM15563.1| rCG59452 [Rattus norvegicus]  clstr ali  57 1673...CQNGGTCVNR---WNTYLCECPLRFGGKNCE...... 1700
637 3.000e-05gi|1009593022|ref|XP_015925434.1| PREDICTED: uncharacterized protein LOC107453216 isoform X1 [Parasteatoda tepidariorum]  clstr ali  46  242...CQNGGTC-RYYIGSTVKTCECPSGFEGSKCE...... 271
638 3.000e-05gi|471390962|ref|XP_004380122.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Trichechus manatus latirostris]  clstr ali  57 1751...CQNGGTCVNR---WNTYLCACPLRFGGKNCE...... 1778
639 4.000e-05gi|919081036|ref|XP_013421640.1| PREDICTED: keratin, type I cytoskeletal 9-like [Lingula anatina]  clstr ali  43  96..PCTNGATCKDGV---NSYSCVCPPGYTGQTCDI..... 125
640 4.000e-05gi|126334857|ref|XP_001374633.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 isoform X1 [Monodelphi  clstr ali  38 1425.NPCRNQATCVDEL---NSYSCKCRPGFSGSRCET..... 1455
641 4.000e-05gi|762150119|ref|XP_011413013.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Crassostrea giga  clstr ali  39 1274..PCLNNGVCQQRL---GGYNCTCPTGFRGTNCEINHD.. 1306
642 4.000e-05gi|537228072|gb|ERE83519.1| sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Cricetulus griseus]  clstr ali  38 1195.NPCRNQATCVDEL---NSYSCKCRPGFSGHRCET..... 1225
643 4.000e-05gi|999990982|gb|KXJ30000.1| Fibropellin-1 [Exaiptasia pallida]  clstr ali  37  329..PCQNGAVCNDLV---NGYNCTCAGGYGGXNCEL..... 358
644 4.000e-05gi|919038824|ref|XP_013402901.1| PREDICTED: fibrillin-1-like [Lingula anatina]  clstr ali  34  398.NPCQNGGKCNNLY---NRFECTCAVGTTGTRCETDVNE. 432
645 4.000e-05gi|769242418|ref|WP_044986366.1| hypothetical protein [Sorangium cellulosum]  clstr ali  35  219ESPCQNDGTCVDHI---DSYSCACLPTYEGTRCE...... 249
646 4.000e-05gi|999979925|gb|KXJ19099.1| Polycystic kidney disease protein 1-like 2 [Exaiptasia pallida]  clstr ali  44  270..PCLHGGTCRDLI---NDYSCTCTEWFGGKSCQ...... 298
647 4.000e-05gi|808880675|gb|KKF28486.1| Rootletin [Larimichthys crocea]  clstr ali  41 2417..PCLNGGYC---YERDGGYTCECKYGYWGKHCE...... 2445
648 4.000e-05gi|966651787|gb|KTF86689.1| hypothetical protein cypCar_00047211 [Cyprinus carpio]  clstr ali  36  50.NPCENGGTCIDKE---DSYVCLCLPSYSGDRCE...... 79
649 4.000e-05gi|749744643|ref|XP_011154833.1| PREDICTED: protein eyes shut [Harpegnathos saltator]  clstr ali  43  57.NPCLNGGTCNDGIA---SYNCTCTDGFVGVNCE...... 86
650 4.000e-05gi|1016664711|ref|XP_016059093.1| PREDICTED: putative ciliary rootlet coiled-coil protein 2 [Miniopterus natalensis]  clstr ali  44 1870..PCLNGGSCVDLV---GNFSCLCAEPFEGPRCE...... 1898
651 4.000e-05gi|861428234|ref|XP_012926543.1| PREDICTED: versican core protein [Heterocephalus glaber]  clstr ali  39 3125.NPCRNGATCVDGF---NTFRCLCLPSYIGALCEQDT... 3157
652 4.000e-05gi|1020502533|ref|XP_016090102.1| PREDICTED: neurocan core protein-like [Sinocyclocheilus grahami]  clstr ali  36  766.NPCENGGTCIDKE---DSFVCLCLPSYSGDRCE...... 795
653 4.000e-05gi|1020397080|ref|XP_016137553.1| PREDICTED: neural-cadherin-like [Sinocyclocheilus grahami]  clstr ali  48 2484...CRNGGTCLAHS--SKSYQCRCPEGFRGQWCEIGRVKS 2518
654 4.000e-05gi|1002600332|ref|XP_015679241.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Protobothrops mucrosquamatus]  clstr ali  57 1693...CQNGGTCVSK---WNTYICDCPLRYGGKNCE...... 1720
