current user: public

Query: d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}, from SCOP175

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
1 3.000e-13gi|694846944|ref|XP_009464527.1| PREDICTED: neurocan core protein [Nipponia nippon]  clstr ali  45  919NNPCLHGGTCHANGTVCG---CSCAPGFTGENCEIDID.. 953
2 3.000e-13gi|405973659|gb|EKC38360.1| Cartilage matrix protein, partial [Crassostrea gigas]  clstr ali  40  143.NPCQNGGTCSNG---NNQYTCTCLPGWTGSNCEIDIDE. 177
3 1.000e-12gi|686603500|ref|XP_009278125.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Aptenodytes forsteri]  clstr ali  45  928NNPCLHGGTCRANGTVCG---CSCAPGFTGENCEIDID.. 962
4 8.000e-12gi|675418418|ref|XP_008922575.1| PREDICTED: urokinase-type plasminogen activator [Manacus vitellinus]  clstr ali  50  36ECSCLNGGTCITYYLFSGISRCICPEGYTGIHCELDTDST 75
5 2.000e-11gi|525001065|ref|XP_005048261.1| PREDICTED: urokinase-type plasminogen activator [Ficedula albicollis]  clstr ali  50  37ECPCLNGGTCITYYVFSGIGRCICPDGYTGLHCELDTGST 76
6 2.000e-11gi|545494833|ref|XP_005618919.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Canis lupus familiaris]  clstr ali  82  142NCSCLNGGTCVSYKYFSNIQRCNCPKKFQGEHCEIDTSKT 181
7 2.000e-11gi|195376839|ref|XP_002047200.1| GJ13308 [Drosophila virilis]  clstr ali  54  581NNHCFHGGTCM-LLPFLNIYYCNCPEGFTGQRCE...... 613
8 3.000e-11gi|529419880|ref|XP_005229802.1| PREDICTED: urokinase-type plasminogen activator [Falco peregrinus]  clstr ali  47  39ECHCLNGGTCITYYLFRGIIRCICPEGYTGTHCELDVD.. 76
9 4.000e-11gi|587004568|ref|XP_006937958.1| PREDICTED: urokinase-type plasminogen activator [Felis catus]  clstr ali  80  32NCGCLNGGTCVSYKYFSNIQRCSCPKKFQGEHCEIDTSKT 71
10 4.000e-11gi|344274298|ref|XP_003408954.1| PREDICTED: urokinase-type plasminogen activator-like [Loxodonta africana]  clstr ali  82  13NCSCLNGGTCVSYKYFSNIQRCNCPKKFQGEHCEIDTSKT 52
11 5.000e-11gi|667288023|ref|XP_008576689.1| PREDICTED: urokinase-type plasminogen activator [Galeopterus variegatus]  clstr ali  80  32NCGCLNGGTCVSYKYFSNIRRCNCPRKFQGEHCEIDTSKT 71
12 5.000e-11gi|507640740|ref|XP_004701473.1| PREDICTED: urokinase-type plasminogen activator [Echinops telfairi]  clstr ali  70  30NCTCLNGGTCVSYKHFSHIQRCHCPKNFQGEHCEIDTLKT 69
13 6.000e-11gi|507617972|ref|XP_004624442.1| PREDICTED: urokinase-type plasminogen activator [Octodon degus]  clstr ali  80  31NCGCLNGGTCVSYKYFSNMQRCNCPKKFQGEHCEIDTSKT 70
14 6.000e-11gi|532080386|ref|XP_005325952.1| PREDICTED: urokinase-type plasminogen activator [Ictidomys tridecemlineatus]  clstr ali  80  31NCGCLNGGTCVSYKYFSNIRRCICPKKFQGEHCEIDTSKT 70
15 7.000e-11gi|634847512|ref|XP_007938789.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Orycteropus afer afer]  clstr ali  80  32NCGCLNGGTCVSYKYFSNIQRCKCPKKFQGEHCEIDTSKT 71
16 7.000e-11gi|677833527|ref|XP_009067782.1| PREDICTED: urokinase-type plasminogen activator-like [Acanthisitta chloris]  clstr ali  50  39DCHCLNGGTCITYYLFSGISRCVCPEGYTGIHCELDSD.. 76
17 8.000e-11gi|597745136|ref|XP_007234607.1| PREDICTED: versican core protein-like [Astyanax mexicanus]  clstr ali  44 1192DNPCLNGGTCVDGV---NSFSCVCLPSYTGALCEQDT-ET 1227
18 1.000e-10gi|641658202|ref|XP_008180635.1| PREDICTED: cubilin-like [Acyrthosiphon pisum]  clstr ali  45  51.NPCQNGGTCVDLY---NGFQCNCPNNWQGKMCELDVDE. 85
19 1.000e-10gi|527269437|ref|XP_005152724.1| PREDICTED: urokinase-type plasminogen activator [Melopsittacus undulatus]  clstr ali  51  40ECHCLNGGTCITYYLFSGINRCICPEGYTGINCEIDT... 76
20 1.000e-10gi|562885273|ref|XP_006170097.1| PREDICTED: urokinase-type plasminogen activator [Tupaia chinensis]  clstr ali  80  36NCGCLNGGTCVSYKFFSNIRRCNCPKKFQGEHCEIDTSKT 75
21 1.000e-10gi|719762238|ref|XP_010216521.1| PREDICTED: urokinase-type plasminogen activator [Tinamus guttatus]  clstr ali  50  39DCNCLNGGTCITYHLFHRISRCLCPDGYTGIHCEIDTDNT 78
22 1.000e-10gi|507942138|ref|XP_004681118.1| PREDICTED: urokinase-type plasminogen activator [Condylura cristata]  clstr ali  77  32NCGCQNGGTCVHYKYFSNIHRCNCPKRFEGEHCEIDRSKT 71
23 1.000e-10gi|594057035|ref|XP_006052703.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Bubalus bubalis]  clstr ali  75  78NCGCLNGGKCVTYKYFSNIQRCSCPKKFQGEHCEIDTSKT 117
24 2.000e-10gi|696961454|ref|XP_009569031.1| PREDICTED: urokinase-type plasminogen activator [Cuculus canorus]  clstr ali  52  39ECHCLNGGTCISYYLFSRINRCVCPEGYTGIHCELDTEST 78
25 2.000e-10gi|674056554|ref|XP_008834769.1| PREDICTED: urokinase-type plasminogen activator [Nannospalax galili]  clstr ali  72  31NCGCQNGGICVSYKYFSNIRRCSCPKRFQGEHCEIDTSKT 70
26 2.000e-10gi|677426995|gb|KFQ28766.1| Urokinase-type plasminogen activator, partial [Mesitornis unicolor]  clstr ali  50  1DCHCLNGGTCISYYFFSRINRCICPEGYTGVYCELDTDST 40
27 2.000e-10gi|560123202|emb|CDJ92166.1| EGF and EGF calcium-binding and CUB domain containing protein [Haemonchus contortus]  clstr ali  37  22NKPCQHGGTC--LPRFGKKYNCLCPPYRTGENCEVDIDE. 58
28 2.000e-10gi|395820478|ref|XP_003783592.1| PREDICTED: urokinase-type plasminogen activator isoform 1 [Otolemur garnettii]  clstr ali  72  30NCGCLNGGTCVTYKHFSNIRRCICPKKFQGEHCEIDTAKT 69
29 2.000e-10gi|432106779|gb|ELK32431.1| Urokinase-type plasminogen activator [Myotis davidii]  clstr ali  82  30.CGCLNGGTCVSYKYFSNIHRCNCPKKFQGEHCEIDTSAT 68
30 2.000e-10gi|554540138|ref|XP_005864719.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Myotis brandtii]  clstr ali  82  33.CGCLNGGTCVSYKYFSNIHRCNCPKKFQGEHCEIDTSAT 71
31 2.000e-10gi|514728917|ref|XP_005015757.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Anas platyrhynchos]  clstr ali  57  35DCHCLNGGTCVTYYLFSRINRCLCPEGYGGLHCEIDDDST 74
32 2.000e-10gi|585665263|ref|XP_006887626.1| PREDICTED: urokinase-type plasminogen activator [Elephantulus edwardii]  clstr ali  72  44DCGCLNGGTCVSYKYFSGIQRCHCPTKFQGEHCEIDTSKT 83
33 2.000e-10gi|632961858|ref|XP_007896991.1| PREDICTED: neurocan core protein [Callorhinchus milii]  clstr ali  39 1446.NPCQNGATCVDGI---NSFTCLCLPSYTGSLCEEDT... 1478
34 3.000e-10gi|557261616|ref|XP_006016364.1| PREDICTED: urokinase-type plasminogen activator [Alligator sinensis]  clstr ali  58  40DCNCLNGGTCISYLLFSGISRCSCPNGYSGNHCEID.... 75
35 3.000e-10gi|678212427|gb|KFV79406.1| Urokinase-type plasminogen activator, partial [Struthio camelus australis]  clstr ali  52  1DCNCLNGGTCITYYLFSRINRCLCPEGYSGIHCEIDTD.. 38
36 3.000e-10gi|254692796|ref|NP_001157065.1| urokinase-type plasminogen activator precursor [Ovis aries]  clstr ali  72  32DCGCLNGGKCVSYKYFSNIQRCSCPKKFQGEYCEIDTSKT 71
37 3.000e-10gi|6679377|ref|NP_032899.1| urokinase-type plasminogen activator precursor [Mus musculus]  clstr ali  70  31NCGCQNGGVCVSYKYFSRIRRCSCPRKFQGEHCEIDASKT 70
38 3.000e-10gi|505843936|ref|XP_004615464.1| PREDICTED: urokinase-type plasminogen activator [Sorex araneus]  clstr ali  70  32DCGCLNGGTCVSYKHFSYIRGCLCPSKFEGEHCEIDTSKT 71
39 4.000e-10gi|348575754|ref|XP_003473653.1| PREDICTED: urokinase-type plasminogen activator [Cavia porcellus]  clstr ali  75  29NCGCLNGGTCVSYKYFSSMQRCSCPKKFQGEHCEIDASKT 68
40 5.000e-10gi|706113456|ref|XP_010193687.1| PREDICTED: versican core protein-like, partial [Colius striatus]  clstr ali  41 2978.NPCLNGGTC---YPRGSFYICTCLPGFSGEQCEL..... 3008
41 5.000e-10gi|395501552|ref|XP_003755157.1| PREDICTED: urokinase-type plasminogen activator [Sarcophilus harrisii]  clstr ali  60  30DCGCLNNGVCISYKYF-KIHRCSCPENFIGEHCEIDISQ. 67
42 6.000e-10gi|617589769|ref|XP_007520446.1| PREDICTED: urokinase-type plasminogen activator [Erinaceus europaeus]  clstr ali  75  30NCYCLNGGTCVFYKYFSNIHRCNCPRNFEGEHCEIESSKT 69
43 7.000e-10gi|488568418|ref|XP_004473837.1| PREDICTED: urokinase-type plasminogen activator isoform 1 [Dasypus novemcinctus]  clstr ali  76  33.CGCLNGGTCVSYKYFSNIQRCNCPKNFQGEHCEIDASQT 71
44 7.000e-10gi|402880412|ref|XP_003903795.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Papio anubis]  clstr ali  90  29DCGCLNGGTCMSNKYFSSIHWCNCPKKFGGQHCEIDKSKT 68
45 7.000e-10gi|694653623|ref|XP_009483133.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Pelecanus crispus]  clstr ali  48 1097.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 1136
46 7.000e-10gi|637357393|ref|XP_008119511.1| PREDICTED: tissue-type plasminogen activator [Anolis carolinensis]  clstr ali  51  91...CFNGGRCQQPLYSSNLFICLCPPGFSGKHCEIDAKAT 127
47 7.000e-10gi|504142458|ref|XP_004583665.1| PREDICTED: urokinase-type plasminogen activator [Ochotona princeps]  clstr ali  72  32HCSCLNGGKCVSYKYFSNIWRCDCPKNFQGEHCEIDKSTT 71
48 7.000e-10gi|533151554|ref|XP_005389993.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Chinchilla lanigera]  clstr ali  70  52NCGCLNGGICVSYKYFSSMRRCSCPKKFQGEHCEIDTAKT 91
49 8.000e-10gi|560133881|emb|CDJ85880.1| Cadherin and Laminin G and EGF domain containing protein, partial [Haemonchus contortus]  clstr ali  40 2194EAPCRNGGTCQ---VIDKTYQCTCPPRYSGANCEIDMD.. 2228
50 9.000e-10gi|612045201|ref|XP_007501313.1| PREDICTED: coagulation factor VII isoform X2 [Monodelphis domestica]  clstr ali  47  93.NPCQNGGTCVDQFQ---SYICFCPARFEGRNCETDKD.. 126
51 9.000e-10gi|537273593|gb|ERE92477.1| tissue-type plasminogen activator [Cricetulus griseus]  clstr ali  50  165...CFNGGTCQQALYFSDFV-CQCPDGFVGKRCDIDTRAT 200
52 9.000e-10gi|505796193|ref|XP_004606976.1| PREDICTED: tissue-type plasminogen activator [Sorex araneus]  clstr ali  50  110...CFNGGTCWQPLYFSDFV-CQCPDGFAGKYCEVDTRTT 145
53 1.000e-09gi|119608837|gb|EAW88431.1| coagulation factor IX (plasma thromboplastic component, Christmas disease, hemophilia B), isoform CRA_a [Homo sapiens] :_  clstr ali  45  100.NPCLNGGSCKDDI---NSYECWCPFGFEGKNCELDV... 132
54 1.000e-09gi|524995909|ref|XP_005045753.1| PREDICTED: LOW QUALITY PROTEIN: coagulation factor IX [Ficedula albicollis]  clstr ali  40  93.NPCQNGAVCKDQI---NSYVCWCPAGYEGKNCEID.... 124
55 1.000e-09gi|156345300|ref|XP_001621318.1| hypothetical protein NEMVEDRAFT_v1g145311 [Nematostella vectensis]  clstr ali  47  78.CPCQNGGTCYPHPYYSGQYECACPKGFNGSRCEINIDE. 118
56 1.000e-09gi|334346827|ref|XP_001374277.2| PREDICTED: coagulation factor VII isoform X1 [Monodelphis domestica]  clstr ali  47  93.NPCQNGGTCVDQFQ---SYICFCPARFEGRNCETDKD.. 126
57 1.000e-09gi|669302602|gb|KFD46252.1| hypothetical protein M513_12870, partial [Trichuris suis]  clstr ali  33  300NNPCRHGGLCMETY---GGYTCQCPPGWNGHNCEKDIDE. 335
58 1.000e-09gi|397482274|ref|XP_003812356.1| PREDICTED: coagulation factor IX [Pan paniscus]  clstr ali  45  100.NPCLNGGSCKDDI---NSYECWCPFGFEGKNCELDV... 132
59 1.000e-09gi|313676|emb|CAA25806.1| pot. pro-plasminogen activator [Sus scrofa]  clstr ali  75  32NCGCLNGGKCVSYKYFSNIQRCSCPKKFQGEHCEIDTSQT 71
60 1.000e-09gi|699695563|ref|XP_009890012.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Charadrius vociferus]  clstr ali  48 1087.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 1126
61 1.000e-09gi|351714573|gb|EHB17492.1| Urokinase-type plasminogen activator [Heterocephalus glaber]  clstr ali  69  32.CGCLNGGSCVTYKYFSGIRRCNCPKRFQGEHCEIDAWKT 70
62 1.000e-09gi|676284354|gb|KFO37005.1| Urokinase-type plasminogen activator [Fukomys damarensis]  clstr ali  72  31NCGCLNGGRCVTYKYFSKMLRCNCPKKFQGEHCEIDASKT 70
63 1.000e-09gi|723537873|ref|XP_010305281.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Balearica regulorum gibbericeps]  clstr ali  48  912.CGCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 951
64 1.000e-09gi|597885280|gb|EYC34639.1| hypothetical protein Y032_0001g68 [Ancylostoma ceylanicum]  clstr ali  40 3937EAPCTNGGTC---HVIGRTYQCTCPARYTGANCEIDSD.. 3971
65 1.000e-09gi|537273594|gb|ERE92478.1| tissue-type plasminogen activator [Cricetulus griseus]  clstr ali  50  165...CFNGGTCQQALYFSDFV-CQCPDGFVGKRCDIDTRAT 200
66 1.000e-09gi|195579808|ref|XP_002079751.1| GD21853 [Drosophila simulans]  clstr ali  35 1176DMPCMNGATCINLEPRLR-YRCICPDGFWGENCEL..... 1209
67 1.000e-09gi|676283119|gb|KFO36418.1| Tissue-type plasminogen activator [Fukomys damarensis]  clstr ali  50  192...CFNGGICRQALYFSDFV-CQCPQGFMGKRCEIDTRAT 227
68 2.000e-09gi|47226544|emb|CAG08560.1| unnamed protein product, partial [Tetraodon nigroviridis]  clstr ali  48  9...CYNGGTCKEAVYTSD-YICQCPPGFSGTHCEINTQE. 43
69 2.000e-09gi|585649367|ref|XP_006814375.1| PREDICTED: uncharacterized protein LOC102805267 [Saccoglossus kowalevskii]  clstr ali  39  113.NPCQNNGTCLEDY---GYYRCQCPYGFTGYDCETDI... 145
70 2.000e-09gi|309363588|emb|CAP26454.2| Protein CBG05891 [Caenorhabditis briggsae]  clstr ali  29 1017..PCQNGGECEDIIGPPNSYNCTCTPQWTGTNCTTDVDE. 1053
71 2.000e-09gi|637319501|ref|XP_008112480.1| PREDICTED: urokinase-type plasminogen activator [Anolis carolinensis]  clstr ali  54  41.CNCLNGGTCITYHLFSRMKRCVCPEGYSGDHCEID.... 75
72 2.000e-09gi|308453821|ref|XP_003089596.1| hypothetical protein CRE_30572 [Caenorhabditis remanei]  clstr ali  32  857..PCQNGGECEDIIGPPNSYNCTCTPQWTGTNCTIDVDE. 893
73 2.000e-09gi|675606377|ref|XP_008947026.1| PREDICTED: urokinase-type plasminogen activator [Merops nubicus]  clstr ali  48  40.CHCLNGGTCITYYYFTGINRCICPKGYTGTYCELETD.. 76
74 2.000e-09gi|149414214|ref|XP_001510562.1| PREDICTED: urokinase-type plasminogen activator [Ornithorhynchus anatinus]  clstr ali  71  36.CHCQNGGECVSYKLFSRIHRCNCPKGFEGEHCEID.... 70
75 2.000e-09gi|530564439|ref|XP_005278798.1| PREDICTED: urokinase-type plasminogen activator [Chrysemys picta bellii]  clstr ali  59  40DCNCVNGGTCISYQLFSRINRCLCPKGYSGQHCEIDT... 76
76 2.000e-09gi|507644906|ref|XP_004631267.1| PREDICTED: coagulation factor VII [Octodon degus]  clstr ali  37  102.NPCQNGGTCQDHHQL---YICFCLLGFSGRNCETN.... 133
77 2.000e-09gi|537270935|gb|ERE91955.1| urokinase-type plasminogen activator-like protein [Cricetulus griseus]  clstr ali  70  48NCGCQNGGICVSYKYFSSIRRCSCPKRFQGEHCEIDTSKT 87
78 2.000e-09gi|541986183|ref|XP_005444584.1| PREDICTED: versican core protein [Falco cherrug]  clstr ali  37 3213.NPCRNGATCIDGL---NTFTCLCLPSYTGALCEQDT-ET 3247
79 2.000e-09gi|532111341|ref|XP_005340367.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Ictidomys tridecemlineatus]  clstr ali  55  98...CFNGGTCWQAIYFSD-FVCQCPEGFAGKRCEIDTSAT 133
80 2.000e-09gi|558177120|ref|XP_006126415.1| PREDICTED: urokinase-type plasminogen activator [Pelodiscus sinensis]  clstr ali  63  40DCNCLNGGTCISYQLFSRINRCLCPKEYTGQHCEID.... 75
81 2.000e-09gi|529449036|ref|XP_005244206.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Falco peregrinus]  clstr ali  46 1029NNPCLHGGTCRAN---GTVCGCSCTPGFTGENCEI..... 1060
82 2.000e-09gi|156399381|ref|XP_001638480.1| predicted protein [Nematostella vectensis]  clstr ali  42 2854ENPCLNGGTCHDTVP-AGWRVCQCPRGYRGPHCE...... 2886
83 2.000e-09gi|723147665|ref|XP_010291115.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Phaethon lepturus]  clstr ali  45 1121.CSCLNAGTCVTNIKFPGEYLCLCPNGFDGEFCQEDID.. 1160
84 2.000e-09gi|568953902|ref|XP_006509090.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Mus musculus]  clstr ali  50  186...CFNGGTCQQALYFSDFV-CQCPDGFVGKRCDIDTRAT 221
85 3.000e-09gi|119608840|gb|EAW88434.1| coagulation factor IX (plasma thromboplastic component, Christmas disease, hemophilia B), isoform CRA_d [Homo sapiens] :_  clstr ali  45  100.NPCLNGGSCKDDI---NSYECWCPFGFEGKNCELDV... 132
86 3.000e-09gi|47226546|emb|CAG08562.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  48  40...CYNGGTCKEAVYTSD-YICQCPPGFSGTHCEINTQE. 74
87 3.000e-09gi|602714709|ref|XP_007467567.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Lipotes vexillifer]  clstr ali  79  33.CGCLNGGKCVSYKYFSNIQRCNCPKKFQGEHCEIDTSKT 71
88 3.000e-09gi|617436128|ref|XP_007563499.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Poecilia formosa]  clstr ali  48  114...CYNGGTCKEAVYSSN-YICQCPPGFSGAQCEINTNE. 148
89 3.000e-09gi|260791920|ref|XP_002590975.1| hypothetical protein BRAFLDRAFT_69474 [Branchiostoma floridae]  clstr ali  38  275.NPCQNGGMCSDGL---NSYVCHCTAGFEGDNCETDMD.. 308
