current user: public

Query: d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}, from SCOP175

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
1 1.000e-14gi|405973659|gb|EKC38360.1| Cartilage matrix protein, partial [Crassostrea gigas]  clstr ali  38  142SNPCQNGGTCSN---GNNQYTCTCLPGWTGSNCEIDIDE. 177
2 5.000e-14NEWGM BRAFL jgi|Brafl1|118576|estExt_fgenesh2_pg.C_160142|Branchiostoma floridae|JGI  ali  40  232SNPCQNGGTCTD---GLNRYTCECVAGFTGDNCET..... 263
3 2.000e-12gi|390356372|ref|XP_783020.2| PREDICTED: uncharacterized protein LOC577714 [Strongylocentrotus purpuratus]  clstr ali  47  466SSPCVNGGTCVD---GHDSYTCNCAKGYDGADCEIDI... 499
4 3.000e-12NEWGM BRAFL jgi|Brafl1|70180|fgenesh2_pg.scaffold_26000220|Branchiostoma floridae|JGI  ali  47 4712ENPCLNGGRCVSRSDGFHDYTCNCPVGFEGRHCEINPN.. 4760
5 5.000e-12gi|195376839|ref|XP_002047200.1| GJ13308 [Drosophila virilis]  clstr ali  54  581NNHCFHGGTCM-LLPFLNIYYCNCPEGFTGQRCE...... 613
6 8.000e-12gi|260791603|ref|XP_002590818.1| hypothetical protein BRAFLDRAFT_90049 [Branchiostoma floridae]  clstr ali  38 1308SSPCRNGAVCLDR---FNGYLCQCPPGYKGLHCETDV... 1341
7 2.000e-11gi|328705632|ref|XP_001950566.2| PREDICTED: cubilin-like [Acyrthosiphon pisum]  clstr ali  44  50SNPCQNGGTCVDLY---NGFQCNCPNNWQGKMCELDVDE. 85
8 3.000e-11gi|334346827|ref|XP_001374277.2| PREDICTED: coagulation factor VII-like [Monodelphis domestica]  clstr ali  45  92SNPCQNGGTCVDQFQ---SYICFCPARFEGRNCETDKD.. 126
9 3.000e-11gi|194222061|ref|XP_001497249.2| PREDICTED: coagulation factor VII-like [Equus caballus]  clstr ali  31  92SNPCQNGGSCEDQLQ---SYICFCLDGFEGRNCETNTD.. 126
10 3.000e-11gi|260791920|ref|XP_002590975.1| hypothetical protein BRAFLDRAFT_69474 [Branchiostoma floridae]  clstr ali  37  274SNPCQNGGMCSD---GLNSYVCHCTAGFEGDNCETDMD.. 308
11 3.000e-11gi|344274298|ref|XP_003408954.1| PREDICTED: urokinase-type plasminogen activator-like [Loxodonta africana]  clstr ali  82  13NCSCLNGGTCVSYKYFSNIQRCNCPKKFQGEHCEIDTSKT 52
12 3.000e-11gi|260828414|ref|XP_002609158.1| hypothetical protein BRAFLDRAFT_131370 [Branchiostoma floridae]  clstr ali  41 2648SNPCMNGGSC-AVVSPSNRYICNCLPRFSGDNCQIDT... 2683
13 4.000e-11gi|405968413|gb|EKC33487.1| IgGFc-binding protein [Crassostrea gigas]  clstr ali  38  16SNPCQNGGTCTD--SSSNSYTCSCSPGWMGEDC....... 46
14 4.000e-11gi|403273068|ref|XP_003928348.1| PREDICTED: coagulation factor VII [Saimiri boliviensis boliviensis]  clstr ali  37  179SSPCQNGGSCEDQLQ---SYICFCPLGFEGRNCETNKD.. 213
15 7.000e-11gi|77736594|ref|NP_001029978.1| coagulation factor VII precursor [Bos taurus]  clstr ali  39  92SSPCQNGGSCEDQLR---SYICFCPDGFEGRNCETD.... 124
16 7.000e-11gi|410975468|ref|XP_003994153.1| PREDICTED: urokinase-type plasminogen activator [Felis catus]  clstr ali  80  32NCGCLNGGTCVSYKYFSNIQRCSCPKKFQGEHCEIDTSKT 71