655 4.000e-05gi|817269735|ref|XP_012304927.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Aotus nancymaae]  clstr ali  57 1697...CQNGGTCVNR---WNMYLCECPLQFGGKNCE...... 1724
656 4.000e-05gi|671020796|ref|XP_008701216.1| PREDICTED: LOW QUALITY PROTEIN: cadherin EGF LAG seven-pass G-type receptor 1 [Ursus maritimus]  clstr ali  57 1452...CQNGGTCVSR---WDTYLCECPLRFGGKNCE...... 1479
657 4.000e-05gi|852776608|ref|XP_012881174.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Dipodomys ordii]  clstr ali  57 1620...CQNGGTCVNR---WNMYLCECPLHFGGKNCE...... 1647
658 4.000e-05gi|537238526|gb|ERE86465.1| cadherin EGF LAG seven-pass G-type receptor [Cricetulus griseus]  clstr ali  57 1701...CQNGGTCVNK---WNTYLCECPLRFGGKNCE...... 1728
659 4.000e-05gi|928050358|ref|XP_013874299.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 isoform X4 [Austrofundulus limnaeus]  clstr ali  57 1641...CLNGGVCVSK---WNTYSCDCPTGYGGKNCE...... 1668
660 5.000e-05gi|821115625|ref|XP_012381629.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Dasypus novemcinctus]  clstr ali  43  611..PCANGGTCVDEVA---GFACLCLPSYGGSLCEKDT... 642
661 5.000e-05gi|528754676|gb|EPY74335.1| FAT tumor suppressor 4 isoform 1-like protein [Camelus ferus]  clstr ali  32 2110..PCKNGAVCQN---FPGSFNCVCKTGYTGKHCELN.... 2143
662 5.000e-05gi|731510818|ref|XP_010598769.1| PREDICTED: LOW QUALITY PROTEIN: cadherin EGF LAG seven-pass G-type receptor 1-like [Loxodonta africana]  clstr ali  60  457...CQNGGTCVNR---WNTHLCVCPLRFGGKNCE...... 484
663 6.000e-05gi|260782456|ref|XP_002586303.1| hypothetical protein BRAFLDRAFT_82909 [Branchiostoma floridae]  clstr ali  43  180.NICQNGGICTSCFNDSAAF-CDCPAGFDGKTCEIDIDE. 216
664 6.000e-05gi|884977118|ref|XP_012995788.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Esox lucius]  clstr ali  29 1253..PCQNGGLCKDG---TGDFLCQCRPGYPGSLCEVEVNE. 1286
665 6.000e-05gi|637256744|ref|XP_008123530.1| PREDICTED: protein delta homolog 2 isoform X1 [Anolis carolinensis]  clstr ali  36  249..PCANGATCLDGM---NRFSCQCQAGFEGRFCTINID.. 281
666 6.000e-05gi|919021103|ref|XP_013394438.1| PREDICTED: extracellular matrix protein A-like [Lingula anatina]  clstr ali  46  714.NPCQNGGTCVDK---TGYYDCLCPTGFNGTECE...... 743
667 6.000e-05gi|780172566|ref|XP_011660780.1| PREDICTED: G-protein coupled receptor 64-like [Strongylocentrotus purpuratus]  clstr ali  39  40..PCLNSGTCTDRI---NYFVCTCPPGYTDSIC....... 67
668 6.000e-05gi|443712251|gb|ELU05672.1| hypothetical protein CAPTEDRAFT_229022 [Capitella teleta]  clstr ali  37 1419..PCQNGGKCFDSYGF---YQCDCFDNYAGLNCE...... 1447
669 6.000e-05gi|593745070|ref|XP_007127891.1| PREDICTED: LOW QUALITY PROTEIN: sushi, nidogen and EGF-like domain-containing protein 1 [Physeter catodon]  clstr ali  50  716..PCQNGGTCTHGV---NSFICQCPAGFGGPTCET..... 745
670 6.000e-05gi|655838090|ref|XP_008260132.1| PREDICTED: versican core protein isoform X4 [Oryctolagus cuniculus]  clstr ali  39 1377.NPCRNGATCVDGF---NTFRCLCLPSYVGVLCEQDT... 1409
671 6.000e-05gi|61162132|dbj|BAD91055.1| Af2-cadherin [Artemia franciscana]  clstr ali  36 2225.NPCFNGGRCTETR---NGAMCQCPSGYDGPRCQ...... 2254