90 3.000e-09gi|704293650|ref|XP_010160573.1| PREDICTED: urokinase-type plasminogen activator-like [Caprimulgus carolinensis]  clstr ali  44  39ECHCLNGGICIAYYLFSRVSRCVCPEGYTGIHCELDTD.. 76
91 3.000e-09gi|669327331|gb|KFD67533.1| hypothetical protein M514_20210 [Trichuris suis]  clstr ali  33  793NNPCRHGGLCMETY---GSYTCQCPPGWNGHNCEKDIDE. 828
92 3.000e-09gi|548488963|ref|XP_005687848.1| PREDICTED: coagulation factor VII [Capra hircus]  clstr ali  41  105..PCQNGGSCEDQLQ---AYICFCPDGFEGRNCETD.... 135
93 3.000e-09gi|657558042|ref|XP_008283120.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Stegastes partitus]  clstr ali  45  115...CYNGGTCKEAVYTSD-YICQCPPGFSGTQCEINTNE. 149
94 3.000e-09gi|678219434|gb|KFV86413.1| Coagulation factor IX, partial [Struthio camelus australis]  clstr ali  40  73.NPCKNGATCKDAV---SSYVCWCPAGYEGRNCEID.... 104
95 3.000e-09gi|164419019|gb|ABY54817.1| c-type lectin [Branchiostoma japonicum]  clstr ali  38  149..PCHNGATCQDG---ANSLTCRCAPGYTGIHCETDIDE. 182
96 3.000e-09gi|507548357|ref|XP_004658004.1| PREDICTED: urokinase-type plasminogen activator [Jaculus jaculus]  clstr ali  77  31NCGCLNGGTCVTYKYFSHILRCSCPKKFQGEHCEIDKSKT 70
97 3.000e-09gi|465984463|gb|EMP36560.1| Fibulin-7 [Chelonia mydas]  clstr ali  43  193.NPCQNGGTCVDGI---NQYKCTCPQGWTGENCQ...... 222
98 3.000e-09gi|537228294|gb|ERE83561.1| versican core protein-like isoform 1 [Cricetulus griseus]  clstr ali  40 3110.NPCRNGATCVDG---FNTFRCLCLPSYTGALCEQDT-ET 3144
99 3.000e-09gi|471397455|ref|XP_004382139.1| PREDICTED: tissue-type plasminogen activator [Trichechus manatus latirostris]  clstr ali  52  91...CFNGGTCRQALYFSD-FVCQCPEGFTGKRCEIDTKAT 126
100 3.000e-09gi|705697712|ref|XP_010124699.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Chlamydotis macqueenii]  clstr ali  48  958.CGCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDTN.. 997
101 3.000e-09gi|395857515|ref|XP_003801137.1| PREDICTED: tissue-type plasminogen activator [Otolemur garnettii]  clstr ali  52  187...CFNGGTCWQALYFS-HFVCQCPEGFTGTRCEIDARAT 222
102 3.000e-09gi|195344746|ref|XP_002038940.1| GM17110 [Drosophila sechellia]  clstr ali  35 1696DLPCLNGATCINLEPRLR-YRCICPEGYWGENCEL..... 1729
103 4.000e-09gi|701413527|ref|XP_009999053.1| PREDICTED: urokinase-type plasminogen activator [Chaetura pelagica]  clstr ali  56  39ECPCLNGGTCITY-YFSKISRCMCPEGYAGIHCEIDTTST 77
104 4.000e-09gi|118403542|ref|NP_001072819.1| coagulation factor VII precursor [Xenopus (Silurana) tropicalis]  clstr ali  40  115.NPCMNGGTCFDQHQ---SYICTCPMGYEGRHCETN.... 146
105 4.000e-09gi|557007638|ref|XP_006005097.1| PREDICTED: urokinase-type plasminogen activator-like [Latimeria chalumnae]  clstr ali  58  39.CDCLNGGSCVRHEYFPTYSYCLCPKGFSGRHCETDT... 74
106 4.000e-09gi|130492452|ref|NP_001076238.1| tissue-type plasminogen activator precursor [Oryctolagus cuniculus]  clstr ali  51  92...CLNGGTCSQALYFSDFV-CQCPEGFVGKRCEVDTRA. 126
107 4.000e-09gi|488596122|ref|XP_004483245.1| PREDICTED: tissue-type plasminogen activator [Dasypus novemcinctus]  clstr ali  52  92...CFNGGTCLQALYFSDFV-CQCPEGFVGKSCEIEASAT 127
108 5.000e-09gi|532049887|ref|XP_005367711.1| PREDICTED: urokinase-type plasminogen activator [Microtus ochrogaster]  clstr ali  75  35NCGCLNGGICVSYKYFSSIRRCNCPKRFQGEHCEIDTSKT 74
109 5.000e-09gi|405973660|gb|EKC38361.1| Versican core protein [Crassostrea gigas]  clstr ali  40  21.NSCQNGGTCHNG---NNQYTCSCLPGWTGTNCEIDIDE. 55
110 5.000e-09gi|704290327|ref|XP_010175952.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Caprimulgus carolinensis]  clstr ali  48 1064.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 1103
111 5.000e-09gi|704590597|ref|XP_010191453.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Mesitornis unicolor]  clstr ali  45  977.CSCLHGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDTN.. 1016
112 5.000e-09gi|270008137|gb|EFA04585.1| cadherin-N [Tribolium castaneum]  clstr ali  46  842..PCLNGGTCVNLEPRFR-YRCHCPDGFWGENCEL..... 873
113 5.000e-09gi|704489544|ref|XP_010075200.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Pterocles gutturalis]  clstr ali  48 1087.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDVN.. 1126
114 5.000e-09gi|499014620|ref|XP_004537828.1| PREDICTED: neural-cadherin-like [Ceratitis capitata]  clstr ali  35 1498DLPCLNGATCINLEPRLR-YRCICPEGYWGENCEL..... 1531
115 6.000e-09gi|405974181|gb|EKC38847.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Crassostrea gigas]  clstr ali  38  61.NPCQNGATCVDEL---NRYSCTCQPGYQGTNCET..... 91
116 6.000e-09gi|326923580|ref|XP_003208013.1| PREDICTED: urokinase-type plasminogen activator-like [Meleagris gallopavo]  clstr ali  54  40.CHCLNGGTCITYQFFSQMKRCLCPEGYGGLHCEIDTD.. 76
117 6.000e-09gi|565313756|gb|ETE66008.1| Urokinase-type plasminogen activator, partial [Ophiophagus hannah]  clstr ali  55  1.CGCLNGGTCLTYGLFSQIKFCLCPEGYDGDHCEIDV... 36
118 6.000e-09gi|431902225|gb|ELK08726.1| Tissue-type plasminogen activator [Pteropus alecto]  clstr ali  55  110...CFNGGTCRQALYFSD-FVCQCPEGFSGKLCEIDASAT 145
119 6.000e-09gi|1351379|sp|P98119.1|URT1_DESRO RecName: Full=Salivary plasminogen activator alpha 1; AltName: Full=DSPA alpha-1; Flags: Precursor [Desmodus rotund  clstr ali  47  92...CFNGGTCWQAVYFSD-FVCQCPAGYTGKRCEVDTRAT 127
120 6.000e-09gi|674085457|ref|XP_008850515.1| PREDICTED: tissue-type plasminogen activator isoform X3 [Nannospalax galili]  clstr ali  50  42...CFNGGTCWQALYFSDFV-CQCPDGFVGKRCDIDTGAT 77
121 6.000e-09gi|301765976|ref|XP_002918410.1| PREDICTED: tissue-type plasminogen activator-like isoform 3 [Ailuropoda melanoleuca]  clstr ali  52  91...CFNGGMCRQALYFSDFV-CQCPEGFLGKRCEIDASAT 126
122 7.000e-09gi|669302141|gb|KFD45828.1| hypothetical protein M513_13293 [Trichuris suis]  clstr ali  33  405NNPCRHGGLCMETY---GGYTCQCPPGWNGHNCEKDIDE. 440
123 7.000e-09gi|548461902|ref|XP_005678918.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1, partial [Capra hircus]  clstr ali  46  153ENPCQNGGTCVPGE---DAHSCDCSPGFKGRHCEL..... 184
124 8.000e-09gi|156350060|ref|XP_001622124.1| predicted protein [Nematostella vectensis]  clstr ali  37  143.NPCKNGGTCH--FKSPGVFSCTCAAGFSGNQCETDID.. 177
125 8.000e-09gi|617455395|ref|XP_007570093.1| PREDICTED: neurocan core protein-like isoform X1 [Poecilia formosa]  clstr ali  43 1084.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKD.... 1115
126 8.000e-09gi|667266766|ref|XP_008569429.1| PREDICTED: tissue-type plasminogen activator [Galeopterus variegatus]  clstr ali  55  92...CFNGGTCRQALYFSD-FVCQCPEGFVGKRCEIDASAT 127
127 8.000e-09gi|507946875|ref|XP_004682333.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Condylura cristata]  clstr ali  52  90...CFNGGTCWQALYFSD-FVCQCPEGFVGKRCEIDTRAT 125
128 8.000e-09gi|194880373|ref|XP_001974422.1| GG21727 [Drosophila erecta]  clstr ali  35 1616DLPCLNGATCINLEPRLR-YRCICPEGYWGENCEL..... 1649
129 8.000e-09gi|2499868|sp|Q28198.1|TPA_BOVIN RecName: Full=Tissue-type plasminogen activator; Short=t-PA; Short=t-plasminogen activator; Short=tPA; Contains: Rec  clstr ali  50  92...CFNGGTCRQALYSSDFV-CQCPEGFMGKLCEIDATAT 127
130 8.000e-09gi|542158519|ref|XP_005488009.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Zonotrichia albicollis]  clstr ali  45 1070.CSCLNGGTCVTNIKYPGEYLCLCPNGFDGEFCQEDTR.. 1109
131 8.000e-09gi|562823864|ref|XP_006141725.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Tupaia chinensis]  clstr ali  47  88...CFNGGACRQALYFSDFV-CQCPEGFVGKRCEVDTRAT 123
132 8.000e-09gi|640793626|ref|XP_008052797.1| PREDICTED: tissue-type plasminogen activator [Tarsius syrichta]  clstr ali  47  88...CFNGGTCWQALYFSDFV-CQCPEGYLGKRCEVDARVT 123
133 9.000e-09gi|657740904|ref|XP_008305518.1| PREDICTED: neurocan core protein [Cynoglossus semilaevis]  clstr ali  42 1077.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1109
134 9.000e-09gi|584036621|ref|XP_006765598.1| PREDICTED: tissue-type plasminogen activator [Myotis davidii]  clstr ali  58  92...CFNGGTCRQALYFSN-FVCQCPEGFSGQLCEIDARAT 127
135 1.000e-08gi|432906540|ref|XP_004077580.1| PREDICTED: fibulin-7-like [Oryzias latipes]  clstr ali  39  147.NPCQNGGTCVEGV---NHYRCTCPQSWSGSHCQTDVNE. 185
136 1.000e-08gi|260826540|ref|XP_002608223.1| hypothetical protein BRAFLDRAFT_87876 [Branchiostoma floridae]  clstr ali  42  296..PCQNGGQCIDDV---NSFRCRCPTGYSGDLCEIDID.. 328
137 1.000e-08gi|410923004|ref|XP_003974972.1| PREDICTED: tissue-type plasminogen activator-like [Takifugu rubripes]  clstr ali  48  84...CYNGGTCKEAVYTSD-YICQCPTGFSGTHCEINTNE. 118
138 1.000e-08gi|675429966|ref|XP_008928984.1| PREDICTED: LOW QUALITY PROTEIN: coagulation factor IX [Manacus vitellinus]  clstr ali  40  93.NPCKNGAVCKDGI---NSYVCWCPAGYEGRNCEID.... 124
139 1.000e-08gi|156353169|ref|XP_001622947.1| predicted protein [Nematostella vectensis]  clstr ali  39  93ECPCQHGGTCHPHPYHSGQYECAFPAGFNGSRCESDID.. 133
140 1.000e-08gi|431839286|gb|ELK01213.1| Protein delta like protein 1 [Pteropus alecto]  clstr ali  42  60..PCQHGGTCVDEDGRASHASCLCPPGFSGNFCEI..... 92
141 1.000e-08gi|657530701|ref|XP_008298822.1| PREDICTED: neurocan core protein [Stegastes partitus]  clstr ali  42 1103.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1135
142 1.000e-08gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Gallus gallus]  clstr ali  40 1022..PCQNGGTCIDEV---NAFVCLCLPSYSGSRCEKDT... 1053
143 1.000e-08gi|478492167|ref|XP_004420448.1| PREDICTED: versican core protein isoform 1 [Ceratotherium simum simum]  clstr ali  37 3138.NPCRNGATCIDG---FNTFRCLCLPSYVGALCEQD-NET 3172
144 1.000e-08gi|719757816|ref|XP_010215301.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Tinamus guttatus]  clstr ali  48  585.CSCVNGGTCVTNIKFPGEYLCLCPNGFDGEFCEEDIN.. 624
145 1.000e-08gi|326923110|ref|XP_003207784.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Meleagris gallopavo]  clstr ali  47 1090.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGGLCQEDINE. 1130
146 1.000e-08gi|642123698|emb|CDQ62744.1| unnamed protein product [Oncorhynchus mykiss]  clstr ali  45  87...CYNGGTCKEAVYSSD-FLCQCPPGFTGAQCEINTNE. 121
147 1.000e-08gi|686584708|ref|XP_009278249.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Aptenodytes forsteri]  clstr ali  44 1085.CSCLSGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDINE. 1125
148 1.000e-08gi|498969091|ref|XP_004547069.1| PREDICTED: tissue-type plasminogen activator-like isoform X1 [Maylandia zebra]  clstr ali  45  114...CYNGGTCKEAVYTSD-YICQCPRGFTGAQCEINTNE. 148
149 1.000e-08gi|541954079|ref|XP_005433255.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Falco cherrug]  clstr ali  48 1218.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 1257
150 1.000e-08gi|562823862|ref|XP_006141724.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Tupaia chinensis]  clstr ali  47  88...CFNGGACRQALYFSDFV-CQCPEGFVGKRCEVDTRAT 123
151 1.000e-08gi|558117097|ref|XP_006113300.1| PREDICTED: LOW QUALITY PROTEIN: tissue-type plasminogen activator [Pelodiscus sinensis]  clstr ali  43  86...CYNGGRCKQALYSPLHFICQCHAGFSGKHCEIDMEAT 122
152 2.000e-08gi|557760921|ref|XP_005180180.1| PREDICTED: epidermal growth factor-like protein 8-like, partial [Musca domestica]  clstr ali  50  92...CQNGGTCT------GHDSCSCPAGFTGRYCEIDIDE. 121
153 2.000e-08gi|533205219|ref|XP_005415083.1| PREDICTED: protein delta homolog 1-like isoform X1 [Chinchilla lanigera]  clstr ali  38  148..PCQHGGTCVDDEGRASHASCLCPPGFSGSFCEIMTN.. 183
154 2.000e-08gi|397526111|ref|XP_003832982.1| PREDICTED: protein delta homolog 1 [Pan paniscus]  clstr ali  42  292..PCQHGGTCVDDEGRASHASCLCPPGFSGNFCEI..... 324
155 2.000e-08gi|688609294|ref|XP_009294615.1| PREDICTED: neurocan core protein [Danio rerio]  clstr ali  42  994.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1026
156 2.000e-08gi|507687448|ref|XP_004641029.1| PREDICTED: versican core protein [Octodon degus]  clstr ali  40 3230.NPCRNGATCVDG---FNTFRCLCLPSYVGSLCEQDT-ET 3264
157 2.000e-08gi|344272704|ref|XP_003408171.1| PREDICTED: versican core protein isoform 1 [Loxodonta africana]  clstr ali  40 3125.NPCRNGATCVDG---FNTFTCLCLPSYVGALCEQDT-ET 3159
158 2.000e-08gi|704478013|ref|XP_010072761.1| PREDICTED: versican core protein-like [Pterocles gutturalis]  clstr ali  37 1905.NPCRNGATCIDGL---NTFTCLCLPSYVGALCEQDT-ET 1939
159 2.000e-08gi|557276309|ref|XP_006021306.1| PREDICTED: versican core protein [Alligator sinensis]  clstr ali  40 3347.NPCRNGATCVDGI---NTFICLCLPSYVGALCERDT-ET 3381
160 2.000e-08gi|585673837|ref|XP_006889930.1| PREDICTED: versican core protein precursor isoform X1 [Elephantulus edwardii]  clstr ali  40 3095.NPCRNGATCVDG---FNTFTCLCLPSYVGALCEQDT-ET 3129
161 2.000e-08gi|727058934|ref|XP_010408162.1| PREDICTED: versican core protein isoform X1 [Corvus cornix cornix]  clstr ali  37 3224.NPCRNGATCIDGL---NTFTCLCLPSYVGALCEQDT-ET 3258
162 2.000e-08gi|699586658|ref|XP_009864862.1| PREDICTED: versican core protein-like, partial [Apaloderma vittatum]  clstr ali  37 3006.NPCRNGATCIDGL---NTFTCLCLPSYVGALCEQDT-ET 3040
163 2.000e-08gi|700346546|ref|XP_009917272.1| PREDICTED: LOW QUALITY PROTEIN: versican core protein-like, partial [Haliaeetus albicilla]  clstr ali  37 1879.NPCRNGATCIDGL---NTFTCLCLPSYVGALCEQDT-ET 1913
164 2.000e-08gi|719755065|ref|XP_010214361.1| PREDICTED: versican core protein-like [Tinamus guttatus]  clstr ali  37 1897.NPCRNGATCIDGL---NTFTCVCLPSYIGTLCEQDT-ET 1931
165 2.000e-08gi|261869973|gb|ACY02334.1| tissue plasminogen activator [synthetic construct]  clstr ali  52  84...CFNGGTCQQALYFSD-FVCQCPEGFAGKCCEIDTRAT 119
166 2.000e-08gi|513195365|ref|XP_004943060.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like isoform X5 [Gallus gallus]  clstr ali  47 1142.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGGFCQEDINE. 1182
167 2.000e-08gi|208879560|gb|ACI31317.1| plasminogen activator [Carollia perspicillata]  clstr ali  50  92...CFNGGTCRQLLYFSD-FVCQCPEGYTGKLCEVDASAT 127
168 2.000e-08gi|113205804|ref|NP_001038056.1| coagulation factor VII precursor [Sus scrofa]  clstr ali  40  91.NPCLNGGSCEDQLQ---AYICFCPEGFEGRNCETN.... 122
169 2.000e-08gi|683907030|ref|XP_009086484.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Serinus canaria]  clstr ali  45 1079.CSCLSGGTCVTNIKYPGEYLCLCPNGFGGEFCQEDIR.. 1118
170 3.000e-08gi|533205223|ref|XP_005415085.1| PREDICTED: protein delta homolog 1-like isoform X3 [Chinchilla lanigera]  clstr ali  38  148..PCQHGGTCVDDEGRASHASCLCPPGFSGSFCEIMTN.. 183
171 3.000e-08gi|514751416|ref|XP_005020856.1| PREDICTED: neurogenic locus notch homolog protein 3-like [Anas platyrhynchos]  clstr ali  47  38..PCLNGGLCQ---YNQSGYICDCPAGFLGHSCEIDINE. 71
172 3.000e-08gi|260824241|ref|XP_002607076.1| hypothetical protein BRAFLDRAFT_68133 [Branchiostoma floridae]  clstr ali  35  444.NPCQHGGTCHDRI---NSYVCHCQSGYTGDNCET..... 474
173 3.000e-08gi|512942817|ref|XP_004910361.1| PREDICTED: protein delta homolog 1 [Heterocephalus glaber]  clstr ali  42  215..PCQHGGTCVDDEGRASHASCLCPPGFSGNFCEI..... 247
174 3.000e-08gi|533135044|ref|XP_005382409.1| PREDICTED: versican core protein [Chinchilla lanigera]  clstr ali  40 3067.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3101
175 3.000e-08gi|586480267|ref|XP_006870659.1| PREDICTED: versican core protein isoform X1 [Chrysochloris asiatica]  clstr ali  40 3119.NPCRNGATCVDG---FNTFTCLCLPSYIGALCEQDT-ET 3153
176 3.000e-08gi|521036766|gb|EPQ18544.1| Versican core protein [Myotis brandtii]  clstr ali  40 3145.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3179
177 3.000e-08gi|532059655|ref|XP_005315718.1| PREDICTED: versican core protein isoform X1 [Ictidomys tridecemlineatus]  clstr ali  40 3136.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3170
178 3.000e-08gi|704157752|ref|XP_010140278.1| PREDICTED: versican core protein-like [Buceros rhinoceros silvestris]  clstr ali  37 3071.NPCRNGATCIDG---FNTFTCLCLPSYVGVLCEQDT-ET 3105