17 9.000e-11gi|397482274|ref|XP_003812356.1| PREDICTED: coagulation factor IX [Pan paniscus]  clstr ali  44  99SNPCLNGGSCKDDI---NSYECWCPFGFEGKNCELDV... 132
18 9.000e-11gi|195579808|ref|XP_002079751.1| GD21853 [Drosophila simulans]  clstr ali  37 1178..PCMNGATCINLEPRLR-YRCICPDGFWGENCEL..... 1209
19 1.000e-10gi|118403542|ref|NP_001072819.1| coagulation factor 7 (serum prothrombin conversion accelerator) precursor [Xenopus (Silurana) tropicalis]  clstr ali  39  114SNPCMNGGTCFDQHQ---SYICTCPMGYEGRHCETN.... 146
20 1.000e-10gi|198435650|ref|XP_002123070.1| PREDICTED: similar to Ficolin-2 precursor (Ficolin-B) (Ficolin-beta) (L-ficolin) (Collagen/fibrinogen domain-contain  clstr ali  46  157SSPCLNGGTCS---RGPNAYTCFCPLGYTGRNCEI..... 188
21 1.000e-10NEWGM CAP jgi|Capca1|169322|estExt_Genewise1Plus.C_650063|Capitella sp.1|JGI  ali  41  203SNPCANGGTCEDHI---NGFTCRCPNGYTGPLCE...... 233
22 1.000e-10gi|119608837|gb|EAW88431.1| coagulation factor IX (plasma thromboplastic component, Christmas disease, hemophilia B), isoform CRA_a [Homo sapiens] :_  clstr ali  44  99SNPCLNGGSCKDDI---NSYECWCPFGFEGKNCELDV... 132
23 1.000e-10NEWGM STRPU GLEAN3_22566|Strongylocentrotus purpuratus|Baylor  ali  45  51SNPCMNGGNCKDLV---NGYTCSCPEGFIGTHCE...... 81
24 2.000e-10gi|113205804|ref|NP_001038056.1| coagulation factor VII precursor [Sus scrofa]  clstr ali  39  90SNPCLNGGSCEDQLQ---AYICFCPEGFEGRNCETN.... 122
25 2.000e-10NEWGM STRPU GLEAN3_25062|Strongylocentrotus purpuratus|Baylor  ali  32 1492SNPCANGGTCTD---GINMYNCTCAPGYTGFNCSTEI... 1525
26 2.000e-10gi|390333218|ref|XP_003723664.1| PREDICTED: uncharacterized protein LOC100889616 [Strongylocentrotus purpuratus]  clstr ali  32 1708SNPCANGGTCTD---GINMYNCTCAPGYTGFNCSTEI... 1741
27 2.000e-10NEWGM BRAFL jgi|Brafl1|112923|fgenesh2_pg.scaffold_1734000001|Branchiostoma floridae|JGI  ali  37  6SGPCQNNATCHDYV---NFYTCECGPGWEGVHCEI..... 37
28 2.000e-10gi|354484110|ref|XP_003504234.1| PREDICTED: versican core protein-like isoform 1 [Cricetulus griseus]  clstr ali  38 2132SNPCRNGATCVD---GFNTFRCLCLPSYTGALCEQDT-ET 2167
29 2.000e-10gi|126723712|ref|NP_001075480.1| urokinase-type plasminogen activator precursor [Oryctolagus cuniculus]  clstr ali  77  32NCGCLNGGTCVTYKYFSNIWRCNCPKKFQGEHCEIDTLKT 71
30 3.000e-10NEWGM STRPU GLEAN3_17361|Strongylocentrotus purpuratus|Baylor  ali  35 3741..PCQNNGTCFNEI---NQYRCECSTGWTGTNCEQDINE. 3774
31 3.000e-10gi|348519084|ref|XP_003447061.1| PREDICTED: coagulation factor X-like [Oreochromis niloticus]  clstr ali  42  133..PCQNGGVCED---GVNGYLCLCQPNFSGKNCEIDVN.. 165
32 3.000e-10NEWGM STRPU GLEAN3_20927|Strongylocentrotus purpuratus|Baylor  ali  43  149SSPCVNGGTCVD---GHDSYTCNCAKGYDGADCEIAPDCT 185
33 3.000e-10gi|395546052|ref|XP_003774908.1| PREDICTED: coagulation factor IX [Sarcophilus harrisii]  clstr ali  37  92SNPCLNGGICKDEI---NSYECWCRKGYEGKNCELDADCS 128