672 6.000e-05gi|632979363|ref|XP_007906426.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1, partial [Callorhinchus milii]  clstr ali  56 1429.NECLNGGTCVNK---WNTYTCQCPIEFGGKNCE...... 1458
673 6.000e-05gi|768953734|ref|XP_011615660.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Takifugu rubripes]  clstr ali  57 1643...CQNGGVCVSK---WNTHSCDCPTGYGGKNCE...... 1670
674 6.000e-05gi|505831051|ref|XP_004622893.1| PREDICTED: LOW QUALITY PROTEIN: cadherin EGF LAG seven-pass G-type receptor 1 [Sorex araneus]  clstr ali  57 1048...CQNGGTCVSR---WGTYLCACPLRFGGKNCE...... 1075
675 7.000e-05gi|699242069|ref|XP_009858460.1| PREDICTED: uncharacterized protein LOC100177838 [Ciona intestinalis]  clstr ali  25  366.NPCQNNAYCEDNCP---QYTCRCLPGYQGSLCSEDINE. 400
676 7.000e-05gi|657554292|ref|XP_008281602.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Stegastes partitus] :  clstr ali  32 1254..PCQNGGLCKDGM---GDFQCQCKPGFLGSLCEAEVNE. 1287
677 7.000e-05gi|734635905|ref|XP_010746565.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Larimichthys crocea]  clstr ali  32 1253..PCQNGGLCRDGM---GDFQCQCKPGFLGSLCEAEVNE. 1286
678 7.000e-05gi|704541444|ref|XP_010176826.1| PREDICTED: protein delta homolog 1-like [Mesitornis unicolor]  clstr ali  37  67.NPCENGGTCTD---IGMGFSCFCPHGYTGKLC....... 95
679 7.000e-05gi|1020553350|ref|XP_016110127.1| PREDICTED: protocadherin Fat 4 [Sinocyclocheilus grahami]  clstr ali  37 3971..PCRHGGTCLDMWSWQ---QCQCIEGFTGPTCE...... 3999
680 7.000e-05gi|906458262|gb|KNC21513.1| Neural-cadherin [Lucilia cuprina]  clstr ali  38 2020NTPCYNGGRCVDTRFGPH---CSCPVGYTGPRCQ...... 2050
681 7.000e-05gi|751457726|ref|XP_011183497.1| PREDICTED: neural-cadherin isoform X1 [Bactrocera cucurbitae]  clstr ali  38 2402NTPCYNGGRCVDTRFGPH---CSCPAGYNGPRCQ...... 2432
682 7.000e-05gi|954441589|gb|KRY89825.1| Cadherin-related tumor suppressor [Trichinella pseudospiralis]  clstr ali  35 2058.NSCLNGGTCIEITESSGSYRCDCSSTYTGEFCETTVD.. 2113
683 7.000e-05gi|665798423|ref|XP_008547086.1| PREDICTED: neural-cadherin isoform X1 [Microplitis demolitor]  clstr ali  38 2274NSPCYNGGRCIEGRYGLT---CQCPGGYNGPRCQ...... 2304
684 7.000e-05gi|987966591|ref|XP_015426219.1| PREDICTED: LOW QUALITY PROTEIN: cadherin EGF LAG seven-pass G-type receptor 1, partial [Myotis davidii]  clstr ali  60  973...CQNGGTCVSR---WDTHLCRCPLRFGGKNCE...... 1000
685 7.000e-05gi|657757343|ref|XP_008314140.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 isoform X1 [Cynoglossus semilaevis]  clstr ali  53 1682...CQNGGVCVSK---WNTYSCDCPTGYGGKNCE...... 1709
686 8.000e-05gi|260818868|ref|XP_002604604.1| hypothetical protein BRAFLDRAFT_126772 [Branchiostoma floridae]  clstr ali  29 1192..PCNNNGTCQDLI---NGFNCTCVSGYTGDTCQMEVNE. 1225
687 8.000e-05gi|821133570|ref|XP_004475730.2| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Dasypus novemcinctus]  clstr ali  41 1033..PCLNKGICVDGLA---GYHCTCVKGFIGLHCETEVNE. 1066
688 8.000e-05gi|47551053|ref|NP_999703.1| fibropellin-3 precursor [Strongylocentrotus purpuratus]  clstr ali  39  336..PCLNGGSCLDGV---DGYVCQCLPNYTGTHCEISLD.. 368
689 8.000e-05gi|919052997|ref|XP_013408403.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 [Lingula anatina]  clstr ali  43  452NNTCKNGATCVDGITN---FTCQCPPGYTGQLC....... 481