179 3.000e-08gi|586559970|ref|XP_006913259.1| PREDICTED: versican core protein [Pteropus alecto]  clstr ali  40 3082.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3116
180 3.000e-08gi|655838081|ref|XP_008260129.1| PREDICTED: versican core protein isoform X1 [Oryctolagus cuniculus]  clstr ali  40 3158.NPCRNGATCVDG---FNTFRCLCLPSYVGVLCEQDT-ET 3192
181 3.000e-08gi|504147732|ref|XP_004586278.1| PREDICTED: versican core protein isoform X1 [Ochotona princeps]  clstr ali  40 3094.NPCRNGATCVDG---FNTFSCLCLPSYVGVLCEQDT-ET 3128
182 3.000e-08gi|21431624|sp|Q9ERB4.2|CSPG2_RAT RecName: Full=Versican core protein; AltName: Full=Chondroitin sulfate proteoglycan core protein 2; Short=Chondroit  clstr ali  40 2476.NPCRNGATCVDGL---NTFRCLCLPSYVGALCEQDT-ET 2510
183 3.000e-08gi|62088562|dbj|BAD92728.1| chondroitin sulfate proteoglycan 2 (versican) variant [Homo sapiens]  clstr ali  40 3148.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3182
184 3.000e-08gi|667286264|ref|XP_008576087.1| PREDICTED: versican core protein isoform X3 [Galeopterus variegatus]  clstr ali  40 3142.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3176
185 3.000e-08gi|674087306|ref|XP_008851510.1| PREDICTED: versican core protein isoform X1 [Nannospalax galili]  clstr ali  40 3134.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3168
186 3.000e-08gi|593721994|ref|XP_007107224.1| PREDICTED: versican core protein isoform X1 [Physeter catodon]  clstr ali  40 3134.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3168
187 3.000e-08gi|330340395|ref|NP_001193358.1| versican core protein precursor [Sus scrofa]  clstr ali  40 3120.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3154
188 3.000e-08gi|562827883|ref|XP_006143545.1| PREDICTED: versican core protein isoform X2 [Tupaia chinensis]  clstr ali  40 3114.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3148
189 3.000e-08gi|488596647|ref|XP_004483499.1| PREDICTED: versican core protein [Dasypus novemcinctus]  clstr ali  40 3108.NPCRNGATCVDG---FNTFRCLCLPSYVGALCERDT-ET 3142
190 3.000e-08gi|402872034|ref|XP_003899948.1| PREDICTED: LOW QUALITY PROTEIN: versican core protein [Papio anubis]  clstr ali  40 3062.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3096
191 3.000e-08gi|507934504|ref|XP_004678485.1| PREDICTED: versican core protein [Condylura cristata]  clstr ali  40 2982.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3016
192 3.000e-08gi|148668663|gb|EDL00982.1| mCG116562, isoform CRA_b [Mus musculus]  clstr ali  40 3151.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3185
193 3.000e-08gi|507649785|ref|XP_004703706.1| PREDICTED: versican core protein [Echinops telfairi]  clstr ali  37 3129.NPCRNGATCIDGL---NTFSCLCLPSYVGALCEQDT-ET 3163
194 3.000e-08gi|471414722|ref|XP_004388895.1| PREDICTED: versican core protein isoform 1 [Trichechus manatus latirostris]  clstr ali  37 3144.NPCRNGATCIDG---FNTFTCLCLPSYVGALCEQDT-ET 3178
195 3.000e-08gi|634875255|ref|XP_007948735.1| PREDICTED: versican core protein isoform X1 [Orycteropus afer afer]  clstr ali  37 3136.NPCRNGATCIDG---FNTFTCLCLPSYVGALCERDT-ET 3170
196 3.000e-08gi|525027791|ref|XP_005061318.1| PREDICTED: versican core protein isoform X2 [Ficedula albicollis]  clstr ali  37 2684.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 2718
197 3.000e-08gi|671027596|ref|XP_008704598.1| PREDICTED: versican core protein isoform X5 [Ursus maritimus]  clstr ali  40 3142.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3176
198 3.000e-08gi|410948928|ref|XP_003981179.1| PREDICTED: versican core protein isoform 1 [Felis catus]  clstr ali  40 3133.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3167
199 3.000e-08gi|589935513|ref|XP_006980528.1| PREDICTED: versican core protein isoform X1 [Peromyscus maniculatus bairdii]  clstr ali  40 3110.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3144
200 3.000e-08gi|532027206|ref|XP_005356579.1| PREDICTED: versican core protein isoform X1 [Microtus ochrogaster]  clstr ali  40 3105.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 3139
201 3.000e-08gi|727058938|ref|XP_010408164.1| PREDICTED: versican core protein isoform X3 [Corvus cornix cornix]  clstr ali  37 2375.NPCRNGATCIDGL---NTFTCLCLPSYVGALCEQDT-ET 2409
202 3.000e-08gi|46048882|ref|NP_990118.1| versican core protein precursor [Gallus gallus]  clstr ali  37 3299.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 3333
203 3.000e-08gi|694835102|ref|XP_009475037.1| PREDICTED: versican core protein isoform X1 [Nipponia nippon]  clstr ali  37 3299.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 3333
204 3.000e-08gi|697493374|ref|XP_009676801.1| PREDICTED: LOW QUALITY PROTEIN: versican core protein [Struthio camelus australis]  clstr ali  37 3250.NPCRNGATCIDGL---NTFTCVCLPSYIGALCEQDT-ET 3284
205 3.000e-08gi|701304749|ref|XP_010013057.1| PREDICTED: versican core protein-like [Nestor notabilis]  clstr ali  37 1888.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 1922
206 3.000e-08gi|700438509|ref|XP_009958420.1| PREDICTED: versican core protein-like, partial [Leptosomus discolor]  clstr ali  37 1859.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 1893
207 3.000e-08gi|704560924|ref|XP_010182696.1| PREDICTED: versican core protein-like, partial [Mesitornis unicolor]  clstr ali  37 1885.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 1919
208 3.000e-08gi|632957377|ref|XP_007894443.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Callorhinchus milii]  clstr ali  47 1193.CGCLNGGTCVTNINFSGEYLCVCPVGFEGEVCQENIDE. 1233
209 3.000e-08gi|573903274|ref|XP_006639360.1| PREDICTED: coagulation factor VII-like [Lepisosteus oculatus]  clstr ali  38  100.NPCQNNGTCVN---SQDAYTCFCPEGFNGRNCEEAIEDT 135
210 3.000e-08gi|602677601|ref|XP_007444246.1| PREDICTED: tissue-type plasminogen activator-like, partial [Python bivittatus]  clstr ali  46  90...CFNGGRCQQALYSPNFFICFCPPGFTGKYCEI..... 121
211 3.000e-08gi|504165749|ref|XP_004592804.1| PREDICTED: tissue-type plasminogen activator [Ochotona princeps]  clstr ali  47  79...CLNGGTCWQAQHFSDFV-CQCPEGFVGKRCDVDTR.. 112
212 3.000e-08gi|585700002|ref|XP_006897052.1| PREDICTED: tissue-type plasminogen activator [Elephantulus edwardii]  clstr ali  50  88...CFNGGICWQAVYFSDFV-CQCPEGFFGKSCEIDAKAT 123
213 3.000e-08gi|61162128|dbj|BAD91053.1| Fc2-cadherin [Folsomia candida]  clstr ali  41 1434DNPCLNNGVC-SNREVPYRYYCECPPGYWGQNCEL..... 1467
214 3.000e-08gi|637333400|ref|XP_008115094.1| PREDICTED: uncharacterized protein LOC103279860 [Anolis carolinensis]  clstr ali  37  119ENLCQNGGTCHQMYLRGGVFRCDCPLHFTGRFCEKDT... 157
215 4.000e-08gi|676274021|gb|KFO28609.1| Crumbs like protein 1 [Fukomys damarensis]  clstr ali  34  419.NPCLHGGNCEDLY---SSYRCSCPLGWAGTHCELNTDE. 453
216 4.000e-08gi|260833750|ref|XP_002611875.1| hypothetical protein BRAFLDRAFT_83101 [Branchiostoma floridae]  clstr ali  45  504.NPCLNGGTCNDFVGF---YNCTCPDSFTGSNCEEDVDE. 538
217 4.000e-08gi|556995575|ref|XP_006001559.1| PREDICTED: protein delta homolog 1 isoform X1 [Latimeria chalumnae]  clstr ali  48  171..PCQNGGTCVDGNGFAHYTSCMCPPGFTGDFCEI..... 203
218 4.000e-08gi|597778159|ref|XP_007252721.1| PREDICTED: neurocan core protein [Astyanax mexicanus]  clstr ali  43 1105..PCQNGGTCIDEI---NSYVCLCLPSYGGATCEKDT... 1136
219 4.000e-08gi|395825586|ref|XP_003786008.1| PREDICTED: versican core protein [Otolemur garnettii]  clstr ali  37 3091.NPCRNGATCIDG---FNTFRCLCLPSYVGALCEQDT-ET 3125
220 4.000e-08gi|602732749|ref|XP_007451766.1| PREDICTED: versican core protein isoform X2 [Lipotes vexillifer]  clstr ali  40 2139.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 2173
221 4.000e-08gi|348587520|ref|XP_003479515.1| PREDICTED: LOW QUALITY PROTEIN: versican core protein [Cavia porcellus]  clstr ali  40 3089.NPCRNGATCVDG---FNTFRCLCLPSYIGALCEQDT-ET 3123
222 4.000e-08gi|525027795|ref|XP_005061320.1| PREDICTED: versican core protein isoform X4 [Ficedula albicollis]  clstr ali  37 2351.NPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 2385
223 4.000e-08gi|472372398|ref|XP_004405681.1| PREDICTED: versican core protein isoform 2 [Odobenus rosmarus divergens]  clstr ali  40 2138.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 2172
224 4.000e-08gi|640802839|ref|XP_008057762.1| PREDICTED: versican core protein isoform X1 [Tarsius syrichta]  clstr ali  37 3133.NPCRNGATCIDG---FNTFRCLCLPSYVGALCEQDT-ET 3167
225 4.000e-08gi|617548474|ref|XP_007518883.1| PREDICTED: versican core protein [Erinaceus europaeus]  clstr ali  37 3028.NPCRNGATCIDG---FNTFRCLCLPSYVGALCEQDT-ET 3062
226 4.000e-08gi|449514773|ref|XP_004174660.1| PREDICTED: versican core protein [Taeniopygia guttata]  clstr ali  37 3190.NPCRNGATCIDSL---NTFTCLCLPSYVGALCEQDT-ET 3224
227 4.000e-08gi|426230094|ref|XP_004009116.1| PREDICTED: versican core protein isoform 1 [Ovis aries]  clstr ali  37 3113.NPCRNGATCIDG---FNTFRCLCLPSYVGALCEQDT-ET 3147
228 4.000e-08gi|560904684|ref|XP_006178701.1| PREDICTED: versican core protein isoform X1 [Camelus ferus]  clstr ali  40 3134.NPCRNGATCVDG---FNTFRCLCLPSYIGALCERDT-ET 3168
229 4.000e-08gi|530589042|ref|XP_005288216.1| PREDICTED: versican core protein isoform X1 [Chrysemys picta bellii]  clstr ali  37 3214.NPCRNGATCIDGL---NLFTCLCLPSYAGALCEQDT-ET 3248
230 4.000e-08gi|700421870|ref|XP_009949206.1| PREDICTED: uncharacterized protein LOC104346213, partial [Leptosomus discolor]  clstr ali  48  101.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGELCQEDTN.. 140
231 4.000e-08gi|568281157|gb|ETN73999.1| EGF-like domain protein [Necator americanus]  clstr ali  40  110..PCQHGGTCL--PRFGNKYNCLCPSYRSGDNCEEDVDE. 144
232 4.000e-08gi|675421298|ref|XP_008924173.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein, partial [Manacus vitellinus]  clstr ali  47 1067.CSCLNGGTCVTNIKHPGEYLCLCPNGFDGEFCQEDI... 1105
233 4.000e-08gi|466083807|ref|XP_004285111.1| PREDICTED: tissue-type plasminogen activator isoform 2 [Orcinus orca]  clstr ali  50  45...CFNRGTCWQALYSSEFV-CQCPEGFIGKRCEIDASAT 80
234 5.000e-08gi|529421617|ref|XP_005230664.1| PREDICTED: protein delta homolog 1 [Falco peregrinus]  clstr ali  41  223..PCQNGGTCIDDNGFAPHASCLCPSGFAGNFCELDRD.. 258
235 5.000e-08gi|533205229|ref|XP_005415088.1| PREDICTED: protein delta homolog 1-like isoform X6 [Chinchilla lanigera]  clstr ali  38  148..PCQHGGTCVDDEGRASHASCLCPPGFSGSFCEIMTN.. 183
236 5.000e-08gi|405974833|gb|EKC39446.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  31  795.NPCQNSATCVDEV---NKYSCTCQPGYQGSQCETETNE. 829
237 5.000e-08gi|499001273|ref|XP_004554939.1| PREDICTED: neurocan core protein-like isoform X1 [Maylandia zebra]  clstr ali  43 1093.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCE...... 1122
238 5.000e-08gi|316980676|dbj|BAJ51987.1| green fluorescnet protein-PG-M/versican (V1) fusion protein [Cloning vector pInSRT-GFPV1]  clstr ali  40 2409.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 2443
239 5.000e-08gi|465961939|gb|EMP29546.1| Versican core protein [Chelonia mydas]  clstr ali  37 3419.NPCRNGATCIDGL---NLFTCLCLPSYVGALCEQDT-ET 3453
240 5.000e-08gi|395507536|ref|XP_003758079.1| PREDICTED: tissue-type plasminogen activator [Sarcophilus harrisii]  clstr ali  56  83...CFNGGTCQQALYFSD-FICQCPRGFSGKQCEID.... 114
241 5.000e-08gi|612025833|ref|XP_007491955.1| PREDICTED: delta-like protein 3 [Monodelphis domestica]  clstr ali  37  174DGPCFNGGTCVDG-GAPAGYTCRCPPGFHGSNCEKKMD.. 210
242 5.000e-08gi|194374979|dbj|BAG62604.1| unnamed protein product [Homo sapiens]  clstr ali  52  91...CFNGGTCQQALYFSD-FVCQCPEGFAGKCCEIDTRAT 126
243 5.000e-08gi|696999584|ref|XP_009565960.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Cuculus canorus]  clstr ali  48 1344.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQKDVN.. 1383
244 5.000e-08gi|701411752|ref|XP_009998690.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Chaetura pelagica]  clstr ali  48 1080.CSCLNGGTCVTNIKFPGEYLCLCPNAFDGDFCQEDTN.. 1119
245 6.000e-08gi|584062310|ref|XP_006775572.1| PREDICTED: versican core protein [Myotis davidii]  clstr ali  40 2136.NPCRNGATCVDG---FNTFSCLCLPSYVGALCEQDT-ET 2170
246 6.000e-08gi|545878910|ref|XP_005657704.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Sus scrofa]  clstr ali  52  107...CFNGGTCLQAVYFSD-FVCQCPVGFIGRQCEIDARAT 142
247 6.000e-08gi|512850564|ref|XP_002939057.2| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Xenopus (Silurana) tropicalis]  clstr ali  39 1186.CGCINGGSCVTNINFPGEYLCLCPNGFEGDNCQVNIDE. 1226
248 6.000e-08gi|542179787|ref|XP_005495992.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Zonotrichia albicollis]  clstr ali  38  45.NKCYNGGRCSQAYYSPQLFVCQCHPGFSGKQCEIDT... 80
249 6.000e-08gi|543375353|ref|XP_005530889.1| PREDICTED: tissue-type plasminogen activator [Pseudopodoces humilis]  clstr ali  37  218.NKCYNGGQCSQAYYSPQLFICQCHQGFSGKQCEIDTE.. 254
250 6.000e-08gi|611981376|ref|XP_007476457.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Monodelphis domestica]  clstr ali  48  87...CFNGGTCKQALYFPDF-ICHCPRGFAGKQCEIDSNS. 121
251 7.000e-08gi|663274091|ref|XP_008495951.1| PREDICTED: neurocan core protein [Calypte anna]  clstr ali  43  892..PCQNGGTCIDEV---NSFICLCLPSYGGSRCEKDT... 923
252 7.000e-08gi|545185442|ref|XP_005599641.1| PREDICTED: versican core protein isoform X3 [Equus caballus]  clstr ali  37 2141.NPCRNGATCIDG---FNTFRCLCLPSYIGALCEQDT-ET 2175
253 7.000e-08gi|637311416|ref|XP_008110901.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Anolis carolinensis]  clstr ali  44 1201.CNCLNGGSCVTNTNFSGKYLCVCLPGFEGRYCQEDIDE. 1241
254 7.000e-08gi|617601074|ref|XP_007522819.1| PREDICTED: tissue-type plasminogen activator [Erinaceus europaeus]  clstr ali  47  88...CFNGGTCQQALYFPD-FVCQCPEGFTGKLCEVDATAT 123
255 7.000e-08gi|507652465|ref|XP_004633125.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Octodon degus]  clstr ali  56  88...CFNGGTCRQALYFSD-FVCQCPEGFMGKRCEID.... 119
256 7.000e-08gi|208879564|gb|ACI31319.1| plasminogen activator [Diaemus youngi]  clstr ali  44  92...CFNGGTCWEALHFSEFV-CQCPERYTGKWCEVDTHAT 127
257 7.000e-08gi|586458538|ref|XP_006859988.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Chrysochloris asiatica]  clstr ali  42  91...CFNGGICRQALYFPDFV-CQCPEGYMGKRCEIDAKA. 125
258 8.000e-08gi|390335713|ref|XP_797176.3| PREDICTED: tenascin-N-like [Strongylocentrotus purpuratus]  clstr ali  39 1774..PCLNGATCLNAVT---IFICQCAPGFQGTRCETRTD.. 1806
259 8.000e-08gi|505839401|ref|XP_004613227.1| PREDICTED: versican core protein isoform X1 [Sorex araneus]  clstr ali  37 2112.NPCRNGATCIDG---FNTFRCLCLPSYVGALCEQDT-ET 2146
260 8.000e-08gi|512816914|ref|XP_002939269.2| PREDICTED: hepatocyte growth factor activator [Xenopus (Silurana) tropicalis]  clstr ali  37  152ENPCEHGGTCH-NIAERGTYHCICPEGYTGKDCEIE.... 186
261 8.000e-08gi|449275177|gb|EMC84120.1| von Willebrand factor D and EGF domain-containing protein, partial [Columba livia]  clstr ali  48 1131.CGCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 1170
262 8.000e-08gi|545878907|ref|XP_005657703.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Sus scrofa]  clstr ali  52  107...CFNGGTCLQAVYFSD-FVCQCPVGFIGRQCEIDARAT 142
263 8.000e-08gi|573874639|ref|XP_006625694.1| PREDICTED: tissue-type plasminogen activator-like [Lepisosteus oculatus]  clstr ali  45  86...CYNGGTCKEAVYSSD-FICQCPPGFTGPQCEINTTE. 120
264 8.000e-08gi|675625023|ref|XP_008940771.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein, partial [Merops nubicus]  clstr ali  47  899.CSCLNGGTCVTNITFPGEYLCLCPNGFDGEFCQEDTNA. 939
265 8.000e-08gi|678201241|gb|KFV68223.1| Tissue-type plasminogen activator [Picoides pubescens]  clstr ali  36  97.NKCYNGGQCSQAYYSPQLFLCQCHQGFSGKQCEIDTEA. 134
266 8.000e-08gi|528761278|gb|EPY80937.1| hypothetical protein CB1_000775021 [Camelus ferus]  clstr ali  50  502EASCINGGTCTASKADS--YICLCPLGFRGRHCE...... 533