34 3.000e-10gi|119608840|gb|EAW88434.1| coagulation factor IX (plasma thromboplastic component, Christmas disease, hemophilia B), isoform CRA_d [Homo sapiens] :_  clstr ali  44  99SNPCLNGGSCKDDI---NSYECWCPFGFEGKNCELDV... 132
35 3.000e-10gi|405974181|gb|EKC38847.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Crassostrea gigas]  clstr ali  37  60SNPCQNGATCVDEL---NRYSCTCQPGYQGTNCET..... 91
36 3.000e-10gi|348575754|ref|XP_003473653.1| PREDICTED: urokinase-type plasminogen activator-like [Cavia porcellus]  clstr ali  75  29NCGCLNGGTCVSYKYFSSMQRCSCPKKFQGEHCEIDASKT 68
37 4.000e-10gi|45383468|ref|NP_989674.1| coagulation factor IX precursor [Gallus gallus]  clstr ali  39  92SNPCKNGAVCKD---GVSSYECMCPPGYGGRNCEID.... 124
38 4.000e-10gi|356467177|gb|AET09719.1| hypothetical protein [Acropora millepora]  clstr ali  35  51SSPCKNGGTCEDR--GLGSYDCICPKGYIGAKCGKDIDE. 87
39 5.000e-10gi|348583579|ref|XP_003477550.1| PREDICTED: coagulation factor VII-like [Cavia porcellus]  clstr ali  36  123SNPCQNGGTCQDDFRL---YICFCLPNFSGRNCETN.... 155
40 5.000e-10gi|164419019|gb|ABY54817.1| c-type lectin [Branchiostoma japonicum]  clstr ali  36  147SAPCHNGATCQD---GANSLTCRCAPGYTGIHCETDIDE. 182
41 5.000e-10gi|405973660|gb|EKC38361.1| Versican core protein [Crassostrea gigas]  clstr ali  38  20SNSCQNGGTCHN---GNNQYTCSCLPGWTGTNCEIDIDE. 55
42 5.000e-10NEWGM STRPU GLEAN3_13545|Strongylocentrotus purpuratus|Baylor  ali  43  352SVPCMNGGTCMDLV---NGYTCSCTTGFNGIHCET..... 383
43 5.000e-10gi|344272704|ref|XP_003408171.1| PREDICTED: versican core protein isoform 1 [Loxodonta africana]  clstr ali  38 3124SNPCRNGATCVD---GFNTFTCLCLPSYVGALCEQDT-ET 3159
44 5.000e-10gi|46048882|ref|NP_990118.1| versican core protein precursor [Gallus gallus]  clstr ali  36 3298SNPCRNGATCID---GLNTFTCLCLPSYIGALCEQDT-ET 3333
45 5.000e-10gi|354468671|ref|XP_003496775.1| PREDICTED: urokinase-type plasminogen activator-like [Cricetulus griseus]  clstr ali  70  31NCGCQNGGICVSYKYFSSIRRCSCPKRFQGEHCEIDTSKT 70
46 5.000e-10gi|270008137|gb|EFA04585.1| cadherin-N [Tribolium castaneum]  clstr ali  46  842..PCLNGGTCVNLEPRFR-YRCHCPDGFWGENCEL..... 873
47 5.000e-10gi|27923751|sp|Q9VJB6.2|CADN2_DROME RecName: Full=Putative neural-cadherin 2; AltName: Full=Cadherin-N2; Short=dN2-cadherin; Flags: Precursor  clstr ali  37 1701..PCLNGATCINLEPRLR-YRCICPEGYWGENCEL..... 1732
48 6.000e-10gi|349803497|gb|AEQ17221.1| putative coagulation factor 7 (serum prothrombin conversion accelerator) [Pipa carvalhoi]  clstr ali  38  19SNPCMNGGTCFDQYQ---SYVCNCLMGFEGRNCETDLKE. 54
49 6.000e-10gi|327286460|ref|XP_003227948.1| PREDICTED: tissue-type plasminogen activator-like [Anolis carolinensis]  clstr ali  51  121...CFNGGRCQQPLYSSNLFICLCPPGFSGKHCEIDAKAT 157
50 6.000e-10gi|395501552|ref|XP_003755157.1| PREDICTED: urokinase-type plasminogen activator [Sarcophilus harrisii]  clstr ali  60  30DCGCLNNGVCISYKYF-KIHRCSCPENFIGEHCEIDISQ. 67