690 8.000e-05gi|852766096|ref|XP_012877564.1| PREDICTED: protocadherin Fat 4 [Dipodomys ordii]  clstr ali  34 4121..PCQHGGTCVDHWSWQ---QCRCREGLAGKYCEKSI... 4152
691 8.000e-05gi|1016682946|ref|XP_016065819.1| PREDICTED: versican core protein isoform X1 [Miniopterus natalensis]  clstr ali  39 3057.NPCRNGATCVDGF---NTFSCLCLPSYVGALCEQDT... 3089
692 8.000e-05gi|612006466|ref|XP_007487407.1| PREDICTED: versican core protein isoform X1 [Monodelphis domestica]  clstr ali  39 3188.NPCRNGATCVDGF---NTFTCLCLPSYVGALCEQDT... 3220
693 8.000e-05gi|836711399|ref|XP_012789982.1| PREDICTED: neurocan core protein [Sorex araneus]  clstr ali  43  804..PCENGGTCIDEV---NGFVCLCLPSYGGSSCEKDT... 835
694 8.000e-05gi|504155713|ref|XP_004589769.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Ochotona princeps]  clstr ali  57 1637...CQNGGTCVNR---WNTYLCLCPLQFGGKNCE...... 1664
695 9.000e-05gi|322793232|gb|EFZ16889.1| hypothetical protein SINV_09531, partial [Solenopsis invicta]  clstr ali  38 1083NSPCYNGGRCVEDRFGLS---CQCPSGYNGPRCQ...... 1113
696 9.000e-05gi|504147732|ref|XP_004586278.1| PREDICTED: versican core protein isoform X1 [Ochotona princeps]  clstr ali  39 3094.NPCRNGATCVDGF---NTFSCLCLPSYVGVLCEQDT... 3126
697 9.000e-05gi|954594718|gb|KRZ71936.1| Cadherin-related tumor suppressor [Trichinella papuae]  clstr ali  35 2003.NSCLNGGTCIEITESSGSYRCDCSSTYTGEFCETTVD.. 2058
698 1.000e-04gi|260794967|ref|XP_002592478.1| hypothetical protein BRAFLDRAFT_68964 [Branchiostoma floridae]  clstr ali  41  295.NECLNGGNCI--ACFSDFSMCRCHPGYTGAFCEIDIDE. 330
699 1.000e-04gi|260790079|ref|XP_002590071.1| hypothetical protein BRAFLDRAFT_123438 [Branchiostoma floridae]  clstr ali  43  545DKPCMNGGTCLDRV---NGYVCRCPEGYGGHNC....... 574
700 1.000e-04gi|919017805|ref|XP_013393182.1| PREDICTED: fibrillin-2-like isoform X25 [Lingula anatina]  clstr ali  43 1523...CQNGGTCEDKVL---GFHCNCVLGFTGINCETDID.. 1554
701 1.000e-04gi|919017808|ref|XP_013393184.1| PREDICTED: fibrillin-2-like isoform X26 [Lingula anatina]  clstr ali  43 1523...CQNGGTCEDKVL---GFHCNCVLGFTGINCETDID.. 1554
702 1.000e-04gi|611976399|ref|XP_007474690.1| PREDICTED: protein crumbs homolog 2 [Monodelphis domestica]  clstr ali  36  432..PCLNGGTCED---LPNSFQCHCLAGYTGLSCMVNVD.. 464
703 1.000e-04gi|617436798|ref|XP_007563718.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 isoform X1 [Poecilia f  clstr ali  32 1248..PCQNGGLCRDGM---GDFQCQCKPGFLGALCEGEVNE. 1281
704 1.000e-04gi|929102856|ref|XP_014062512.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like isoform X1 [Salmo  clstr ali  32 1252..PCQNGGLCKDG---TGDFLCQCRPGFVGSLCEAEVNE. 1285
705 1.000e-04gi|929102860|ref|XP_014062514.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like isoform X3 [Salmo  clstr ali  32 1188..PCQNGGLCKDG---TGDFLCQCRPGFVGSLCEAEVNE. 1221
706 1.000e-04gi|597791710|ref|XP_007258966.1| PREDICTED: protein delta homolog 1 [Astyanax mexicanus]  clstr ali  43  214.NPCLNGGTCRDNGL---GYTCVCLSGFSGPTCNIN.... 245
707 1.000e-04gi|620948150|ref|XP_007653845.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Ornithorhynchus anati  clstr ali  29 1277..PCLNNGVCKDGIK---AFTCHCQAGFTGLLCQENINE. 1310
708 1.000e-04gi|