267 9.000e-08gi|532059657|ref|XP_005315719.1| PREDICTED: versican core protein isoform X2 [Ictidomys tridecemlineatus]  clstr ali  40 1389.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 1423
268 9.000e-08gi|725551051|ref|XP_010338991.1| PREDICTED: versican core protein isoform X3 [Saimiri boliviensis boliviensis]  clstr ali  40 1381.NPCRNGATCVDGL---NTFRCLCLPSYVGALCERDT-ET 1415
269 9.000e-08gi|686757986|ref|XP_009251331.1| PREDICTED: neurocan core protein, partial [Pongo abelii]  clstr ali  43 1573..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1604
270 9.000e-08gi|637260072|ref|XP_008101214.1| PREDICTED: versican core protein [Anolis carolinensis]  clstr ali  38 2901..PCRNGATCIDGV---NTFTCLCLPSYVGALCEKDT-ET 2934
271 9.000e-08gi|507535312|ref|XP_004651697.1| PREDICTED: versican core protein isoform X1 [Jaculus jaculus]  clstr ali  36 3116.NPCRNGATCIDG---FNTFRCLCLPSYVGALCEQDT... 3148
272 9.000e-08gi|675622650|ref|XP_008939456.1| PREDICTED: versican core protein-like, partial [Merops nubicus]  clstr ali  37 3275.NPCRNGATCIDG---PNTFACLCLPSYVGALCEQDT-ET 3309
273 9.000e-08gi|664706335|ref|XP_008504968.1| PREDICTED: hyaluronan-binding protein 2 isoform X2 [Equus przewalskii]  clstr ali  41  116.NPCQNGGTCSRHRRRS-KFICTCPDGFQGRLCEIGSD.. 151
274 9.000e-08gi|1351381|sp|P98121.1|URTB_DESRO RecName: Full=Salivary plasminogen activator beta; AltName: Full=DSPA beta; Flags: Precursor [Desmodus rotundus] :_  clstr ali  47  46...CFNGGTCWQAASFSD-FVCQCPKGYTGKQCEVDTHAT 81
275 9.000e-08gi|465956696|gb|EMP27063.1| Delta-like protein C [Chelonia mydas]  clstr ali  33  131DGPCFNGGTC--AEKPTGGYTCHCPLGYHGSNCEKKID.. 166
276 9.000e-08gi|471415775|ref|XP_004389413.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Trichechus manatus latiro  clstr ali  52 1181.CDCLNGGSCVSDINFSGVYLCVCLPGFQGGLCEVDISE. 1221
277 9.000e-08gi|669287308|ref|XP_008636484.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Corvus brachyrhynchos]  clstr ali  43 1093.CSCLSGGTCVTNIKYPGEYLCLCPNGFDGEFCQEDTR.. 1132
278 9.000e-08gi|187607167|ref|NP_001120289.1| uncharacterized protein LOC100145345 precursor [Xenopus (Silurana) tropicalis]  clstr ali  38  87ENPCQNGGICQQYHYS---YTCLCPPSYSGRYCE...... 117
279 1.000e-07gi|585652617|ref|XP_006814952.1| PREDICTED: uncharacterized protein LOC102801595 [Saccoglossus kowalevskii]  clstr ali  43  653..PCQNGGTCTDLIA---AYKCNCTDGYNGTNCEI..... 682
280 1.000e-07gi|532055745|ref|XP_005370585.1| PREDICTED: neurocan core protein [Microtus ochrogaster]  clstr ali  43  995..PCENGGTCIDGV---NGFTCLCLPSYGGSLCEKDT... 1026
281 1.000e-07gi|554584444|ref|XP_005883676.1| PREDICTED: versican core protein isoform X2 [Myotis brandtii]  clstr ali  40 1272.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 1306
282 1.000e-07gi|655838090|ref|XP_008260132.1| PREDICTED: versican core protein isoform X4 [Oryctolagus cuniculus]  clstr ali  40 1377.NPCRNGATCVDG---FNTFRCLCLPSYVGVLCEQDT-ET 1411
283 1.000e-07gi|504147736|ref|XP_004586280.1| PREDICTED: versican core protein isoform X3 [Ochotona princeps]  clstr ali  40 1350.NPCRNGATCVDG---FNTFSCLCLPSYVGVLCEQDT-ET 1384
284 1.000e-07gi|562827881|ref|XP_006143544.1| PREDICTED: versican core protein isoform X1 [Tupaia chinensis]  clstr ali  40 1377.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 1411
285 1.000e-07gi|281604094|ref|NP_001164031.1| versican core protein isoform 3 precursor [Rattus norvegicus]  clstr ali  40 1359.NPCRNGATCVDGL---NTFRCLCLPSYVGALCEQDT-ET 1393
286 1.000e-07gi|674087308|ref|XP_008851511.1| PREDICTED: versican core protein isoform X2 [Nannospalax galili]  clstr ali  40 1390.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 1424
287 1.000e-07gi|634875261|ref|XP_007948737.1| PREDICTED: versican core protein isoform X3 [Orycteropus afer afer]  clstr ali  37 1393.NPCRNGATCIDG---FNTFTCLCLPSYVGALCERDT-ET 1427
288 1.000e-07gi|640802843|ref|XP_008057764.1| PREDICTED: versican core protein isoform X3 [Tarsius syrichta]  clstr ali  37 1381.NPCRNGATCIDG---FNTFRCLCLPSYVGALCEQDT-ET 1415
289 1.000e-07gi|511878469|ref|XP_004759183.1| PREDICTED: versican core protein isoform X4 [Mustela putorius furo]  clstr ali  40 1399.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 1433
290 1.000e-07gi|359720333|gb|AEV54351.1| chondroitin sulfate proteoglycan 2 isoform 2 [Xenopus laevis]  clstr ali  33 3593.NPCRNGAACVDGI---DSFKCICLPSYTGSLCEQDT... 3625
291 1.000e-07gi|159024138|gb|ABW87311.1| chondroitin sulfate proteoglycan 2 variant V1a [Xenopus laevis]  clstr ali  33 2685.NPCRNGAACVDGI---DSFKCICLPSYTGSLCEQDT... 2717
292 1.000e-07gi|641759768|ref|XP_008165700.1| PREDICTED: versican core protein isoform X3 [Chrysemys picta bellii]  clstr ali  37 1369.NPCRNGATCIDGL---NLFTCLCLPSYAGALCEQDT-ET 1403
293 1.000e-07gi|532039651|ref|XP_005362683.1| PREDICTED: tissue-type plasminogen activator [Microtus ochrogaster]  clstr ali  50  88...CFNGGTCQQAMYFSD-FVCQCPDGFVGKRCDIDTRAT 123
294 1.000e-07gi|642120549|emb|CDQ64806.1| unnamed protein product [Oncorhynchus mykiss]  clstr ali  48 1115.CDCLNGASCVTNINGSGEYLCVCPAGFTGDRCEEDID.. 1154
295 1.000e-07gi|573897286|ref|XP_006636380.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Lepisosteus oculatus]  clstr ali  42 1185.CGCHNGGTCVTNINFSGRYLCVCAPGFKGDLCQENVDE. 1225
296 1.000e-07gi|557020440|ref|XP_006010543.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Latimeria chalumnae]  clstr ali  42 1195.CGCMNSGTCVTNINFSGEYLCVCPVGFQGEYCQENIDE. 1235
297 1.000e-07gi|344238919|gb|EGV95022.1| Salivary plasminogen activator alpha 2 [Cricetulus griseus]  clstr ali  47  291...CFNGGACQQALYFSDFV-CQCPDGFVGKRCDIDTRAT 326
298 1.000e-07gi|675427144|ref|XP_008927421.1| PREDICTED: tissue-type plasminogen activator [Manacus vitellinus]  clstr ali  37  83.NKCYNGGQCSQAYYSPQLFICQCHQGFSGKQCEIDTE.. 119
299 1.000e-07gi|677288611|gb|KFP71039.1| Salivary plasminogen activator alpha 2, partial [Acanthisitta chloris]  clstr ali  41  1...CYNGGQCSQAYYSPQLFICQCHQGFSGKQCEIDT... 34
300 1.000e-07gi|537257597|gb|ERE89283.1| von Willebrand factor D and EGF domain-containing protein [Cricetulus griseus]  clstr ali  54 1211.CDCLNGGSCVSDRKFSGAYLCVCLPGFHGNLCEVDAS.. 1250
301 1.000e-07gi|345306462|ref|XP_003428469.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Ornithorhynchus anatinus]  clstr ali  48  84...CYNGGTCYQALYFSDF-ICSCPSGFDGKQCEINVNA. 118
302 2.000e-07gi|260836180|ref|XP_002613084.1| hypothetical protein BRAFLDRAFT_125704 [Branchiostoma floridae]  clstr ali  38  227..PCLNSAACQDNV---NYYTCDCTPGYRGVHCEEDIDE. 260
303 2.000e-07gi|410924479|ref|XP_003975709.1| PREDICTED: neurocan core protein-like [Takifugu rubripes]  clstr ali  37  594..PCENGGTCIDKI---DSFLCLCLPSYEGDRCEKDI... 625
304 2.000e-07gi|675744937|ref|XP_008969329.1| PREDICTED: neurocan core protein [Pan paniscus]  clstr ali  43 1028..PCENGGTCIDEV---NGFVCLCLPSYGGSFCEKDT... 1059
305 2.000e-07gi|586480271|ref|XP_006870661.1| PREDICTED: versican core protein isoform X3 [Chrysochloris asiatica]  clstr ali  40 1386.NPCRNGATCVDG---FNTFTCLCLPSYIGALCEQDT-ET 1420
306 2.000e-07gi|585673845|ref|XP_006889932.1| PREDICTED: versican core protein precursor isoform X3 [Elephantulus edwardii]  clstr ali  40 1361.NPCRNGATCVDG---FNTFTCLCLPSYVGALCEQDT-ET 1395
307 2.000e-07gi|573904725|ref|XP_006640084.1| PREDICTED: neurocan core protein-like [Lepisosteus oculatus]  clstr ali  43  877..PCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 908
308 2.000e-07gi|594058009|ref|XP_006053172.1| PREDICTED: versican core protein isoform X4 [Bubalus bubalis]  clstr ali  37 1383.NPCRNGATCIDG---FNTFRCLCLPSYVGALCEQDT-ET 1417
309 2.000e-07gi|560904688|ref|XP_006178703.1| PREDICTED: versican core protein isoform X3 [Camelus ferus]  clstr ali  40 1391.NPCRNGATCVDG---FNTFRCLCLPSYIGALCERDT-ET 1425
310 2.000e-07gi|512813782|ref|XP_002935750.2| PREDICTED: versican core protein isoform X1 [Xenopus (Silurana) tropicalis]  clstr ali  36 3464.NPCRNGAACVDGI---NSFSCICLPSYAGSLCEQDT... 3496
311 2.000e-07gi|632963651|ref|XP_007898000.1| PREDICTED: versican core protein [Callorhinchus milii]  clstr ali  39 2964.NPCRNGATCIDGI---NCFNCVCLPSYGGALCERDT... 2996
312 2.000e-07gi|504143839|ref|XP_004584350.1| PREDICTED: protein delta homolog 1 isoform X2 [Ochotona princeps]  clstr ali  42  136..PCQHGGTCVDDEGRASHASCLCPPGFSGNFCEI..... 168
313 2.000e-07gi|410898553|ref|XP_003962762.1| PREDICTED: protein delta homolog 1-like [Takifugu rubripes]  clstr ali  37  132..PCQNGGTCIDGDGPSAYSSCLCPPGFSGDFCEMLVDS. 168
314 2.000e-07gi|632963508|ref|XP_007897921.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Callorhinchus milii]  clstr ali  48 1196.CNCLNGGSCVINIHFSGEYLCVCPLGFEGKYCEVNID.. 1235
315 2.000e-07gi|432938955|ref|XP_004082562.1| PREDICTED: protein delta homolog 1-like [Oryzias latipes]  clstr ali  40  134..PCQNGGTCVDASGSAASPFCSCPSGFSGDFCEIGVDS. 170
316 2.000e-07gi|338716565|ref|XP_001916629.2| PREDICTED: LOW QUALITY PROTEIN: hyaluronan-binding protein 2 [Equus caballus]  clstr ali  41  155.NPCQNGGTCSRHRRRS-KFICTCPDGFQGRLCEIGSD.. 190
317 2.000e-07gi|391330169|ref|XP_003739536.1| PREDICTED: crumbs homolog 1-like [Metaseiulus occidentalis]  clstr ali  48  14NNPCKNGGTCSPLDDFS-EYQCICPPGFRGGQCE...... 46
318 2.000e-07gi|533205225|ref|XP_005415086.1| PREDICTED: protein delta homolog 1-like isoform X4 [Chinchilla lanigera]  clstr ali  37  148..PCQHGGTCVDDEGRASHASCLCPPGFSGSFCEIMTNS. 184
319 2.000e-07gi|573889380|ref|XP_006632455.1| PREDICTED: protein delta homolog 1-like [Lepisosteus oculatus]  clstr ali  41  117..PCQNGGTCQDYNGSALHPSCLCPPGFNGNFCEIDLD.. 152
320 2.000e-07gi|119583635|gb|EAW63231.1| plasminogen activator, tissue, isoform CRA_a [Homo sapiens]  clstr ali  52  91...CFNGGTCQQALYFSD-FVCQCPEGFAGKCCEIDTRAT 126
321 2.000e-07gi|568257236|gb|ETN65566.1| hypothetical protein AND_002660 [Anopheles darlingi]  clstr ali  43  18..PCLNGGVCVNQEPRLR-YRCDCPDGFWGENCEL..... 49
322 2.000e-07gi|465989184|gb|EMP37951.1| von Willebrand factor D and EGF domain-containing protein, partial [Chelonia mydas]  clstr ali  40 1166.CSCMNGGSCVTNINFPGEYLCICPSGFDGNFCQENIN.. 1205
323 2.000e-07gi|528945700|ref|XP_005205132.1| PREDICTED: neurocan core protein-like isoform X2 [Bos taurus]  clstr ali  46  272ENPCQNGGTCVPGE---DAHSCDCSPGFKGRHCEL..... 303
324 2.000e-07gi|632936980|ref|XP_007896862.1| PREDICTED: urokinase-type plasminogen activator [Callorhinchus milii]  clstr ali  41  83.NKCFHGGRCASQLH-SEHYLCLCPAGYRGKHCEIDVD.. 118
325 2.000e-07gi|525004194|ref|XP_005049792.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Ficedula albicollis]  clstr ali  43 1586.CSCLSGGTCVTNTKHPGEYLCLCPNGFDGEFCQEDIR.. 1625
326 2.000e-07gi|292616627|ref|XP_002663097.1| PREDICTED: tissue-type plasminogen activator [Danio rerio]  clstr ali  48  87...CYNGGTCKEALYSSDF-ICQCPPGFTGTQCEINT... 119
327 2.000e-07gi|59860161|gb|AAX09643.1| mini-agrin [Mus musculus]  clstr ali  45  739DNPCLNGGSCIPREA---TYECLCPGGFSGLHCE...... 769
328 2.000e-07gi|348605110|ref|NP_001025574.2| tissue-type plasminogen activator precursor [Xenopus (Silurana) tropicalis]  clstr ali  50  96...CYNGGRCQQAVY-STHHLCRCPSGFKGEHCETDTKET 131
329 2.000e-07gi|432911068|ref|XP_004078578.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Oryzias latipes]  clstr ali  43 1152.CDCLNGARCVPDASIPAGFRCACPEGFTGRRCEADAD.. 1188
330 2.000e-07gi|699241980|ref|XP_009858422.1| PREDICTED: ficolin-2-like [Ciona intestinalis]  clstr ali  50  159..PCLNGGTCSR---GPNAYTCFCPLGYTGRNCEI..... 188
331 2.000e-07gi|405969700|gb|EKC34654.1| Deleted in malignant brain tumors 1 protein [Crassostrea gigas]  clstr ali  36  285.NPCQNAATCSRDYYYSTNYYCSCPRGYSGRNCE...... 317
332 3.000e-07gi|390369821|ref|XP_001191674.2| PREDICTED: deleted in malignant brain tumors 1 protein-like, partial [Strongylocentrotus purpuratus]  clstr ali  46  460.NPCMNGGNCKDLV---NGYTCSCPEGFIGTHCE...... 489
333 3.000e-07gi|441628676|ref|XP_003275977.2| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Nomascus leucogenys]  clstr ali  43 1128..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1159
334 3.000e-07gi|602673017|ref|XP_007442008.1| PREDICTED: neurocan core protein-like, partial [Python bivittatus]  clstr ali  41 1175.NPCQNGGTCIDDI---NAFVCLCLPSYGGSLC....... 1203
335 3.000e-07gi|327290489|ref|XP_003229955.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Anolis carolinensis]  clstr ali  43 1059..PCQNGGTCIDEI---NAFVCLCLPSYGGNLCERDT... 1090
336 3.000e-07gi|677608344|ref|XP_009068154.1| PREDICTED: LOW QUALITY PROTEIN: versican core protein-like, partial [Acanthisitta chloris]  clstr ali  36 1868.NPCRNGATCIDGL---NTFTCLCLPSYIGALCE...... 1897
337 3.000e-07gi|395827812|ref|XP_003787089.1| PREDICTED: protein delta homolog 1 isoform 1 [Otolemur garnettii]  clstr ali  42  137..PCQNGGSCVDDEGWASHVSCLCPPGFSGNFCEI..... 169
338 3.000e-07gi|514448035|ref|XP_003463172.2| PREDICTED: protein delta homolog 1 [Cavia porcellus]  clstr ali  35  150..PCQHGGTCEDDEGQAFHASCLCPPGFSGNFCEIMTNS. 186
339 3.000e-07gi|504143843|ref|XP_004584352.1| PREDICTED: protein delta homolog 1 isoform X4 [Ochotona princeps]  clstr ali  42  136..PCQHGGTCVDDEGRASHASCLCPPGFSGNFCEI..... 168
340 3.000e-07gi|507631291|ref|XP_004699170.1| PREDICTED: protein delta homolog 1 [Echinops telfairi]  clstr ali  37  139..PCQHGGTCVDDEGRASHASCLCPPGFSGIFCEIMANS. 175
341 3.000e-07gi|556949778|ref|XP_005987458.1| PREDICTED: epidermal growth factor-like protein 7-like isoform X1 [Latimeria chalumnae]  clstr ali  45  111..PCQNGGTC------SKPNRCDCPPGWNGKHCQTDVDE. 141
342 3.000e-07gi|332241010|ref|XP_003269681.1| PREDICTED: tissue-type plasminogen activator isoform 3 [Nomascus leucogenys]  clstr ali  54  91...CFNGGTCQQALYFSDFV-CQCPEGFAGKCCEI..... 121
343 4.000e-07gi|694973757|ref|XP_009433315.1| PREDICTED: neurocan core protein isoform X2 [Pan troglodytes]  clstr ali  43  920..PCENGGTCIDEV---NGFVCLCLPSYGGSFCEKDT... 951
344 4.000e-07gi|667262435|ref|XP_008567951.1| PREDICTED: neurocan core protein [Galeopterus variegatus]  clstr ali  43 1072..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1103
345 4.000e-07gi|585659430|ref|XP_006886026.1| PREDICTED: neurocan core protein [Elephantulus edwardii]  clstr ali  43 1122..PCENGGTCIDEV---NGFVCLCLPSYGGNLCEKDT... 1153
346 4.000e-07gi|512930262|ref|XP_004906629.1| PREDICTED: neurocan core protein, partial [Heterocephalus glaber]  clstr ali  43  974..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1005
347 4.000e-07gi|655900774|ref|XP_008251641.1| PREDICTED: neurocan core protein [Oryctolagus cuniculus]  clstr ali  46 1168..PCENGGTCVDEV---NGFVCLCLPSYGGSLCEKDT... 1199
348 4.000e-07gi|56122258|gb|AAV74280.1| chondroitin sulfate proteoglycan 3 [Saimiri boliviensis]  clstr ali  43  930..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 961
349 4.000e-07gi|634861215|ref|XP_007943679.1| PREDICTED: neurocan core protein [Orycteropus afer afer]  clstr ali  43 1077..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1108
350 4.000e-07gi|1709255|sp|P55066.1|NCAN_MOUSE RecName: Full=Neurocan core protein; AltName: Full=Chondroitin sulfate proteoglycan 3; Flags: Precursor [Mus muscul  clstr ali  43 1006..PCENGGTCIDEV---NGFICLCLPSYGGSLCEKDT... 1037
351 4.000e-07gi|507535316|ref|XP_004651699.1| PREDICTED: versican core protein isoform X3 [Jaculus jaculus]  clstr ali  36 1378.NPCRNGATCIDG---FNTFRCLCLPSYVGALCEQDT... 1410
352 4.000e-07gi|542233937|ref|XP_005455174.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Oreochromis niloticus]  clstr ali  43 1142.CECLNGASCVNLPAGSGEYVCVCPDGFTGKRCEVDID.. 1181
353 4.000e-07gi|545891364|ref|XP_005674391.1| PREDICTED: protein delta homolog 2-like [Sus scrofa]  clstr ali  37  23...CRNGGQCQDDQGFALNYTCRCLAGFVGAHCEVNVD.. 57
354 4.000e-07gi|512949108|ref|XP_004837006.1| PREDICTED: protein delta homolog 1 isoform X2 [Heterocephalus glaber]  clstr ali  42  136..PCQHGGTCVDDEGRASHASCLCPPGFSGNFCEI..... 168