51 7.000e-10gi|390360114|ref|XP_794676.3| PREDICTED: uncharacterized protein LOC589956 [Strongylocentrotus purpuratus]  clstr ali  35 1803..PCQNNGTCFNEI---NQYRCECSTGWTGTNCEQDINE. 1836
52 7.000e-10gi|308453821|ref|XP_003089596.1| hypothetical protein CRE_30572 [Caenorhabditis remanei]  clstr ali  32  857..PCQNGGECEDIIGPPNSYNCTCTPQWTGTNCTIDVDE. 893
53 7.000e-10NEWGM STRPU GLEAN3_08165|Strongylocentrotus purpuratus|Baylor  ali  43  329SGPCMNGGTCMDLV---NGYTCSCPTGFNGTDCET..... 360
54 7.000e-10gi|291394978|ref|XP_002713921.1| PREDICTED: versican [Oryctolagus cuniculus]  clstr ali  38 3109SNPCRNGATCVD---GFNTFRCLCLPSYVGVLCEQDT-ET 3144
55 7.000e-10gi|348587520|ref|XP_003479515.1| PREDICTED: LOW QUALITY PROTEIN: versican core protein-like [Cavia porcellus]  clstr ali  38 3088SNPCRNGATCVD---GFNTFRCLCLPSYIGALCEQDT-ET 3123
56 7.000e-10gi|62088562|dbj|BAD92728.1| chondroitin sulfate proteoglycan 2 (versican) variant [Homo sapiens]  clstr ali  38 3147SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3182
57 7.000e-10gi|410948928|ref|XP_003981179.1| PREDICTED: versican core protein isoform 1 [Felis catus]  clstr ali  38 3132SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3167
58 7.000e-10gi|149414214|ref|XP_001510562.1| PREDICTED: urokinase-type plasminogen activator-like [Ornithorhynchus anatinus]  clstr ali  65  36.CHCQNGGECVSYKLFSRIHRCNCPKGFEGEHCEIDSQE. 73
59 7.000e-10NEWGM DROPS Contig6573_Contig4|GENSCAN_predicted_peptide_119|1881_aa|Drosophila pseudoobscura|Baylor  ali  37 1479..PCLNGATCINLEPRLR-YRCICPEGYWGENCEL..... 1510
60 8.000e-10gi|334350295|ref|XP_001366679.2| PREDICTED: coagulation factor IX [Monodelphis domestica]  clstr ali  40  179SNPCLNGGVCKD---GTNAYECWCRGGYEGKNCEIDASCS 215
61 8.000e-10gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Gallus gallus]  clstr ali  38 1020SSPCQNGGTCIDEV---NAFVCLCLPSYSGSRCEKDT... 1053
62 8.000e-10gi|395825586|ref|XP_003786008.1| PREDICTED: versican core protein [Otolemur garnettii]  clstr ali  36 3090SNPCRNGATCID---GFNTFRCLCLPSYVGALCEQDT-ET 3125
63 8.000e-10gi|402872034|ref|XP_003899948.1| PREDICTED: versican core protein [Papio anubis]  clstr ali  38 3061SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3096
64 8.000e-10gi|194220080|ref|XP_001504686.2| PREDICTED: versican core protein-like isoform 1 [Equus caballus]  clstr ali  36 3137SNPCRNGATCID---GFNTFRCLCLPSYIGALCEQDT-ET 3172
65 8.000e-10gi|30794358|ref|NP_851378.1| versican core protein precursor [Bos taurus]  clstr ali  36 3118SNPCRNGATCID---GFNTFRCLCLPSYVGALCEQDT-ET 3153
66 9.000e-10gi|426236925|ref|XP_004012414.1| PREDICTED: coagulation factor VII [Ovis aries]  clstr ali  40  113.SPCQNGGSCEDQLQ---AYICFCPDGFEGRNCETD.... 144
67 9.000e-10gi|395849900|ref|XP_003797547.1| PREDICTED: coagulation factor IX [Otolemur garnettii]  clstr ali  42  101SNPCLNGGSCRDDV---NSYECWCRLGFEGKNCELD.... 133