355 4.000e-07gi|527247271|ref|XP_005141961.1| PREDICTED: slit homolog 3 protein-like, partial [Melopsittacus undulatus]  clstr ali  32  14.NPCQNGGTCHLTEANKDGFSCSCLLGYEGERCEINPD.. 50
356 4.000e-07gi|545850058|ref|XP_005667711.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Sus scrofa]  clstr ali  50 1186.CDCLNGGSCVSDIQFSGAYLCVCLPGFQGDLCEEDVTE. 1226
357 4.000e-07gi|542263841|ref|XP_005466557.1| PREDICTED: mucin-17-like, partial [Oreochromis niloticus]  clstr ali  40 1230.NPCRNGGTCVDGLA---SFTCVCLPSYAGLFCE...... 1259
358 4.000e-07gi|573897012|ref|XP_006636244.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Lepisosteus oculatus]  clstr ali  42 1175.CECLNGGSCVTDINFSGEYLCVCPPGLEGERCAVDTDE. 1215
359 4.000e-07gi|22090636|dbj|BAC06838.1| Pf2-cadherin [Ptychodera flava]  clstr ali  46  461..PCLNGGECIDGV---NGYICVCPPGFSGIHCELRT... 492
360 4.000e-07gi|156366074|ref|XP_001626966.1| predicted protein [Nematostella vectensis]  clstr ali  44 1059.CPCINGGVCHPHPYHSGRYTCTCPEGFTGNLCET..... 1095
361 4.000e-07gi|260811932|ref|XP_002600675.1| hypothetical protein BRAFLDRAFT_67738 [Branchiostoma floridae]  clstr ali  50 3647.CDCHNGGTCDYNNTIERVNGCQCLPGFGGEHCEIDIDA. 3689
362 4.000e-07gi|586451040|ref|XP_006834449.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Chrysochloris asiatica]  clstr ali  52 1181.CDCMNGGSCVSDMNFSGVYLCVCLPGFRGGLCEIDTSE. 1221
363 4.000e-07gi|557280183|ref|XP_006023096.1| PREDICTED: tissue-type plasminogen activator [Alligator sinensis]  clstr ali  42  85...CYNGGRCRQALYSPQHFICLCRRGFSGQQCEIDTE.. 119
364 4.000e-07gi|565313393|gb|ETE65746.1| von Willebrand factor D and EGF domain-containing protein, partial [Ophiophagus hannah]  clstr ali  51 1019.CGCLNGGTCITNINFPGEYLCICPSEFEGDHCQ...... 1054
365 4.000e-07gi|544424020|ref|XP_005551373.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Macaca fascicularis]  clstr ali  51 1384.CDCLNGGSCVSDRNFSGVYRCVCLPGFHGSLCEVNTS.. 1423
366 5.000e-07gi|507564614|ref|XP_004665976.1| PREDICTED: neurocan core protein [Jaculus jaculus]  clstr ali  43 1036..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1067
367 5.000e-07gi|513024541|ref|XP_004873483.1| PREDICTED: neurocan core protein [Heterocephalus glaber]  clstr ali  43 1042..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1073
368 5.000e-07gi|30580855|sp|Q28858.1|CSPG2_MACNE RecName: Full=Versican core protein; AltName: Full=Chondroitin sulfate proteoglycan core protein 2; Short=Chondro  clstr ali  37  763.NPCRNGATCADG---FNTFRCLCLPSYVGALCEQDI-ET 797
369 5.000e-07gi|532094688|ref|XP_005333018.1| PREDICTED: neurocan core protein [Ictidomys tridecemlineatus]  clstr ali  43 1049..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1080
370 5.000e-07gi|471404796|ref|XP_004384417.1| PREDICTED: neurocan core protein [Trichechus manatus latirostris]  clstr ali  43 1018..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1049
371 5.000e-07gi|544509858|ref|XP_005588589.1| PREDICTED: neurocan core protein isoform X3 [Macaca fascicularis]  clstr ali  43 1053..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1084
372 5.000e-07gi|344283059|ref|XP_003413290.1| PREDICTED: neurocan core protein [Loxodonta africana]  clstr ali  43 1044..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1075
373 5.000e-07gi|528760277|gb|EPY79936.1| neurocan [Camelus ferus]  clstr ali  40 1099..PCENGGTCIDEV---NAFVCLCLPSYAGSLCEKDT... 1130
374 5.000e-07gi|602647296|ref|XP_007430075.1| PREDICTED: versican core protein [Python bivittatus]  clstr ali  35 2824..PCRNGATCIDGV---STFTCLCLPSYVGALCEKDT-ET 2857
375 5.000e-07gi|405958595|gb|EKC24707.1| Deleted in malignant brain tumors 1 protein [Crassostrea gigas]  clstr ali  37  321HNPCNNGGTCYHNYGYPGYY-CTCPSGYSGRNC....... 352
376 5.000e-07gi|612006466|ref|XP_007487407.1| PREDICTED: versican core protein isoform X1 [Monodelphis domestica]  clstr ali  40 3188.NPCRNGATCVDGF---NTFTCLCLPSYVGALCEQDT-ET 3222
377 5.000e-07gi|694919915|ref|XP_009450940.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein isoform X2 [Pan troglodytes]  clstr ali  54 1184.CDCLNGGSCVSDRNFSGVYLCVCLPGFHGSLCEVDIS.. 1223
378 5.000e-07gi|645026521|ref|XP_008214058.1| PREDICTED: uncharacterized protein LOC100119261 [Nasonia vitripennis]  clstr ali  48  252..PCQNGGVC------SSPGRCTCPKGFTGNYCQIDVDE. 282
379 6.000e-07gi|524972710|ref|XP_005086204.1| PREDICTED: neurocan core protein [Mesocricetus auratus]  clstr ali  43 1006..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1037
380 6.000e-07gi|551530093|ref|XP_005816505.1| PREDICTED: aggrecan core protein-like, partial [Xiphophorus maculatus]  clstr ali  43  533..PCENGGTCVDKI---DSFLCLCLPSYGGDTCEKDV... 564
381 6.000e-07gi|586482595|ref|XP_006871809.1| PREDICTED: neurocan core protein, partial [Chrysochloris asiatica]  clstr ali  43 1026..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1057
382 6.000e-07gi|551511837|ref|XP_005807436.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Xiphophorus maculatus]  clstr ali  44 1185.CGCLNGGTCVTDVSFSGKYLCVCPEGKQGELCGKDMDQ. 1225
383 6.000e-07gi|634831950|ref|XP_007933214.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Orycteropus afer afer]  clstr ali  42  45...CFNGGICWQALYFSDFV-CQCHEGFVGKRCETDAKA. 79
384 6.000e-07gi|697490001|ref|XP_009675651.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Struthio camelus australis]  clstr ali  43 1164.CSCINGGICVTNIKFPGEYLCLCPNGFDGKFCQEDIN.. 1203
385 6.000e-07gi|395818947|ref|XP_003782869.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Otolemur garnettii]  clstr ali  51 1182.CDCLNGGSCVSDIKFPGMYLCVCLPGFQGSLCEVDAS.. 1221
386 6.000e-07gi|488534921|ref|XP_004485076.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domains [Dasypus novemcinctus]  clstr ali  52 1008.CDCLNGGSCVSDIKFSGAYLCVCLPGFWGGLCEV..... 1044
387 7.000e-07gi|426230254|ref|XP_004009192.1| PREDICTED: neurocan core protein [Ovis aries]  clstr ali  43 1087..PCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 1118
388 7.000e-07gi|664759833|ref|XP_008537493.1| PREDICTED: neurocan core protein [Equus przewalskii]  clstr ali  43 1049..PCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 1080
389 7.000e-07gi|641771429|ref|XP_008169767.1| PREDICTED: neurocan core protein [Chrysemys picta bellii]  clstr ali  40 1409..PCQNGGTCIDEI---NSFVCLCLPSYGDSLCEKDT... 1440
390 8.000e-07gi|260817936|ref|XP_002603841.1| hypothetical protein BRAFLDRAFT_101343 [Branchiostoma floridae]  clstr ali  46  624..PCQNGGQCQDG---DNSYTCDCPDGFLGERCEI..... 653
391 8.000e-07gi|507710503|ref|XP_004646932.1| PREDICTED: neurocan core protein [Octodon degus]  clstr ali  43 1051..PCENGGTCIDEV---NSFVCLCLPSYGGSLCEKDT... 1082
392 8.000e-07gi|390339295|ref|XP_003724971.1| PREDICTED: uncharacterized protein LOC100892917 [Strongylocentrotus purpuratus]  clstr ali  40  194..PCLNGGTCMN---TNGSYDCQCDRGWTGLNCET..... 223
393 8.000e-07gi|344241310|gb|EGV97413.1| Neurocan core protein [Cricetulus griseus]  clstr ali  43  972..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1003
394 8.000e-07gi|507657471|ref|XP_004705572.1| PREDICTED: neurocan core protein [Echinops telfairi]  clstr ali  43 1022..PCANGGTCIDEV---NGFGCLCLPSYGGSFCEKDT... 1053
395 8.000e-07gi|528954372|ref|XP_005208516.1| PREDICTED: neurocan core protein isoform X1 [Bos taurus]  clstr ali  43 1118..PCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 1149
396 8.000e-07gi|548471536|ref|XP_005682143.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Capra hircus]  clstr ali  43  960..PCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 991
397 8.000e-07gi|465951085|gb|EMP24104.1| Neurocan core protein [Chelonia mydas]  clstr ali  40 1308..PCQNGGTCIDEI---NSFVCLCLPSYGDSLCEKDT... 1339
398 8.000e-07gi|586520201|ref|XP_006904472.1| PREDICTED: neurocan core protein [Pteropus alecto]  clstr ali  43 1067..PCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 1098
399 8.000e-07gi|507667021|ref|XP_004707730.1| PREDICTED: tissue-type plasminogen activator [Echinops telfairi]  clstr ali  45  92...CFSGGLCRQAVYFSDFV-CQCPEGFLGKRCEIDQDS. 126
400 8.000e-07gi|513220739|ref|XP_004947670.1| PREDICTED: tissue-type plasminogen activator isoform X3 [Gallus gallus]  clstr ali  37  98.NKCYNGGQCSQAYYSPQLFICRCHHGFSGKQCEIDTE.. 134
401 9.000e-07gi|348558724|ref|XP_003465166.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Cavia porcellus]  clstr ali  43 1043..PCENGGTCIDEV---NSFVCLCLPSYGGNLCEKDT... 1074
402 9.000e-07gi|521030642|gb|EPQ12428.1| Neurocan core protein [Myotis brandtii]  clstr ali  43  992..PCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 1023
403 9.000e-07gi|555972697|ref|XP_005898350.1| PREDICTED: neurocan core protein [Bos mutus]  clstr ali  43 1080..PCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 1111
404 9.000e-07gi|677990794|ref|XP_009075203.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Acanthisitta chloris]  clstr ali  47  559.CSCLNGGTCVTNIKYPGEYLCLCPNGFDGEFCQDDI... 597
405 9.000e-07gi|354468247|ref|XP_003496578.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Cricetulus griseus]  clstr ali  54 1237.CDCLNGGSCVSDRKFSGAYLCVCLPGFHGNLCEVDAS.. 1276
406 9.000e-07gi|537257598|gb|ERE89284.1| von Willebrand factor D and EGF domain-containing protein [Cricetulus griseus]  clstr ali  54 1273.CDCLNGGSCVSDRKFSGAYLCVCLPGFHGNLCEVDAS.. 1312
407 1.000e-06gi|573876699|ref|XP_006626617.1| PREDICTED: versican core protein-like [Lepisosteus oculatus]  clstr ali  40  390.NPCRNGGTCIDSL---NSFTCVCLPSYAGALCEQDT-ET 424
408 1.000e-06gi|657809549|ref|XP_008332060.1| PREDICTED: neurocan core protein-like [Cynoglossus semilaevis]  clstr ali  40 1027..PCENGGTCIDKI---DSFLCLCLPSYGGDTCEKDI... 1058
409 1.000e-06gi|444726601|gb|ELW67125.1| Neurocan core protein [Tupaia chinensis]  clstr ali  43  963..PCDNGGTCIDQV---NGFVCLCLPSYGGSLCEKDT... 994
410 1.000e-06gi|562835694|ref|XP_006147156.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Tupaia chinensis]  clstr ali  43 1079..PCDNGGTCIDQV---NGFVCLCLPSYGGSLCEKDT... 1110
411 1.000e-06gi|533193837|ref|XP_005409679.1| PREDICTED: neurocan core protein [Chinchilla lanigera]  clstr ali  43 1046..PCENGGTCIDEV---NSFVCLCLPSYGGSLCEKDT... 1077
412 1.000e-06gi|584039724|ref|XP_006778460.1| PREDICTED: neurocan core protein [Myotis davidii]  clstr ali  43 1025..PCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 1056
413 1.000e-06gi|657552193|ref|XP_008280457.1| PREDICTED: neurocan core protein-like [Stegastes partitus]  clstr ali  40  996..PCENGGTCIDKI---DSFLCLCLPSYGGDTCEKDI... 1027
414 1.000e-06gi|591325426|ref|XP_007088728.1| PREDICTED: neurocan core protein [Panthera tigris altaica]  clstr ali  43 1000..PCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1031
415 1.000e-06gi|511882082|ref|XP_004760927.1| PREDICTED: neurocan core protein isoform X4 [Mustela putorius furo]  clstr ali  43 1105..PCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1136
416 1.000e-06gi|586977710|ref|XP_006928799.1| PREDICTED: neurocan core protein [Felis catus]  clstr ali  43 1027..PCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1058
417 1.000e-06gi|511882076|ref|XP_004760924.1| PREDICTED: neurocan core protein isoform X1 [Mustela putorius furo]  clstr ali  43 1129..PCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1160
418 1.000e-06gi|554559119|ref|XP_005873956.1| PREDICTED: neurocan core protein [Myotis brandtii]  clstr ali  43 1009..PCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 1040
419 1.000e-06gi|507965338|ref|XP_004688644.1| PREDICTED: neurocan core protein [Condylura cristata]  clstr ali  43 1056..PCENGGTCIDEI---NAFICLCLPSYGGSLCEKDT... 1087
420 1.000e-06gi|558177379|ref|XP_006100464.1| PREDICTED: neurocan core protein [Myotis lucifugus]  clstr ali  43 1079..PCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 1110
421 1.000e-06gi|478497275|ref|XP_004422976.1| PREDICTED: neurocan core protein [Ceratotherium simum simum]  clstr ali  43 1077..PCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1108
422 1.000e-06gi|345787551|ref|XP_541924.3| PREDICTED: neurocan core protein isoform X2 [Canis lupus familiaris]  clstr ali  43 1052..PCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1083
423 1.000e-06gi|640834304|ref|XP_008072858.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein-like [Tarsius syrichta]  clstr ali  43  857..PCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 888
424 1.000e-06gi|589943282|ref|XP_006984345.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Peromyscus maniculatus bairdii]  clstr ali  54 1181.CDCLNGGSCVSDRKFSGAYLCVCLPGFHGGLCEVDAS.. 1220
425 1.000e-06gi|524962186|ref|XP_005081022.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Mesocricetus auratus]  clstr ali  51 1181.CDCLNGGSCVPDRKFSGAYLCVCLPGFHGDLCEVDAS.. 1220
426 1.000e-06gi|157278399|ref|NP_001098301.1| tissue-type plasminogen activator precursor [Oryzias latipes]  clstr ali  45  87...CYNGGTCKESVYTSD-YICQCPQGFKGAQCEINSNE. 121
427 1.000e-06gi|297288789|ref|XP_002803427.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Macaca mulatta]  clstr ali  51 1316.CDCLNGGSCVSDRNFSGVYLCVCLPGFHGSLCEVNTS.. 1355
428 1.000e-06gi|667241686|ref|XP_008568333.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Galeopterus variegatus]  clstr ali  54 1256.CDCLNGGSCVSDMKFSGVYLCVCLPGFQGGLCEVDVS.. 1295
429 2.000e-06gi|405970071|gb|EKC35006.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  33  554..PCQNNGTCIDQV---NHFQCECVPGYNGTTCENMVN.. 586
430 2.000e-06gi|530414516|ref|XP_005259804.1| PREDICTED: neurocan core protein isoform X3 [Homo sapiens]  clstr ali  43  601..PCENGGTCIDEV---NGFVCLCLPSYGGSFCEKDT... 632
431 2.000e-06gi|658898203|ref|XP_008431944.1| PREDICTED: neurocan core protein-like [Poecilia reticulata]  clstr ali  43  982..PCENGGTCVDKI---DSFLCLCLPSYGGDTCEKDV... 1013
432 2.000e-06gi|316980673|dbj|BAJ51985.1| green fluorescnet protein-PG-M/versican (V3) fusion protein [Cloning vector pInSRT-GFPV3]  clstr ali  40  655.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 689
433 2.000e-06gi|564264497|ref|XP_006271095.1| PREDICTED: neurocan core protein [Alligator mississippiensis]  clstr ali  43  405..PCQNGGTCIDEI---NSFVCLCLPSYGGSLCEKDT... 436
434 2.000e-06gi|556988805|ref|XP_005999483.1| PREDICTED: neurocan core protein [Latimeria chalumnae]  clstr ali  43  400..PCQNGGTCIDEI---NSFVCLCLPSYGGGRCEKDT... 431
435 2.000e-06gi|512813786|ref|XP_004910942.1| PREDICTED: versican core protein isoform X2 [Xenopus (Silurana) tropicalis]  clstr ali  36  841.NPCRNGAACVDGI---NSFSCICLPSYAGSLCEQDT... 873
436 2.000e-06gi|512814844|ref|XP_002936378.2| PREDICTED: neurocan core protein [Xenopus (Silurana) tropicalis]  clstr ali  39 1326.NPCQNGGTCIDEI---NSFLCLCLSSYGGSTCGKDT... 1358
437 2.000e-06gi|431922043|gb|ELK19216.1| Neurocan core protein [Pteropus alecto]  clstr ali  43  778..PCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 809
438 2.000e-06gi|338718707|ref|XP_003363880.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Equus caballus]  clstr ali  43  871..PCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 902
439 2.000e-06gi|545534045|ref|XP_005632716.1| PREDICTED: neurocan core protein isoform X1 [Canis lupus familiaris]  clstr ali  43  982..PCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1013
440 2.000e-06gi|47216660|emb|CAG04858.1| unnamed protein product, partial [Tetraodon nigroviridis]  clstr ali  43 1148.NPCQNGGTCIDEI---NSFVCLCLPSYGGATCE...... 1177
441 2.000e-06gi|564263491|ref|XP_006270607.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Alligator mississippiensis]  clstr ali  41  904.CSCMHGGTCVTNINFPGEYLCICPNGFDGELCQENI... 942
442 2.000e-06gi|637249575|ref|XP_008111251.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Anolis carolinensis]  clstr ali  51  171.CGCLNGGTCITNVNFPGKYLCICPNEFEGEHCQ...... 206
443 2.000e-06gi|395502468|ref|XP_003755602.1| PREDICTED: lactadherin [Sarcophilus harrisii]  clstr ali  50  33...CLNGGTCLNGSESSTFY-CLCPDGFTGQNCQ...... 62
444 2.000e-06gi|557319459|ref|XP_006032895.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Alligator sinensis]  clstr ali  40  819.CSCMHGGTCVTNINFPGEYLCICPNGFDGVLCQENIN.. 858
445 2.000e-06gi|635114531|ref|XP_007980216.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein isoform X1 [Chlorocebus sabaeus]  clstr ali  51 1271.CDCLNGGSCVSDRNFSGVYLCVCLPGFHGSLCEVNIS.. 1310
446 2.000e-06gi|697414972|gb|KGL75997.1| Salivary plasminogen activator beta, partial [Tinamus guttatus]  clstr ali  38  1...CFNGGQCSQAYYSPQLFVCQCRQGFSGKQCETDT... 34
447 2.000e-06gi|472351818|ref|XP_004395590.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Odobenus rosmarus diverge  clstr ali  47 1381.CDCLNGGSCVSDRKFSGMYLCVCLPGFQGVLCEVNVTE. 1421
448 3.000e-06gi|617468454|ref|XP_007574543.1| PREDICTED: neurocan core protein-like isoform X2 [Poecilia formosa]  clstr ali  43  912..PCENGGTCVDKI---DSFLCLCLPSYGGDTCEKDV... 943
449 3.000e-06gi|612011870|ref|XP_007489259.1| PREDICTED: neurocan core protein isoform X2 [Monodelphis domestica]  clstr ali  43 1106..PCLNGGTCIDEV---NSFICLCLPSYGGSLCDKDT... 1137
450 3.000e-06gi|507566845|ref|XP_004667063.1| PREDICTED: protocadherin Fat 4-like [Jaculus jaculus]  clstr ali  32 3910..PCKNGAICHN---FPGGFNCVCKTGYTGKHCELN.... 3943
451 3.000e-06gi|395513129|ref|XP_003760782.1| PREDICTED: neurocan core protein [Sarcophilus harrisii]  clstr ali  43 1096..PCLNGGTCIDEV---NSFICLCLPSYGGSLCDKDT... 1127
452 3.000e-06gi|612006470|ref|XP_007487409.1| PREDICTED: versican core protein isoform X3 [Monodelphis domestica]  clstr ali  40 1419.NPCRNGATCVDGF---NTFTCLCLPSYVGALCEQDT-ET 1453
453 3.000e-06gi|532042020|ref|XP_005363848.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Microtus ochrogaster]  clstr ali  50 1172.CDCLNGGSCESDRKFSGAYLCVCLPGFHGRLCEVDA... 1210
454 3.000e-06gi|663293468|ref|XP_008502505.1| PREDICTED: tissue-type plasminogen activator-like, partial [Calypte anna]  clstr ali  37  95.NKCYNGGQCSQAYYSPQLFICQCHPRFSGKQCEIDTE.. 131
455 3.000e-06gi|591365353|ref|XP_007057545.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Chelonia mydas]  clstr ali  40  876.CSCMNGGSCVTNINFPGEYLCICPSGFDGNFCQENIN.. 915
456 3.000e-06gi|719745453|ref|XP_010211093.1| PREDICTED: tissue-type plasminogen activator [Tinamus guttatus]  clstr ali  36  89.NKCFNGGQCSQAYYSPQLFVCQCRQGFSGKQCETDT... 124
457 3.000e-06gi|641766290|ref|XP_008167998.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Chrysemys picta bellii]  clstr ali  40  788.CSCMNGGSCVTNINFPGEYLCICPNGFDGNFCQENIN.. 827
458 4.000e-06gi|677716695|ref|XP_009082123.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like, partial [Acanthi  clstr ali  28  649.NPCLNRAICEDRV---GGFSCKCLPGFSGVLCERNIDE. 683
459 4.000e-06gi|585653738|ref|XP_006815169.1| PREDICTED: fibropellin-1-like, partial [Saccoglossus kowalevskii]  clstr ali  41  249.NPCLNNGTCVDGV---NSYVCNCVDGYSGDNCQT..... 279
460 4.000e-06gi|260826500|ref|XP_002608203.1| hypothetical protein BRAFLDRAFT_90357 [Branchiostoma floridae]  clstr ali  42  141...CENGGTCRDGI---NEYSCDCADGFNGDTCQIDTNE. 173
461 4.000e-06gi|260785516|ref|XP_002587807.1| hypothetical protein BRAFLDRAFT_92256 [Branchiostoma floridae]  clstr ali  43 3910..PCLNNGTCTDGQT---SYSCQC--GFKGDNCEI..... 3939
462 4.000e-06gi|597787433|ref|XP_007257154.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Astyanax mexicanus]  clstr ali  43 1116.CGCMNGGTCVTNVERPGEYLCVCPSGFGGDLCQEETD.. 1155
463 4.000e-06gi|514476174|ref|XP_003477550.2| PREDICTED: coagulation factor VII [Cavia porcellus]  clstr ali  37  93.NPCQNGGTCQDDF---RLYICFCLPNFSGRNCETNRSA. 127
464 4.000e-06gi|260819590|ref|XP_002605119.1| hypothetical protein BRAFLDRAFT_84207 [Branchiostoma floridae]  clstr ali  35 1261.CECENGGSCVTYPAGSGMYMCVCPPGYQGERCQDNVD.. 1300
465 4.000e-06gi|405968866|gb|EKC33895.1| hypothetical protein CGI_10026390 [Crassostrea gigas]  clstr ali  48  52...CKNGGTCVESAPCSNSGSCICPENYSGEHCQ...... 82
466 5.000e-06gi|564242614|ref|XP_006278103.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Alligator missis  clstr ali  32 1256..PCLNNGVCKDGIA---AFICQCQPGYTGSLCEEDVNE. 1289
467 5.000e-06gi|674098529|ref|XP_008822706.1| PREDICTED: neurocan core protein, partial [Nannospalax galili]  clstr ali  40 1002..PCENGGTCIDEV---NGFVCLCLPSYGGSLCQKDT... 1033
468 5.000e-06gi|348500902|ref|XP_003438010.1| PREDICTED: neurocan core protein-like isoform X1 [Oreochromis niloticus]  clstr ali  40 1044..PCANGGTCIDKI---DSFLCLCLPSYGGDMCEKDV... 1075
469 5.000e-06gi|395541765|ref|XP_003772809.1| PREDICTED: protocadherin Fat 4 [Sarcophilus harrisii]  clstr ali  38 4601..PCQNGGSCEPVSY--SGFTCSCPESHTGRTCET..... 4631
470 5.000e-06gi|658868422|ref|XP_008417102.1| PREDICTED: versican core protein isoform X2 [Poecilia reticulata]  clstr ali  40  394.NPCRNGGTCVDGLA---SFTCVCLPSYSGLYCEEDT-ET 428
471 5.000e-06gi|528480304|ref|XP_002662132.3| PREDICTED: versican core protein [Danio rerio]  clstr ali  40  558.NPCRNGGTCIDGL---NSFTCLCLPSYAGALCEQDT-ET 592
472 5.000e-06gi|504172493|ref|XP_004595823.1| PREDICTED: neurocan core protein [Ochotona princeps]  clstr ali  43  984..PCENGGTCIDEV---NGFVCLCLPSYGGSQCEKDT... 1015
473 5.000e-06gi|585640453|ref|XP_006880440.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Elephantulus edwardii]  clstr ali  51 1184.CDCLNGGSCVSDINSSGGNLCVCLPGFQGDLCEVDIS.. 1223
474 5.000e-06gi|632948385|ref|XP_007889569.1| PREDICTED: slit homolog 3 protein [Callorhinchus milii]  clstr ali  39  955NSPCQNGGTCHVNEGEKDGFRCVCPEGFEGQVCDQNAD.. 992
475 5.000e-06gi|688608773|ref|XP_009294487.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Danio rerio]  clstr ali  51 1176.CVCMNGGSCVTNIRFSGEYLCICPSGFHGDHCQ...... 1211
476 6.000e-06gi|351712034|gb|EHB14953.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Heterocephalus glaber]  clstr ali  37 1299.NPCRNQATCVDGL---NSYSCKCRPGFSGSRCETE.... 1330
477 6.000e-06gi|390347626|ref|XP_780954.3| PREDICTED: uncharacterized protein LOC575460 [Strongylocentrotus purpuratus]  clstr ali  44  272..PCQNGGTCEDGV---NGYVCICVDGWGGGDCE...... 300
478 6.000e-06gi|583983562|ref|XP_006787067.1| PREDICTED: neurocan core protein-like [Neolamprologus brichardi]  clstr ali  40  955..PCANGGTCIDKI---DSFLCLCLPSYGGDMCEKDV... 986
479 6.000e-06gi|195168024|ref|XP_002024832.1| GL17893 [Drosophila persimilis]  clstr ali  43  194...CQNGGNCTAPQ------TCSCPSGYTGRHCEVDVNE. 223
480 6.000e-06gi|641796653|ref|XP_008161681.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Chrysemys picta bellii]  clstr ali  45 1198.CDCLNGGSCVTNIHFSGKYLCVCLPGFEGDLCQVNFD.. 1237
481 6.000e-06gi|395861202|ref|XP_003802882.1| PREDICTED: coagulation factor XII [Otolemur garnettii]  clstr ali  38  181.NPCLNGGRCLEAE---GHHLCHCPMGYTGPFCDIDTEAS 216
482 6.000e-06gi|664753528|ref|XP_008534227.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Equus przewalskii]  clstr ali  47 1203.CDCLNGGSCVSDIKFSGAYLCVCLPGFQGGLCEVEVTE. 1243
483 6.000e-06gi|583995728|ref|XP_006792987.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Neolamprologus brichardi]  clstr ali  39 1178.CGCQNGGSCVTDINFSGKYLCVCPEGTQGELCADDIDE. 1218
484 6.000e-06gi|585652120|ref|XP_006884017.1| PREDICTED: coagulation factor VII [Elephantulus edwardii]  clstr ali  42  93.NPCQNGGTCMDQL---QSYICFCLEEFEGRNCEIDKNS. 127
485 6.000e-06gi|61162130|dbj|BAD91054.1| Af1-cadherin [Artemia franciscana]  clstr ali  53 1148...CFNGGTCILNGLFP---RCECPDNFEGPRCE...... 1175
486 7.000e-06gi|470618392|ref|XP_004317818.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like, partial [Tursiop  clstr ali  37 1369.NPCRNQATCVDEL---NSYSCKCQPGFSGSRCETE.... 1400
487 7.000e-06gi|405958597|gb|EKC24709.1| Oncoprotein-induced transcript 3 protein [Crassostrea gigas]  clstr ali  45  27...CYNGGTCIAYNNGYPGYYCNCPSGFTGLHCQ...... 57
488 7.000e-06gi|426228311|ref|XP_004008256.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Ovis aries]  clstr ali  47  854.CDCLNGGSCVSDTKFSGAYLCVCLPGFHGDLCEKNVTE. 894
489 7.000e-06gi|551495922|ref|XP_005799521.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Xiphophorus maculatus]  clstr ali  40 1192.CDCFNAASCITNVNSSGEYVCVCPDGFTGRRCEVDVD.. 1231
490 7.000e-06gi|699633359|ref|XP_009908400.1| PREDICTED: hepatocyte growth factor activator [Picoides pubescens]  clstr ali  41  102NNPCQNGGSCSLAHGHST-YHCTCPEGFMGEDCQI..... 135
491 7.000e-06gi|198475483|ref|XP_002132931.1| GA26093 [Drosophila pseudoobscura pseudoobscura]  clstr ali  33 2368.NPCHNGGRCIDTRFGPH---CSCPVGYTGPRCQ...... 2397
492 7.000e-06gi|645002338|ref|XP_008209926.1| PREDICTED: LOW QUALITY PROTEIN: neural-cadherin [Nasonia vitripennis]  clstr ali  38 2331NNPCHNGGRCVEGRF---GLTCQCPAGYNGPRCQ...... 2361
493 8.000e-06gi|505768687|ref|XP_004600512.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Sorex araneus]  clstr ali  28 1314.NPCFHNAICEDQV---GGFLCKCPPGFLGTLCEKDLDE. 1348
494 8.000e-06gi|640783341|ref|XP_008047343.1| PREDICTED: coagulation factor X [Tarsius syrichta]  clstr ali  33  824..PCQNQGECRDGL---GEYTCTCLEGFEGRNCEL..... 853
495 8.000e-06gi|662196349|ref|XP_008471202.1| PREDICTED: uncharacterized protein LOC103508436, partial [Diaphorina citri]  clstr ali  38 1208ENSCQHGGLCVP---IGHTVQCFCPAGFSGRRCEIDIDE. 1243
496 8.000e-06gi|683922551|ref|XP_009092038.1| PREDICTED: protein jagged-1 [Serinus canaria]  clstr ali  45  311..PCLNGGTCSN--TGPDKYQCSCPEGYSGQNCEIDANE. 345
497 8.000e-06gi|348578597|ref|XP_003475069.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Cavia porcellus]  clstr ali  44 1182.CDCLNGGSCVPDRKFSGAYLCICLPGFHGGLCEVAVDA. 1222
498 9.000e-06JGI.Meta 7064312322 SRS019064_WUGC_scaffold_15616__gene_15276 PREDICTED: similar to CG8355-PC [Human Right Retroauricular crease microbiome  ali  53  260...CHNGGTCVDQV---NSYRCECPDGFSGSFCE...... 287
499 9.000e-06gi|478498911|ref|XP_004423786.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Ceratotherium simum s  clstr ali  29 1239..PCLNNAVCEDQV---GGFLCKCLPGFLGTRCEKNIDE. 1272
500 9.000e-06gi|444730184|gb|ELW70574.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Tupaia chinensis]  clstr ali  37 1448.NPCKNQATCVDEL---NSYSCKCRPGFSGSQCETE.... 1479
501 9.000e-06gi|148668664|gb|EDL00983.1| mCG116562, isoform CRA_c [Mus musculus]  clstr ali  40  452.NPCRNGATCVDG---FNTFRCLCLPSYVGALCEQDT-ET 486
502 9.000e-06gi|543277596|ref|XP_005427040.1| PREDICTED: versican core protein [Geospiza fortis]  clstr ali  37  389.NPCRNGATCIDSL---NTFTCLCLPSYVGALCEQDT-ET 423
503 9.000e-06gi|119625608|gb|EAX05203.1| FAT tumor suppressor homolog 4 (Drosophila) [Homo sapiens]  clstr ali  34 4119..PCQHGGTCMDYWSWQ---QCHCKEGLTGKYCE...... 4147
504 9.000e-06gi|611975090|ref|XP_007474213.1| PREDICTED: coagulation factor XII [Monodelphis domestica]  clstr ali  41  175DNPCLHGGMCLEAEGQS---VCHCPPNYVGHFCEIDTSA. 210
505 9.000e-06gi|61162132|dbj|BAD91055.1| Af2-cadherin [Artemia franciscana]  clstr ali  46 2764NSPCLNGGVCLNREPF---YVCACPEGYLGDHCEL..... 2795
506 1.000e-05gi|260817932|ref|XP_002603839.1| hypothetical protein BRAFLDRAFT_101341 [Branchiostoma floridae]  clstr ali  32 1398.NPCQNGGQCQD---EANSYSCTCAAGYSGDDCETNDD.. 1431
507 1.000e-05gi|537228073|gb|ERE83520.1| sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Cricetulus griseus]  clstr ali  37 1464.NPCRNQATCVDEL---NSYSCKCRPGFSGHRCETE.... 1495
508 1.000e-05gi|321466601|gb|EFX77596.1| hypothetical protein DAPPUDRAFT_30003 [Daphnia pulex]  clstr ali  29 1149..PCHQGATCLDKIL---GYVCVCPPGMAGSRCELEVDE. 1182
509 1.000e-05gi|675385360|gb|KFM78257.1| Basement membrane-specific heparan sulfate proteoglycan core protein, partial [Stegodyphus mimosarum]  clstr ali  48  921..PCKNGGTCS---GSGNSYKCNCPLAYKGTNCE...... 949
510 1.000e-05gi|573882072|ref|XP_006629223.1| PREDICTED: protocadherin Fat 4-like [Lepisosteus oculatus]  clstr ali  43 4148.NVCKHGGTCVDNWSWQ---QCKCMEGFTGKYCE...... 4177
511 1.000e-05gi|537245548|gb|ERE87808.1| protocadherin Fat 4 [Cricetulus griseus]  clstr ali  30 3780..PCKNGAVCQN---FPGGFNCVCKTGYTGKMCESSVN.. 3812
512 1.000e-05gi|625270788|ref|XP_007626942.1| PREDICTED: protocadherin Fat 4 isoform X2 [Cricetulus griseus]  clstr ali  30 4263..PCKNGAVCQN---FPGGFNCVCKTGYTGKMCESSVN.. 4295
513 1.000e-05gi|584086441|ref|XP_006762943.1| PREDICTED: LOW QUALITY PROTEIN: protocadherin Fat 4 [Myotis davidii]  clstr ali  30 4002..PCKNGAVCQN---FPGSFHCVCKTGYTGKMCESSVN.. 4034
514 1.000e-05gi|498957442|ref|XP_004544774.1| PREDICTED: versican core protein-like [Maylandia zebra]  clstr ali  39  396.NPCRNGGTCVDGL---SSFTCVCLPSYAGLFCEEDT... 428
515 1.000e-05gi|584054853|ref|XP_006772021.1| PREDICTED: delta-like protein 3 [Myotis davidii]  clstr ali  33  216DGPCFNGGLCVGGTDPDSAYICHCPPGFQGSNCEKRVDR. 254
516 1.000e-05gi|551512972|ref|XP_005808000.1| PREDICTED: zonadhesin-like, partial [Xiphophorus maculatus]  clstr ali  51 1493..PCLNGGTCVTANN--NAYTCACPEGFYGQNCEMEV... 1525
517 1.000e-05gi|543347278|ref|XP_005519186.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Pseudopodoces humilis]  clstr ali  45 1472.CDCLNNGTCVTNINFSGRYLCVCVAGFEGDLCQVNTD.. 1511
518 1.000e-05gi|504135605|ref|XP_004580278.1| PREDICTED: hyaluronan-binding protein 2 [Ochotona princeps]  clstr ali  38  216.NPCQNGGTCSQHKRRSRF-RCACPDQYWGRFCEVGPD.. 251
519 1.000e-05gi|478535052|ref|XP_004441655.1| PREDICTED: delta-like protein 3 [Ceratotherium simum simum]  clstr ali  33  318DGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDR. 356
520 1.000e-05gi|242005391|ref|XP_002423552.1| predicted protein [Pediculus humanus corporis]  clstr ali  35 4119HNPCINGGMC---YPEGDSYSCSCPEGYTGRHCETQI... 4152
521 1.000e-05gi|704230354|ref|XP_010146109.1| PREDICTED: hepatocyte growth factor activator [Eurypyga helias]  clstr ali  39  44NNPCQNGGTCSLAQGH-GMYHCTCPEEFTGENCQ...... 76
522 1.000e-05gi|672018235|ref|XP_008773934.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Rattus norvegicus]  clstr ali  45 1168.CDCLNGGSCVTDRKFPGAYLCDCLPGFSGDLCEVEAS.. 1207
523 1.000e-05gi|556949791|ref|XP_005987462.1| PREDICTED: epidermal growth factor-like protein 7-like isoform X5 [Latimeria chalumnae]  clstr ali  45  111..PCQNGGTC------SKPNRCDCPPGWNGKHCQTDVDE. 141
524 1.000e-05gi|532070055|ref|XP_005320860.1| PREDICTED: hyaluronan-binding protein 2 [Ictidomys tridecemlineatus]  clstr ali  44  139.NPCQNGGTCSRHKRRSRF-SCACPEQFSGRFCEIGPD.. 174
525 1.000e-05gi|586524136|ref|XP_006905492.1| PREDICTED: delta-like protein 3 [Pteropus alecto]  clstr ali  33  294DGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDR. 332
526 1.000e-05gi|543377105|ref|XP_005531758.1| PREDICTED: neurocan core protein [Pseudopodoces humilis]  clstr ali  42 1149..PCQNGGTCIDEV---NSFVCLCLPSYGGSRCEKDTE.. 1181
527 2.000e-05gi|432876048|ref|XP_004072951.1| PREDICTED: protein crumbs homolog 1-like [Oryzias latipes]  clstr ali  40  883.NPCLNGATCQDQL---NHFKCVCVPGFHGKFCENNKEE. 917
528 2.000e-05gi|405966781|gb|EKC32021.1| Fibropellin-3, partial [Crassostrea gigas]  clstr ali  38  122..PCQNYGTCTDLL---NDYNCSCVPGFNGTNCENN.... 152
529 2.000e-05gi|405973160|gb|EKC37890.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Crassostrea gigas]  clstr ali  39  395..PCLNNGVCQQRL---GGYNCTCPTGFRGTNCEINHD.. 427
530 2.000e-05gi|260782454|ref|XP_002586302.1| hypothetical protein BRAFLDRAFT_82908 [Branchiostoma floridae]  clstr ali  43  255.NICQNGGICTSCFNDSAAF-CDCPAGFDGKTCEIDIDE. 291
531 2.000e-05gi|537228072|gb|ERE83519.1| sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Cricetulus griseus]  clstr ali  37 1195.NPCRNQATCVDEL---NSYSCKCRPGFSGHRCETE.... 1226
532 2.000e-05gi|591384083|ref|XP_007066499.1| PREDICTED: versican core protein [Chelonia mydas]  clstr ali  37  394.NPCRNGATCIDGL---NLFTCLCLPSYVGALCEQDT-ET 428