68 9.000e-10gi|390457552|ref|XP_002742598.2| PREDICTED: coagulation factor VII [Callithrix jacchus]  clstr ali  34  76SSPCQNGGSCEDQFQ---SYICFCLLGFEGRNCETNKD.. 110
69 9.000e-10gi|156366319|ref|XP_001627086.1| predicted protein [Nematostella vectensis]  clstr ali  40  7SNPCQNGATCND---GVNNYTCVCLSKFIGANCET..... 38
70 9.000e-10gi|22090636|dbj|BAC06838.1| Pf2-cadherin [Ptychodera flava]  clstr ali  46  459SDPCLNGGECID---GVNGYICVCPPGFSGIHCEL..... 490
71 9.000e-10gi|417401309|gb|JAA47545.1| Putative trypsin-like serine protease [Desmodus rotundus]  clstr ali  40  105SNPCQNGGSCEDQFQ---SYICFCPEEFEGRHCETNKD.. 139
72 9.000e-10gi|330340395|ref|NP_001193358.1| versican core protein precursor [Sus scrofa]  clstr ali  38 3119SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3154
73 9.000e-10gi|345798621|ref|XP_003434465.1| PREDICTED: versican core protein isoform 2 [Canis lupus familiaris]  clstr ali  38 3138SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3173
74 9.000e-10gi|224052406|ref|XP_002193229.1| PREDICTED: plasminogen activator, urokinase [Taeniopygia guttata]  clstr ali  50  38ECLCLNGGRCISYYLFSGITRCICPDGYTGIHCELDTDST 77
75 9.000e-10gi|221131712|ref|XP_002162352.1| PREDICTED: similar to predicted protein, partial [Hydra magnipapillata]  clstr ali  36 3516ENPCLNGGTC--YPIFPSGYRCKCMQGFDGLQCQLSTR.. 3551
76 1.000e-09gi|121949811|ref|NP_001073605.1| coagulation factor VII precursor [Macaca mulatta]  clstr ali  34  118SNPCQNGGSCKDQLQ---SYICFCLPSFEGRNCEKNKD.. 152
77 1.000e-09gi|326924365|ref|XP_003208399.1| PREDICTED: coagulation factor IX-like [Meleagris gallopavo]  clstr ali  39  92SNPCKNGAMCKD---GVSSYECMCPPGYGGRNCEID.... 124
78 1.000e-09NEWGM STRPU GLEAN3_07661|Strongylocentrotus purpuratus|Baylor  ali  37  105..PCQNGGTCTD---GLNSYTCACVLGYTGSMCETEI... 136
79 1.000e-09gi|148668663|gb|EDL00982.1| mCG116562, isoform CRA_b [Mus musculus]  clstr ali  38 3150SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3185
80 1.000e-09gi|313676|emb|CAA25806.1| pot. pro-plasminogen activator [Sus scrofa]  clstr ali  75  32NCGCLNGGKCVSYKYFSNIQRCSCPKKFQGEHCEIDTSQT 71
81 1.000e-09gi|260822961|ref|XP_002602286.1| hypothetical protein BRAFLDRAFT_76974 [Branchiostoma floridae]  clstr ali  33  600SNPCQNGGTCINME---NAYRCQCPEQYKGKNCDTERNC. 635
82 1.000e-09gi|194880373|ref|XP_001974422.1| GG21727 [Drosophila erecta]  clstr ali  37 1618..PCLNGATCINLEPRLR-YRCICPEGYWGENCEL..... 1649
83 2.000e-09gi|390331768|ref|XP_800523.3| PREDICTED: uncharacterized protein LOC588697 [Strongylocentrotus purpuratus]  clstr ali  36  374SNPCLNGGSCNPQAN--SQYYCGCTFGWTGQNCETDID.. 409
84 2.000e-09gi|351704668|gb|EHB07587.1| Coagulation factor IX [Heterocephalus glaber]  clstr ali  46  99SNPCLNGGSCKDDI---NAYECWCPLGFEGQNCEL..... 130
85 2.000e-09NEWGM STRPU GLEAN3_01994|Strongylocentrotus purpuratus|Baylor  ali  40  34SSPCMNGGTCMDLV---NGYTCSCAIGFNGTDCET..... 65
86 2.000e-09gi|338818097|sp|A6MFK7.1|FAXD1_DEMVE RecName: Full=Venom prothrombin activator vestarin-D1; Short=vPA; AltName: Full=Venom coagulation factor Xa-like  clstr ali  33  92SNPCHYGGTCKD---GIGSYTCTCLAGYEGKNCEHD.... 124
87 2.000e-09gi|291239496|ref|XP_002739660.1| PREDICTED: EGF-like domain-containing protein-like [Saccoglossus kowalevskii]  clstr ali  27  258SNPCYNGATCIDLI---DSYECNCAPGYELDRCQADIDE. 293
88 2.000e-09gi|156345300|ref|XP_001621318.1| hypothetical protein NEMVEDRAFT_v1g145311 [Nematostella vectensis]  clstr ali  47  78.CPCQNGGTCYPHPYGSGQYECACPKGFNGSRCEINIDE. 118
89 2.000e-09gi|119769|sp|P00741.1|FA9_BOVIN RecName: Full=Coagulation factor IX; AltName: Full=Christmas factor; Contains: RecName: Full=Coagulation factor IXa l  clstr ali  42  53SNPCLNGGMCKDDI---NSYECWCQAGFEGTNCELD.... 85
90 2.000e-09gi|296189002|ref|XP_002742599.1| PREDICTED: vitamin K-dependent protein Z [Callithrix jacchus]  clstr ali  33  93SQPCLHNGSCQDS---TRGYTCSCPPGYEGINCEIAKNE. 128
91 2.000e-09NEWGM STRPU GLEAN3_04532|Strongylocentrotus purpuratus|Baylor  ali  40  252SSPCVNGGMCVD---GHDSYTCNCAKGYNGANCEIGSDST 288
92 2.000e-09gi|260794149|ref|XP_002592072.1| hypothetical protein BRAFLDRAFT_104759 [Branchiostoma floridae]  clstr ali  38  265SSPCRNGAVCLDR---FNGYLCQCPPGYKGLHCETDV... 298
93 2.000e-09gi|327288006|ref|XP_003228719.1| PREDICTED: coagulation factor IX-like, partial [Anolis carolinensis]  clstr ali  36  161SNPCKNGGRCEDDV---SNYICWCPAGYEGRNCELD.... 193
94 2.000e-09NEWGM STRPU GLEAN3_16363|Strongylocentrotus purpuratus|Baylor  ali  36  37SDPCMNGGTCNDLV---NDYNCTCPTGFEGKNCGNEVAE. 72
95 2.000e-09gi|316980676|dbj|BAJ51987.1| green fluorescnet protein-PG-M/versican (V1) fusion protein [Cloning vector pInSRT-GFPV1]  clstr ali  38 2408SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 2443
96 2.000e-09gi|426230096|ref|XP_004009117.1| PREDICTED: versican core protein isoform 2 [Ovis aries]  clstr ali  36 2125SNPCRNGATCID---GFNTFRCLCLPSYVGALCEQDT-ET 2160
97 2.000e-09gi|21431624|sp|Q9ERB4.2|CSPG2_RAT RecName: Full=Versican core protein; AltName: Full=Chondroitin sulfate proteoglycan core protein 2; Short=Chondroit  clstr ali  38 2475SNPCRNGATCVD---GLNTFRCLCLPSYVGALCEQDT-ET 2510
98 2.000e-09NEWGM STRPU GLEAN3_04871|Strongylocentrotus purpuratus|Baylor  ali  35  13SNPCQHGGTCEETDQGFN---CTCLDGYKGDRCEDDVYAT 49
99 2.000e-09gi|137114|sp|P16227.1|UROK_PAPCY RecName: Full=Urokinase-type plasminogen activator; Short=U-plasminogen activator; Short=uPA; Contains: RecName: Ful  clstr ali  90  29DCGCLNGGTCMSNKYFSSIHWCNCPKKFGGQHCEIDKSKT 68
100 2.000e-09gi|6679377|ref|NP_032899.1| urokinase-type plasminogen activator precursor [Mus musculus]  clstr ali  70  31NCGCQNGGVCVSYKYFSRIRRCSCPRKFQGEHCEIDASKT 70