533 2.000e-05gi|597797694|ref|XP_007260404.1| PREDICTED: protocadherin Fat 4 [Astyanax mexicanus]  clstr ali  29 3949.NPCKNGALCQN---FPGGFNCLCKSGFAGKTCDSIIN.. 3982
534 2.000e-05gi|658872840|ref|XP_008419373.1| PREDICTED: protocadherin Fat 4 isoform X2 [Poecilia reticulata]  clstr ali  28 4375.NPCQNHGSCIPDPHT--GFTCICSEFYTGKTCET..... 4406
535 2.000e-05gi|432916725|ref|XP_004079363.1| PREDICTED: neurocan core protein-like [Oryzias latipes]  clstr ali  43  707..PCENGGTCVDKI---DSFLCLCLPSYGGDTCEKDV... 738
536 2.000e-05gi|281344076|gb|EFB19660.1| hypothetical protein PANDA_017200 [Ailuropoda melanoleuca]  clstr ali  33  266DGPCFNGGLCVGGADPDSAYVCHCPPGFQGSNCEKRVDR. 304
537 2.000e-05gi|395859768|ref|XP_003802204.1| PREDICTED: delta-like protein 3 [Otolemur garnettii]  clstr ali  33  318DGPCFNGGLCVGGADPDSAYVCHCPPGFQGSNCEKRVDR. 356
538 2.000e-05gi|537231807|gb|ERE84239.1| agrin-like isoform 1 [Cricetulus griseus]  clstr ali  50 1716.NPCLNGGSCVPREA---TYECLCPGGFSGLHCE...... 1745
539 2.000e-05gi|556769916|ref|XP_005980158.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Pantholops hodgsonii]  clstr ali  50  798.CDCLNGGSCVSDTKFSGAHLCVCLPGFHGDLCEKNVTE. 838
540 2.000e-05gi|524941651|ref|XP_005072510.1| PREDICTED: protein delta homolog 2 [Mesocricetus auratus]  clstr ali  41  177..PCRNGGQCQDNQGFALNFTCRCLAGFAGAHCEVDVD.. 212
541 2.000e-05gi|674088528|ref|XP_008852188.1| PREDICTED: delta-like protein 3 [Nannospalax galili]  clstr ali  33  319DGPCFNGGLCVGGEDPESAYICHCPPGFQGSNCEKRVDR. 357
542 2.000e-05gi|591349139|ref|XP_007069118.1| PREDICTED: delta-like protein C-like [Chelonia mydas]  clstr ali  32  130DGPCFNGGTC--AEKPTGGYTCHCPLGYHGSNCEKKIDR. 166
543 2.000e-05gi|511984971|ref|XP_004810274.1| PREDICTED: delta-like protein 3 [Mustela putorius furo]  clstr ali  33  317DGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDR. 355
544 2.000e-05gi|675717446|ref|XP_008962937.1| PREDICTED: delta-like protein 3 [Pan paniscus]  clstr ali  33  264DGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDR. 302
545 2.000e-05gi|528991404|ref|XP_005218977.1| PREDICTED: delta-like protein 3 isoform X1 [Bos taurus]  clstr ali  33  318DGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDR. 356
546 2.000e-05gi|576693235|gb|EUB56854.1| hypothetical protein EGR_08260 [Echinococcus granulosus]  clstr ali  38  281...CQNGGKCRDLAGNVGAYICVCPPGWWGKHCE...... 311
547 2.000e-05gi|665798423|ref|XP_008547086.1| PREDICTED: neural-cadherin isoform X1 [Microplitis demolitor]  clstr ali  38 2274NSPCYNGGRCIEGRY---GLTCQCPGGYNGPRCQ...... 2304
548 2.000e-05gi|671410054|emb|CDP96750.1| Protein Bm3440, isoform b [Brugia malayi]  clstr ali  36 2111...CRNGGTCIKYRHFTHTGTCLCTKGYTGKFCQNDIDE. 2147
549 3.000e-05gi|260782456|ref|XP_002586303.1| hypothetical protein BRAFLDRAFT_82909 [Branchiostoma floridae]  clstr ali  43  180.NICQNGGICTSCFNDSAAF-CDCPAGFDGKTCEIDIDE. 216
550 3.000e-05gi|126334857|ref|XP_001374633.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 isoform X1 [Monodelphi  clstr ali  29 1350..PCLNNAVCEDQI---GGFLCKCLPGFRGTRCEKNVDE. 1383
551 3.000e-05gi|4321121|gb|AAB17010.2| Notch-3 homolog [Carassius auratus]  clstr ali  37  8...CFNGGTCTDGV---NGFKCTCRSGFTGDYCQYEVN.. 39
552 3.000e-05gi|556979133|ref|XP_005996507.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Latimeria chalum  clstr ali  33 1396.NPCFNQATCVDAL---NSYNCKCAPGYKGERCETGI... 1428
553 3.000e-05gi|488580572|ref|XP_004475730.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Dasypus novemcinctus]  clstr ali  41  997..PCLNKGICVDGLA---GYHCTCVKGFIGLHCETEVNE. 1030
554 3.000e-05gi|585650438|ref|XP_006814579.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Saccoglossus kow  clstr ali  31  816.NSCYNNATCMDKV---NGFSCHCMQGYSGILCDIDINE. 850
555 3.000e-05gi|584081816|ref|XP_006760742.1| PREDICTED: LOW QUALITY PROTEIN: sushi, nidogen and EGF-like domain-containing protein 1 [Myotis davidii]  clstr ali  39  944...CVNGGRCQ---VVSGSAVCECPVGYTGHACETDVDE. 976
556 3.000e-05gi|488538962|ref|XP_004461111.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Dasypus novemcinctus]  clstr ali  43  827..PCANGGTCVDEVA---GFACLCLPSYGGSLCEKDT... 858
557 3.000e-05gi|443712251|gb|ELU05672.1| hypothetical protein CAPTEDRAFT_229022 [Capitella teleta]  clstr ali  37 1419..PCQNGGKCFDSYGF---YQCDCFDNYAGLNCE...... 1447
558 3.000e-05gi|410914515|ref|XP_003970733.1| PREDICTED: protocadherin Fat 4-like [Takifugu rubripes]  clstr ali  31 4900.NPCQNQGSCVPGLH--SGFTCVCSEFYTGKSCET..... 4931
559 3.000e-05gi|514781472|ref|XP_005027860.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 48 [Anas platyrhynchos]  clstr ali  44  132HNPCLHGGTCKGNA-------CICPEGYTGPYCQ...... 158
560 3.000e-05gi|585683736|ref|XP_006812462.1| PREDICTED: protocadherin Fat 4-like [Saccoglossus kowalevskii]  clstr ali  42 2995..PCLNNGTCIPQDA---GYLCICPKNYTGPQC....... 3022
561 3.000e-05gi|528472382|ref|XP_002661027.3| PREDICTED: neurocan core protein [Danio rerio]  clstr ali  35  873.NPCENGGTCIDKE---DSFVCLCLPSYSGDRCERDTE.. 906
562 3.000e-05gi|585672644|ref|XP_006818278.1| PREDICTED: neural-cadherin-like [Saccoglossus kowalevskii]  clstr ali  48 2413..PCLNGGACIDGV---NGYICICPEGYSGIHCE...... 2441
563 3.000e-05gi|498968042|ref|XP_004526212.1| PREDICTED: protein vein-like isoform X1 [Ceratitis capitata]  clstr ali  53  895...CLNGGTC---NFFSEIYSCICPEGFMGERCD...... 924
564 3.000e-05gi|557327337|ref|XP_006036630.1| PREDICTED: vasorin [Alligator sinensis]  clstr ali  51  419...CLNGGTCQLNDH--NHLECVCPAGFSGLYCESEVRKT 453
565 4.000e-05gi|260794967|ref|XP_002592478.1| hypothetical protein BRAFLDRAFT_68964 [Branchiostoma floridae]  clstr ali  41  295.NECLNGGNCI--ACFSDFSMCRCHPGYTGAFCEIDIDE. 330
566 4.000e-05gi|260790079|ref|XP_002590071.1| hypothetical protein BRAFLDRAFT_123438 [Branchiostoma floridae]  clstr ali  43  545DKPCMNGGTCLDRV---NGYVCRCPEGYGGHNC....... 574
567 4.000e-05gi|556761780|ref|XP_005976194.1| PREDICTED: LOW QUALITY PROTEIN: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [  clstr ali  32 1379..PCLNNAVCEDQL---GGFLCKCPPGFLGTRCDINMDE. 1412
568 4.000e-05gi|657554292|ref|XP_008281602.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Stegastes partitus] :  clstr ali  32 1254..PCQNGGLCKDGM---GDFQCQCKPGFLGSLCEAEVNE. 1287
569 4.000e-05gi|358413651|ref|XP_002705103.2| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Bos taurus]  clstr ali  32 1180..PCLNNAVCEDQL---GGFLCKCPPGFLGTRCDINMDE. 1213
570 4.000e-05gi|557026516|ref|XP_006013378.1| PREDICTED: neurogenic locus notch homolog protein 2-like [Latimeria chalumnae]  clstr ali  28  379..PCQNGGVCKVAFNTPRGYTCRCQPNYSGLNCEKSI... 413
571 4.000e-05gi|47551053|ref|NP_999703.1| fibropellin-3 precursor [Strongylocentrotus purpuratus]  clstr ali  39  336..PCLNGGSCLDGV---DGYVCQCLPNYTGTHCEISLD.. 368
572 4.000e-05gi|704541444|ref|XP_010176826.1| PREDICTED: protein delta homolog 1-like [Mesitornis unicolor]  clstr ali  37  67.NPCENGGTCTD---IGMGFSCFCPHGYTGKLC....... 95
573 4.000e-05gi|528499025|ref|XP_005173110.1| PREDICTED: protocadherin Fat 4 [Danio rerio]  clstr ali  26 1593.NPCQNGALCQNY---PGGFNCLCKSGFAGKACDSVIN.. 1626
574 4.000e-05gi|528754676|gb|EPY74335.1| FAT tumor suppressor 4 isoform 1-like protein [Camelus ferus]  clstr ali  32 2110..PCKNGAVCQN---FPGSFNCVCKTGYTGKHCELN.... 2143
575 4.000e-05gi|586984042|ref|XP_006930937.1| PREDICTED: LOW QUALITY PROTEIN: protocadherin Fat 4 [Felis catus]  clstr ali  29 3867..PCKNGAVCQN---VPGSFNCVCKTGYTGKHCELN.... 3900
576 4.000e-05gi|683918047|ref|XP_009090409.1| PREDICTED: vasorin [Serinus canaria]  clstr ali  45  417...CLNGGTC--HLGAQNLLECLCPVGFSGVYCEVEARGT 451
577 5.000e-05gi|565316956|gb|ETE68518.1| Protein delta-like 2, partial [Ophiophagus hannah]  clstr ali  36  203..PCANGATCLDGI---NRFSCQCQVGFEGRFCTINID.. 235
578 5.000e-05gi|699242069|ref|XP_009858460.1| PREDICTED: uncharacterized protein LOC100177838 [Ciona intestinalis]  clstr ali  25  366.NPCQNNAYCEDNCPQ---YTCRCLPGYQGSLCSEDINE. 400
579 5.000e-05gi|403266214|ref|XP_003925288.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Saimiri boliviensis b  clstr ali  38 1276..PCLNKGICVDGVA---GYRCRCVKGYVGLHCEAEVNE. 1309
580 5.000e-05gi|697848982|ref|XP_009644863.1| PREDICTED: LOW QUALITY PROTEIN: basement membrane-specific heparan sulfate proteoglycan core protein [Egretta garzet  clstr ali  46 2671.NPCLHGGTCKGNA-------CLCPQGYTGPYCQ...... 2696
581 6.000e-05gi|617436798|ref|XP_007563718.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 isoform X1 [Poecilia f  clstr ali  32 1248..PCQNGGLCRDGM---GDFQCQCKPGFLGALCEGEVNE. 1281
582 6.000e-05gi|560930011|ref|XP_006191148.1| PREDICTED: protein crumbs homolog 1-like [Camelus ferus]  clstr ali  42  307..PCLHGGLCVDG---ADSYSCNCTSGFTGKHCETSI... 339
583 6.000e-05gi|47215753|emb|CAG05764.1| unnamed protein product, partial [Tetraodon nigroviridis]  clstr ali  32  525..PCQNGGLCKDGM---GEFQCQCKPGFLGSLCEAEVNE. 558
584 6.000e-05gi|512810563|ref|XP_004910507.1| PREDICTED: pikachurin isoform X2 [Xenopus (Silurana) tropicalis]  clstr ali  38  816NIPCANGGSCRPQH---DSYECDCPLGFDGKNCQ...... 846
585 6.000e-05gi|307174406|gb|EFN64925.1| Neural-cadherin [Camponotus floridanus]  clstr ali  38  966NSPCYNGGRCVEDRF---GLSCQCPSGYNGPRCQ...... 996
586 6.000e-05gi|322793232|gb|EFZ16889.1| hypothetical protein SINV_09531 [Solenopsis invicta]  clstr ali  38 1083NSPCYNGGRCVEDRF---GLSCQCPSGYNGPRCQ...... 1113
587 6.000e-05gi|637294277|ref|XP_008107674.1| PREDICTED: tyrosine-protein kinase receptor Tie-1 [Anolis carolinensis]  clstr ali  53  315ECHCENGGTC------NRFSGCICPAGWHGQHCE...... 342
588 7.000e-05gi|545843488|ref|XP_005666519.1| PREDICTED: protein delta homolog 1-like [Sus scrofa]  clstr ali  35  249.NPCANNGTCANL--DNGQYECSCPPGFSGRDCQ...... 279
589 7.000e-05gi|260833680|ref|XP_002611840.1| hypothetical protein BRAFLDRAFT_123361 [Branchiostoma floridae]  clstr ali  41  770DKPCQNEGTCEDLV---NGFKCTCPKGITGDLCE...... 800
590 7.000e-05gi|148703183|gb|EDL35130.1| mCG142341 [Mus musculus]  clstr ali  29 1813..PCKHGAICQN---FPGGFNCVCKTGYTGKHCELN.... 1846
591 7.000e-05gi|328714938|ref|XP_001945353.2| PREDICTED: neural-cadherin [Acyrthosiphon pisum]  clstr ali  41 1544..PCLNGGRCSDTRNGPT---CECPNGFNGPRCQ...... 1572
592 7.000e-05gi|465999177|gb|EMP40847.1| Vasorin [Chelonia mydas]  clstr ali  45  438...CLNGGTCQLDAH--NHLECQCPDGFSGLYCEAEIQRT 472
593 7.000e-05gi|390353700|ref|XP_786113.2| PREDICTED: uncharacterized protein LOC580994 [Strongylocentrotus purpuratus]  clstr ali  44  809...CLNGGTCVPPGNGETIATCSCASDYEGRRCEVEKSN. 844
594 8.000e-05gi|597791710|ref|XP_007258966.1| PREDICTED: protein delta homolog 1 [Astyanax mexicanus]  clstr ali  43  214.NPCLNGGTCRDNGL---GYTCVCLSGFSGPTCNIN.... 245
595 8.000e-05gi|390364043|ref|XP_795071.3| PREDICTED: uncharacterized protein LOC590372 [Strongylocentrotus purpuratus]  clstr ali  34 1813..PCQNGGRCING---QGRYTCTCRLGYSGLNCE...... 1841
596 8.000e-05gi|646722981|gb|KDR23766.1| Basement membrane-specific heparan sulfate proteoglycan core protein [Zootermopsis nevadensis]  clstr ali  35 2930.NPCLNQGVCQEATELQG-YSCICPPGFSGLNC....... 2960
597 9.000e-05gi|637333404|ref|XP_008115096.1| PREDICTED: protein eyes shut homolog [Anolis carolinensis]  clstr ali  35  108..PCKNQGRCVDRV---NSYRCLCREGFSGTLCEVEINE. 141
598 9.000e-05gi|676271759|gb|KFO26727.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Fukomys damarensis]  clstr ali  34 1262.NPCRNQAICVDEL---NSYSCKCRPGFSGSRCETE.... 1293
599 9.000e-05gi|670631986|gb|KFE78014.1| hypothetical protein DB32_7279 [Sandaracinus amylolyticus]  clstr ali  32  227..PCQNSGVCANGE---DDYTCACPAGFDGVNCENEIDE. 260
600 9.000e-05gi|444712552|gb|ELW53473.1| Pikachurin [Tupaia chinensis]  clstr ali  53  623EASCVNGGTCTAIKADSYI--CLCPLGFKGRHCE...... 654
601 9.000e-05gi|533143429|ref|XP_005386281.1| PREDICTED: pikachurin isoform X1 [Chinchilla lanigera]  clstr ali  53  579EASCVNGGTCTAIKADSYI--CLCPLGFKGRHCE...... 610
602 1.000e-04gi|241576133|ref|XP_002403554.1| LIN-12 protein, putative [Ixodes scapularis]  clstr ali  32  527..PCRHGGTCEDLV---NGYQCRCRPGTSGVDCEYNVNE. 560
603 1.000e-04gi|322786496|gb|EFZ12941.1| hypothetical protein SINV_04133 [Solenopsis invicta]  clstr ali  36  231..PCLNGGTCKDQV---NSFRCQCVPGYVGRLCQDKVD.. 263
604 1.000e-04gi|582014472|dbj|BAO49753.1| C-type lectin [Ruditapes philippinarum]  clstr ali  44  193..PCKNGGECVDG---DNSYTCTCPPNTAGDNCE...... 221
605 1.000e-04gi|571560014|ref|XP_006566475.1| PREDICTED: neurogenic locus protein delta [Apis mellifera]  clstr ali  25  421DSPCHHGASCEDDSLH--GYVCRCPPGYTGNDCESQLD.. 456
606 1.000e-04gi|380015973|ref|XP_003691968.1| PREDICTED: neurogenic locus protein delta-like [Apis florea]  clstr ali  25  306DSPCHHGASCEDDSLH--GYVCRCPPGYTGNDCESQLD.. 341
607 1.000e-04gi|432091556|gb|ELK24581.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Myotis davidii]  clstr ali  32 1108..PCLNNAVCEDQV---GRFLCKCPAGFWGTRCEKNMDE. 1141
608 1.000e-04gi|260792245|ref|XP_002591126.1| hypothetical protein BRAFLDRAFT_105530 [Branchiostoma floridae]  clstr ali  40  399...CVNGATCK-GCFNSLITTCDCQAGFTGERCEININE. 433
609 1.000e-04gi|260791908|ref|XP_002590969.1| hypothetical protein BRAFLDRAFT_69480 [Branchiostoma floridae]  clstr ali  33  159..PCQNGAICQDGV---NSFTCQCASGYYGTLCE-DIDE. 191
610 1.000e-04gi|641649617|ref|XP_008186443.1| PREDICTED: protein eyes shut [Acyrthosiphon pisum]  clstr ali  53  274...CDNGGTCVDGV---DGYTCTCPKGLTGQSCE...... 301
611 1.000e-04gi|47226149|emb|CAG08296.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  35  922ENKCQHGAECVDAV---NGYICVCKEGFSGLFCE...... 952
612 1.000e-04gi|548511552|ref|XP_005694630.1| PREDICTED: LOW QUALITY PROTEIN: slit homolog 3 protein [Capra hircus]  clstr ali  34  934DNDCENNATCVDGV---NNYACVCPPNYTGELCDEVID.. 968
613 1.000e-04gi|560953398|ref|XP_006199211.1| PREDICTED: slit homolog 3 protein [Vicugna pacos]  clstr ali  42 1010...CRHGAQCVDAV---NGYTCTCPQGFSGLFCE...... 1037
614 1.000e-04gi|635125279|ref|XP_008013449.1| PREDICTED: slit homolog 3 protein [Chlorocebus sabaeus]  clstr ali  39 1254...CRHGAQCMDTI---NGYTCTCPQGFSGPFCE...... 1281
615 1.000e-04gi|625184074|ref|XP_007649233.1| PREDICTED: slit homolog 3 protein isoform X1 [Cricetulus griseus]  clstr ali  42 1057...CRHGAQCVDAV---NGYTCICPQGFSGLFCE...... 1084
616 1.000e-04gi|665404123|ref|NP_001259924.2| eyes shut, isoform E [Drosophila melanogaster]  clstr ali  35 1315DNPCQYGGTCVQ--FPGSGYLCLCPLGKHGHYCEHN.... 1348
617 1.000e-04gi|195433705|ref|XP_002064848.1| GK15151 [Drosophila willistoni]  clstr ali  35 1265DNPCQYGGTCVQ--FPGSGYLCLCPLGKHGHYCEHN.... 1298
618 1.000e-04gi|586482151|ref|XP_006871590.1| PREDICTED: delta-like protein 3 [Chrysochloris asiatica]  clstr ali  41  281.NPCLNGGSCSET---PGSFECACPRGFYGLRCEV..... 311
619 1.000e-04gi|537217432|gb|ERE82041.1| sushi, nidogen and EGF-like domain-containing protein 1 [Cricetulus griseus]  clstr ali  41 2223DCECRNGGRCL----GTNTTLCQCPPGFFGLLCEFEVTAT 2258
620 1.000e-04gi|357612923|gb|EHJ68236.1| hypothetical protein KGM_05707 [Danaus plexippus]  clstr ali  34 1545NNPCLHGGKCVDRDPARR-YDCICTFGYAGHDCELE.... 1579
621 1.000e-04gi|525025556|ref|XP_005060236.1| PREDICTED: neurocan core protein [Ficedula albicollis]  clstr ali  42  601..PCQNGGTCIDEV---NSFVCLCLPSYGGSRCEKDTE.. 633
622 1.000e-04gi|195344744|ref|XP_002038939.1| GM17111 [Drosophila sechellia]  clstr ali  37 2404..PCHNGGRCVDTRFGPH---CSCPVGYAGPRCQ...... 2432
623 1.000e-04gi|542239158|ref|XP_005457174.1| PREDICTED: tyrosine-protein kinase receptor Tie-1-like isoform X2 [Oreochromis niloticus]  clstr ali  55  314.CRCQNGGIC------SRFSGCQCPRGWRGQHCE...... 340
624 1.000e-04gi|655838841|ref|XP_008260350.1| PREDICTED: pikachurin [Oryctolagus cuniculus]  clstr ali  53  584EASCVNGGTCTAVKADSYI--CLCPLGFKGRHCE...... 615
625 1.000e-04gi|583971527|ref|XP_006781185.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1-like [Neolamprologus brichardi]  clstr ali  60 1542...CQNGGTCVS-KW--NTYICDCPTGYGGKNCE...... 1569