101 2.000e-09NEWGM BRAFL jgi|Brafl1|76978|fgenesh2_pg.scaffold_67000142|Branchiostoma floridae|JGI  ali  33  496SNPCQNGGTCINME---NAYRCQCPEQYKGKNCDTERNC. 531
102 2.000e-09gi|327276869|ref|XP_003223189.1| PREDICTED: urokinase-type plasminogen activator-like [Anolis carolinensis]  clstr ali  52  36SCNCLNGGTCITYHLFSRMKRCVCPEGYSGDHCEID.... 71
103 2.000e-09gi|260788917|ref|XP_002589495.1| hypothetical protein BRAFLDRAFT_88354 [Branchiostoma floridae]  clstr ali  40  919SNPCLNGGVCSERHP--DGYFCACPTGFVGNNCE...... 950
104 2.000e-09gi|348557734|ref|XP_003464674.1| PREDICTED: tissue-type plasminogen activator-like [Cavia porcellus]  clstr ali  55  161...CFNGGTCWQPLYFSD-FVCQCPKGFMGKRCEIDTRVT 196
105 3.000e-09gi|198420881|ref|XP_002126557.1| PREDICTED: similar to SED-1 like protein [Ciona intestinalis]  clstr ali  29  321SNPCQNEGVCNNE--DGTTYNCTCPCGWNGTNCEIQIDE. 357
106 3.000e-09gi|260824241|ref|XP_002607076.1| hypothetical protein BRAFLDRAFT_68133 [Branchiostoma floridae]  clstr ali  34  443SNPCQHGGTCHDRI---NSYVCHCQSGYTGDNCET..... 474
107 3.000e-09gi|47226544|emb|CAG08560.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  48  9...CYNGGTCKEAVYTSD-YICQCPPGFSGTHCEINTQE. 43
108 3.000e-09gi|149410985|ref|XP_001513556.1| PREDICTED: coagulation factor IX [Ornithorhynchus anatinus]  clstr ali  39  92SNPCLNGGQCKDDI---NAYECWCLPGFEGKNCELE.... 124
109 3.000e-09NEWGM CAP jgi|Capca1|102284|e_gw1.161.44.1|Capitella sp.1|JGI  ali  28  42.NPCKNHATCIEPEDGSYGYTCKCLPGYTGAHCDIEIDE. 79
110 3.000e-09gi|344272708|ref|XP_003408173.1| PREDICTED: versican core protein isoform 3 [Loxodonta africana]  clstr ali  38 1390SNPCRNGATCVD---GFNTFTCLCLPSYVGALCEQDT-ET 1425
111 3.000e-09gi|114599321|ref|XP_001147534.1| PREDICTED: versican core protein isoform 1 [Pan troglodytes]  clstr ali  38 1379SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 1414
112 3.000e-09NEWGM TAEGU ENSTGUP00000007104 pep:known chromosome:taeGut3.2.4:Z:70949554:71039568:-1 gene:ENSTGUG00000006883 transcript:ENSTGUT0000000717  ali  36 3180SNPCRNGATCIDSL---NTFTCLCLPSYVGALCEQDT-ET 3215
113 3.000e-09NEWGM BRAFL jgi|Brafl1|124849|estExt_fgenesh2_pg.C_1590056|Branchiostoma floridae|JGI  ali  34 1769SAPCQNNARCILSEDREGGYYCNCPSGFEGRHCET..... 1803
114 3.000e-09gi|390356954|ref|XP_789788.3| PREDICTED: uncharacterized protein LOC584850 [Strongylocentrotus purpuratus]  clstr ali  37 1305SNPCQNGGTCSDIH---GGFQCFCPEGFKGDYCQT..... 1336
115 3.000e-09gi|393908503|gb|EJD75084.1| cadherin domain-containing protein [Loa loa]  clstr ali  40 3875..PCENEGTCI--PSGQKTYNCVCPPRYTGNNCEID.... 3906
116 4.000e-09gi|344284687|ref|XP_003414096.1| PREDICTED: coagulation factor X-like [Loxodonta africana]  clstr ali  27  257SNPCQNQGKCQD---GLGEYTCTCLEGFEGKNCELTIRE. 292
117 4.000e-09gi|47226546|emb|CAG08562.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  48  40...CYNGGTCKEAVYTSD-YICQCPPGFSGTHCEINTQE. 74