626 1.000e-04gi|612006750|ref|XP_007487497.1| PREDICTED: pikachurin isoform X1 [Monodelphis domestica]  clstr ali  53  586EASCINGGTCTAVKADSYI--CLCPLGFKGRHCE...... 617
627 1.000e-04gi|541040163|gb|ERG79711.1| egf-like domain containing protein [Ascaris suum]  clstr ali  56  203...CLNGGTEMK-------QRCLCPPNFLGYHCEIDTNRT 232
628 1.000e-04gi|585672658|ref|XP_006889604.1| PREDICTED: pikachurin [Elephantulus edwardii]  clstr ali  58  548...CINGGTCTATKADSYI--CLCPLGFKGRHCE...... 576
629 1.000e-04gi|344250535|gb|EGW06639.1| Pikachurin [Cricetulus griseus]  clstr ali  53  452EASCINGGTCAAIKADSYI--CLCPLGFRGRHCE...... 483
630 1.000e-04gi|528504705|ref|XP_001921123.3| PREDICTED: neural-cadherin [Danio rerio]  clstr ali  53 2516...CRNGGTCLAHSTKS--YQCRCPEGFRGQWCEI..... 2545
631 1.000e-04gi|594078724|ref|XP_006063051.1| PREDICTED: pikachurin isoform X1 [Bubalus bubalis]  clstr ali  53  580EASCINGGTCTASKADSYI--CLCPLGFRGRHCE...... 611
632 1.000e-04gi|521025889|gb|EPQ07677.1| Tyrosine-protein kinase receptor Tie-1 [Myotis brandtii]  clstr ali  51  275.CQCQNGGTC------DRFSGCVCPPGWHGVHCE...... 301
633 1.000e-04gi|542239156|ref|XP_005457173.1| PREDICTED: tyrosine-protein kinase receptor Tie-1-like isoform X1 [Oreochromis niloticus]  clstr ali  55  314.CRCQNGGIC------SRFSGCQCPRGWRGQHCE...... 340
634 1.000e-04gi|351695636|gb|EHA98554.1| Pikachurin [Heterocephalus glaber]  clstr ali  53  589EASCVNGGTCTAVKADSYI--CLCPLGFKGRHCE...... 620
635 2.000e-04gi|700338949|ref|XP_009914409.1| PREDICTED: fibropellin-3-like, partial [Haliaeetus albicilla]  clstr ali  36  90..PCLNNATCVAQQQN---YNCRCMPGFTGKNCEEVID.. 122
636 2.000e-04gi|270002799|gb|EEZ99246.1| hypothetical protein TcasGA2_TC000871 [Tribolium castaneum]  clstr ali  28 2236EKPCLLGANCTDLVAD---FSCSCPPGFTGKRCQEKID.. 2270
637 2.000e-04gi|344239219|gb|EGV95322.1| Sushi, nidogen and EGF-like domain-containing protein 1 [Cricetulus griseus]  clstr ali  55  941...CQNGGTCVPG---ANAHSCDCRPGFKGRHCEL..... 969
638 2.000e-04gi|640786996|ref|XP_008049261.1| PREDICTED: protein crumbs homolog 2, partial [Tarsius syrichta]  clstr ali  32  282..PCLNRGRCQDL---PSGFQCHCPDGYAGLTCQEDVDE. 315
639 2.000e-04gi|260789858|ref|XP_002589961.1| hypothetical protein BRAFLDRAFT_81597 [Branchiostoma floridae]  clstr ali  40  261...CVNGATCK-GCFNSLITTCDCQAGFTGERCEININE. 295
640 2.000e-04gi|11526769|gb|AAG36772.1|AF210320_1 Slit3 [Danio rerio]  clstr ali  37  994DNDCENNSTCVDGI---NNYTCVCPPNYKGDLCEEVVD.. 1028
641 2.000e-04gi|584015744|ref|XP_006802632.1| PREDICTED: protein crumbs homolog 2-like [Neolamprologus brichardi]  clstr ali  38  495..PCLNGATCLDRL---NHFQCVCVSGYTGTLCDSDKEE. 528
642 2.000e-04gi|669331058|gb|KFD71230.1| hypothetical protein M514_04926 [Trichuris suis]  clstr ali  39  539...CENGGTCQDEV---NGISCKCPEEWTGGRCEEEINE. 571
643 2.000e-04gi|594661527|ref|XP_007178990.1| PREDICTED: uncharacterized protein LOC103010286 [Balaenoptera acutorostrata scammoni]  clstr ali  36  507..PCANNGTCVNL--DNGQYECSCAPGFSGKDCQ...... 536
644 2.000e-04gi|242017207|ref|XP_002429083.1| slit protein, putative [Pediculus humanus corporis]  clstr ali  35  997NHKCENNATCHDSVL---SYVCKCLPGFMGEYCEIKI... 1030
645 2.000e-04gi|297295684|ref|XP_002808486.1| PREDICTED: LOW QUALITY PROTEIN: slit homolog 3 protein-like [Macaca mulatta]  clstr ali  39  948...CRHGAQCMDTI---NGYTCTCPQGFSGPFCE...... 975
646 2.000e-04gi|444725687|gb|ELW66247.1| Slit like protein 3 protein [Tupaia chinensis]  clstr ali  42  859...CRHGAQCVDAV---NGYTCTCPQGFSGLFCE...... 886
647 2.000e-04gi|676410384|gb|KFO54587.1| Slit 3 protein, partial [Corvus brachyrhynchos]  clstr ali  34  822DNDCENNSTCVDGI---NNYVCLCPPNYTGELCDEVIN.. 856
648 2.000e-04gi|594636078|ref|XP_007171446.1| PREDICTED: slit homolog 3 protein isoform X2 [Balaenoptera acutorostrata scammoni]  clstr ali  42 1059...CRHGAQCVDAV---NGYTCVCPQGFSGLYCE...... 1086
649 2.000e-04gi|260818872|ref|XP_002604606.1| hypothetical protein BRAFLDRAFT_92840 [Branchiostoma floridae]  clstr ali  30 1227..PCQYG-TCQDLVAD---YSCTCSAGYAGKDCEINIDE. 1259
650 2.000e-04gi|260814370|ref|XP_002601888.1| hypothetical protein BRAFLDRAFT_124580 [Branchiostoma floridae]  clstr ali  37 2115.NPCRNGGNCVDRV---DGYTCTCVGHYMGTHC....... 2143
651 2.000e-04gi|584061162|ref|XP_006775024.1| PREDICTED: slit homolog 3 protein [Myotis davidii]  clstr ali  40 1118DNDCENNATCVDGI---NNYVCVCPPNYTGELC....... 1147
652 2.000e-04gi|554552382|ref|XP_005870681.1| PREDICTED: slit homolog 3 protein, partial [Myotis brandtii]  clstr ali  42  972...CRHGAQCVDAV---NGYTCLCPQGFSGLLCE...... 999
653 2.000e-04gi|47227548|emb|CAG04696.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  31 1726.NPCQNQGSCVPDPH--SGFTCACSEFYTGKSCET..... 1757
654 2.000e-04gi|194759666|ref|XP_001962068.1| GF14619 [Drosophila ananassae]  clstr ali  35 1376DNPCQYGGTCVQ--FPGSGYLCLCPLGKHGHYCEHN.... 1409
655 2.000e-04gi|585187308|ref|XP_006745117.1| PREDICTED: protocadherin Fat 4-like [Leptonychotes weddellii]  clstr ali  26 3922HSPCQHGGMCMDYWSWQ---LCHCKEGLTGKYCEKSI... 3955
656 2.000e-04gi|307173920|gb|EFN64668.1| Protein eyes shut [Camponotus floridanus]  clstr ali  44  37..PCLNGGTCNDGVA---TYNCTCVDGFVGVNCE...... 65
657 2.000e-04gi|625201815|ref|XP_007642611.1| PREDICTED: delta-like protein 3 isoform X1 [Cricetulus griseus]  clstr ali  41  281.NPCANGGSCSE---VSGSFECTCPRGFYGLRCEV..... 311
658 2.000e-04gi|625253872|ref|XP_007618273.1| PREDICTED: LOW QUALITY PROTEIN: delta-like protein 3 isoform X2 [Cricetulus griseus]  clstr ali  41  259.NPCANGGSCSE---ISGSFECTCPRGFYGLRCEV..... 289
659 2.000e-04gi|260821750|ref|XP_002606266.1| hypothetical protein BRAFLDRAFT_83982 [Branchiostoma floridae]  clstr ali  35  444..PCQNGGVCTS---SGDSYTCECVDGWGGPDCQTDDDE. 477
660 2.000e-04gi|541966557|ref|XP_005437914.1| PREDICTED: LOW QUALITY PROTEIN: basement membrane-specific heparan sulfate proteoglycan core protein-like, partial [  clstr ali  46 3417.NPCLHGGTCKGNA-------CLCPQGYTGPYCQ...... 3442
661 2.000e-04gi|674589022|emb|CDS32017.1| fat cadherin tumor suppressor [Hymenolepis microstoma]  clstr ali  38 4663..PCLNGGTCTSRRVRPSDFNCTCQTGFQGSLCEETTD.. 4711
662 2.000e-04gi|507537240|ref|XP_004652647.1| PREDICTED: pikachurin [Jaculus jaculus]  clstr ali  58  529...CINGGTCAAIKADSYI--CLCPLGFKGRHCE...... 557
663 2.000e-04gi|657817754|ref|XP_008335881.1| PREDICTED: versican core protein-like [Cynoglossus semilaevis]  clstr ali  42 1130...CLNGGTC---HKVSGLPTCSCAPGYTGYQCETDMDE. 1162
664 2.000e-04gi|642061263|emb|CDQ90600.1| unnamed protein product [Oncorhynchus mykiss]  clstr ali  39  953...CLNGGSC---YRRGSLPSCSCAPGYSGDHCETDIDE. 985
665 2.000e-04gi|512818271|ref|XP_004878794.1| PREDICTED: tyrosine-protein kinase receptor Tie-1 isoform X4 [Heterocephalus glaber]  clstr ali  51  284.CQCQNGGTC------DRFSGCVCPSGWHGVHCE...... 310
666 2.000e-04gi|542225047|ref|XP_005451816.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1-like isoform X1 [Oreochromis niloticus]  clstr ali  60 1659...CQNGGTCVS-KW--NTYICDCPTGYGGKNCE...... 1686
667 2.000e-04gi|632979363|ref|XP_007906426.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1, partial [Callorhinchus milii]  clstr ali  63 1429.NECLNGGTCV-NKW--NTYTCQCPIEFGGKNCE...... 1458
668 2.000e-04gi|612039162|ref|XP_007499129.1| PREDICTED: vasorin [Monodelphis domestica]  clstr ali  45  419...CLNGGTCRLGAW--HRLECLCPEGFLGLHCEVKAK.. 451
669 3.000e-04gi|551500438|ref|XP_005801768.1| PREDICTED: slit homolog 3 protein-like [Xiphophorus maculatus]  clstr ali  35  725ENKCQHGAECVDAI---NGYTCVCKEGFSGLFCE...... 755
670 3.000e-04gi|572269807|ref|XP_006612916.1| PREDICTED: uncharacterized protein LOC102681196 isoform X2 [Apis dorsata]  clstr ali  28 2176EKPCLLGANCTDLI---GDFTCDCPPGFTGKRCHEKID.. 2210
671 3.000e-04gi|585637814|ref|XP_006879135.1| PREDICTED: protein delta homolog 1 [Elephantulus edwardii]  clstr ali  32  97.NPCANNATCENLEV--GGYKCACVPGFQGDRCE...... 127
672 3.000e-04gi|632935107|ref|XP_007887824.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 [Callorhinchus milii]  clstr ali  45  593.NPCRNGGTC---KESHGTYQCVCLYRFTGKHCET..... 623
673 3.000e-04gi|161466|gb|AAA62163.1| fibropellin Ib [Strongylocentrotus purpuratus]  clstr ali  45  526..PCLNGGICVDGV---NGFVCQCPPNYSGTYCEISLD.. 558
674 3.000e-04gi|260795571|ref|XP_002592778.1| hypothetical protein BRAFLDRAFT_65357 [Branchiostoma floridae]  clstr ali  37  369.NLCQNGGNCTSCFGGSTTF-CDCLEGYGGTLCEINIDE. 405
675 3.000e-04gi|557331264|ref|XP_006038481.1| PREDICTED: protein delta homolog 1-like [Alligator sinensis]  clstr ali  37  183.NPCKNGGTCTD---IGAGYSCHCPHGYTGKSC....... 211
676 3.000e-04gi|512845124|ref|XP_002943134.2| PREDICTED: protein delta homolog 2 [Xenopus (Silurana) tropicalis]  clstr ali  37  153..PCQNNGRCYDRV---GDYECYCPEGFMGKSCEIPI... 184
677 3.000e-04gi|676266667|gb|KFO22548.1| Sushi, nidogen and EGF-like domain-containing protein 1 [Fukomys damarensis]  clstr ali  40  297.HPCQNGGICTNGV---NSFSCQCRAGFRGPTCE...... 326
678 3.000e-04gi|390369733|ref|XP_003731696.1| PREDICTED: neurogenic locus notch homolog protein 1-like, partial [Strongylocentrotus purpuratus]  clstr ali  39  281..PCENGGTCSDGM---NTFTCACAPGYTGPTC....... 308
679 3.000e-04gi|620971004|ref|XP_007660963.1| PREDICTED: neurocan core protein-like, partial [Ornithorhynchus anatinus]  clstr ali  43  67..PCQNGGTCIDEI---NSFVCLCLPSYGGSVCEKDT... 98
680 3.000e-04gi|426363624|ref|XP_004048937.1| PREDICTED: neurogenic locus notch homolog protein 1 [Gorilla gorilla gorilla]  clstr ali  37  147.NPCANGGQC---LPFEASYICHCPPSFHGPTCRQDVNE. 181
681 3.000e-04gi|328702918|ref|XP_003242041.1| PREDICTED: cubilin-like [Acyrthosiphon pisum]  clstr ali  31  475.NPCQNNGLCLP-ELEPGDYTCTCTSGYYGQYCE...... 506
682 3.000e-04gi|410930456|ref|XP_003978614.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Takifugu rubripe  clstr ali  32 1242..PCQNGGLCNDGM---GEFQCDCKPGFIGAVCEAEVNE. 1275
683 3.000e-04gi|488510712|ref|XP_004447439.1| PREDICTED: slit homolog 3 protein-like, partial [Dasypus novemcinctus]  clstr ali  42  935...CRHGALCVDAV---NGYTCTCPQGFSGLFCE...... 962
684 3.000e-04gi|260835699|ref|XP_002612845.1| hypothetical protein BRAFLDRAFT_118409 [Branchiostoma floridae]  clstr ali  34 1893...CQNDATC---EPDGESFKCICPKGYAGTMCETNVD.. 1924
685 3.000e-04gi|558184808|ref|XP_006102093.1| PREDICTED: LOW QUALITY PROTEIN: slit homolog 3 protein, partial [Myotis lucifugus]  clstr ali  42 1038...CRHGAQCVDAV---NGYTCLCPQGFSGLLCE...... 1065
686 3.000e-04gi|642125870|emb|CDQ61207.1| unnamed protein product [Oncorhynchus mykiss]  clstr ali  32 2422..PCQNRGSCVPGPR--SSYTCVCSEFYTGKTCET..... 2452
687 3.000e-04gi|548339759|ref|XP_005722472.1| PREDICTED: versican core protein-like [Pundamilia nyererei]  clstr ali  40  414.NPCRNGGTCVDGLA---SFTCVCLPSYAGLFCE...... 443
688 3.000e-04gi|390360995|ref|XP_787781.3| PREDICTED: uncharacterized protein LOC582746 [Strongylocentrotus purpuratus]  clstr ali  35  854..PCRNGGTCMDLI---DGYQCSCLDGYKGKDCEISI... 887
689 3.000e-04gi|529435731|ref|XP_005237635.1| PREDICTED: LOW QUALITY PROTEIN: basement membrane-specific heparan sulfate proteoglycan core protein-like, partial [  clstr ali  46 3565.NPCLHGGTCKGNA-------CLCPQGYTGPYCQ...... 3590
690 3.000e-04gi|431896774|gb|ELK06078.1| Pikachurin [Pteropus alecto]  clstr ali  35  791..PCTHGGSCRPRKE---GYECDCPLGFEGLHCQKAITE. 824
691 3.000e-04gi|505846821|ref|XP_004616883.1| PREDICTED: neurocan core protein [Sorex araneus]  clstr ali  42  896..PCENGGTCIDEV---NGFVCLCLPSYGGSSCEKDTE.. 928
692 3.000e-04gi|148671398|gb|EDL03345.1| expressed sequence AU040377, isoform CRA_a [Mus musculus]  clstr ali  50  660EASCIHGGTCAAIKADSYI--CLCPLGFRGRHCE...... 691
693 3.000e-04gi|389615571|dbj|BAM20745.1| unknown protein, partial [Papilio polytes]  clstr ali  50  79...CLNGGTCL-YFELVQEQACKCPEGFNGQRCE...... 108
694 3.000e-04gi|551520130|ref|XP_005811557.1| PREDICTED: versican core protein-like [Xiphophorus maculatus]  clstr ali  42 1107.NDCLNGGSCFEK---GPVNICVCTPGFSGLHCETDVDE. 1141
695 3.000e-04gi|532027361|ref|XP_005356655.1| PREDICTED: pikachurin isoform X2 [Microtus ochrogaster]  clstr ali  58  571...CINGGTCAAIKADSYI--CLCPLGFRGRHCE...... 599
696 3.000e-04gi|699662366|ref|XP_009898837.1| PREDICTED: vasorin [Picoides pubescens]  clstr ali  45  380...CLNGGTC--HLGAQNLLECLCPAGFTGTYCEVGAR.. 412
697 3.000e-04gi|545183694|ref|XP_003362809.2| PREDICTED: vasorin [Equus caballus]  clstr ali  44  487DCPCLNGGTC--HLEARGHLKCLCPEGFTGLYCE...... 521
698 3.000e-04gi|611986236|ref|XP_007480360.1| PREDICTED: tyrosine-protein kinase receptor Tie-1 [Monodelphis domestica]  clstr ali  51  318.CRCQNGGTC------DRFTGCVCPSGWHGEHCE...... 344
699 4.000e-04gi|719788703|ref|XP_010223502.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 [Tinamus guttatus]  clstr ali  43 1471..PCRNGGVCV---WGARSYRCHCTPGFKGRHCEL..... 1500
700 4.000e-04gi|591383033|ref|XP_007065980.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 3 [Chelonia mydas]  clstr ali  28  430.NPCEHFGRCVN---TQGSFQCQCGRGYTGPRCETDINE. 464
701 4.000e-04gi|345806108|ref|XP_548462.3| PREDICTED: LOW QUALITY PROTEIN: protein crumbs homolog 2 [Canis lupus familiaris]  clstr ali  26  232..PCANNASCLDGLA---SFRCLCWPGYSGLQCEVDEDE. 265
702 4.000e-04gi|507946079|ref|XP_004682068.1| PREDICTED: protein delta homolog 1 [Condylura cristata]  clstr ali  35  133..PCANNGTCLNL--GDGSYECSCPPGFSGKDCQL..... 163
703 4.000e-04gi|670614329|gb|KFE60923.1| Coagulation factor XIIa [Hyalangium minutum]  clstr ali  40  255.NPCLNGGTCTDGV---NSFTCACAPTYEGATCQ...... 284
704 4.000e-04gi|507558050|ref|XP_004662763.1| PREDICTED: protein crumbs homolog 2 [Jaculus jaculus]  clstr ali  50 1108DNPCLNGGTCR---AASGISECICSAGFSGQFCEV..... 1139
705 4.000e-04gi|512917185|ref|XP_004928825.1| PREDICTED: protein crumbs-like [Bombyx mori]  clstr ali  33  70..PCAAGSTCVDGVA---SYSCQCQEGLTGPRCEVDID.. 102
706 4.000e-04gi|390342180|ref|XP_792282.3| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Strongylocentrotus  clstr ali  37 1425..PCLNGATCKDLIAGI---ECVCMPGYTGVFCE...... 1453
707 4.000e-04gi|260791938|ref|XP_002590984.1| hypothetical protein BRAFLDRAFT_69465 [Branchiostoma floridae]  clstr ali  48  192.NPCWFGGTCVDGIRD---FICVCPKGFEGEKCEI..... 222
708 4.000e-04gi|512919401|ref|XP_004929366.1| PREDICTED: LOW QUALITY PROTEIN: protein eyes shut-like [Bombyx mori]  clstr ali  42  264...CMNGGTCIDGI---DNFTCSCPPRLTGTLCE...... 291
709 4.000e-04gi|195493596|ref|XP_002094485.1| GE20177 [Drosophila yakuba]  clstr ali  31  430.HPCQNNGTC---IQSGRGTTCICQPGYTGAVC....... 458
710 4.000e-04gi|395505064|ref|XP_003756866.1| PREDICTED: slit homolog 3 protein [Sarcophilus harrisii]  clstr ali  31  901DNDCENNSTCLDGI---NNYVCVCPPNYTGELCDEVID.. 935
711 4.000e-04gi|542238549|ref|XP_005456940.1| PREDICTED: slit homolog 2 protein isoform X5 [Oreochromis niloticus]  clstr ali  40  933.NPCKNDGTCANDPVH--YYRCTCPYGFKGQNC....... 962
712 4.000e-04gi|542223573|ref|XP_005451249.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1-like isoform X2 [Oreochromis niloticus]  clstr ali  46  603..PCRNGGSC---KEEADSYRCVCPYRFTGKHCEV..... 632
713 4.000e-04gi|542223571|ref|XP_005451248.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1-like isoform X1 [Oreochromis niloticus]  clstr ali  46  603..PCRNGGSC---KEEADSYRCVCPYRFTGKHCEV..... 632
714 4.000e-04gi|498993527|ref|XP_004553021.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1-like [Maylandia zebra]  clstr ali  46  603..PCRNGGSC---KEEADSYRCVCPYRFTGKHCEV..... 632
715 4.000e-04gi|543244583|ref|XP_005415669.1| PREDICTED: slit homolog 2 protein [Geospiza fortis]  clstr ali  38 1042.NPCKNDGTCNNDPV--DFYRCTCPYGFKGQDCDIPI... 1075
716 4.000e-04gi|678208613|gb|KFV75593.1| Sushi, nidogen and EGF-like domain-containing protein 1, partial [Struthio camelus australis]  clstr ali  43  708..PCKNGGTCKDL---PGSFTCYCPEGFVGIQCET..... 737
717 4.000e-04gi|