118 4.000e-09gi|410947702|ref|XP_003980582.1| PREDICTED: coagulation factor VII [Felis catus]  clstr ali  33  92SNPCQNGGSCEDQLQ---SYICFCLDNFEGRNCETN.... 124
119 4.000e-09gi|395855156|ref|XP_003800036.1| PREDICTED: coagulation factor VII [Otolemur garnettii]  clstr ali  34  90SNPCQNGGSCEDQLQ---SYVCFCLPEFEGRNCETNKN.. 124
120 4.000e-09gi|345798625|ref|XP_546039.3| PREDICTED: versican core protein isoform 4 [Canis lupus familiaris]  clstr ali  38 1396SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 1431
121 4.000e-09gi|405968866|gb|EKC33895.1| hypothetical protein CGI_10026390 [Crassostrea gigas]  clstr ali  48  52...CKNGGTCVESAPCSNSGSCICPENYSGEHCQ...... 82
122 5.000e-09gi|359720333|gb|AEV54351.1| chondroitin sulfate proteoglycan 2 isoform 2 [Xenopus laevis]  clstr ali  32 3592SNPCRNGAACVD---GIDSFKCICLPSYTGSLCEQDT... 3625
123 5.000e-09gi|301612480|ref|XP_002935750.1| PREDICTED: hypothetical protein LOC100101672 [Xenopus (Silurana) tropicalis]  clstr ali  35 3590SNPCRNGAACVD---GINSFSCICLPSYAGSLCEQDT... 3623
124 5.000e-09gi|344281578|ref|XP_003412555.1| PREDICTED: tissue-type plasminogen activator-like isoform 1 [Loxodonta africana]  clstr ali  52  91...CFNGGTCKQAVYFSD-FVCQCPEGFVGKRCEIDTNAT 126
125 5.000e-09gi|254692796|ref|NP_001157065.1| urokinase-type plasminogen activator precursor [Ovis aries]  clstr ali  72  32DCGCLNGGKCVSYKYFSNIQRCSCPKKFQGEYCEIDTSKT 71
126 5.000e-09gi|351697273|gb|EHB00192.1| Versican core protein, partial [Heterocephalus glaber]  clstr ali  38 2967SNPCRNGATCVD---GFNTFRCLCLPSYIGALCEQDT-ET 3002
127 5.000e-09gi|170589928|ref|XP_001899725.1| Cadherin domain containing protein [Brugia malayi]  clstr ali  39 3963.NPCKNEGTCI--PSSEKAYECACPPRYSGSNCEID.... 3995
128 6.000e-09NEWGM BRAFL jgi|Brafl1|90596|fgenesh2_pg.scaffold_199000061|Branchiostoma floridae|JGI  ali  42  313SSPCQHGGTCQDDV---NSYSCRCPTGFVGANCESD.... 345
129 6.000e-09gi|410955332|ref|XP_003984309.1| PREDICTED: fibulin-7 [Felis catus]  clstr ali  35  242SQPCQNGGTCVE---GISQYKCICPPGKTGSHCQTDVNE. 281
130 6.000e-09gi|281604094|ref|NP_001164031.1| versican core protein isoform 3 precursor [Rattus norvegicus]  clstr ali  38 1358SNPCRNGATCVD---GLNTFRCLCLPSYVGALCEQDT-ET 1393
131 6.000e-09gi|3253304|gb|AAC24360.1| versican V2 splice-variant precursor [Bos taurus]  clstr ali  36 1380SNPCRNGATCID---GFNTFRCLCLPSYVGALCEQDT-ET 1415
132 6.000e-09gi|159024138|gb|ABW87311.1| chondroitin sulfate proteoglycan 2 variant V1a [Xenopus laevis]  clstr ali  32 2684SNPCRNGAACVD---GIDSFKCICLPSYTGSLCEQDT... 2717
133 7.000e-09gi|156399381|ref|XP_001638480.1| predicted protein [Nematostella vectensis]  clstr ali  42 2854ENPCLNGGTCHDTVP-AGWRVCQCPRGYRGPHCE...... 2886
134 8.000e-09gi|74199332|dbj|BAE33190.1| unnamed protein product [Mus musculus]  clstr ali  36  93SNPCQNGGTCQDHLK---SYVCFCLLDFEGRNCEKSKNE. 128
135 8.000e-09gi|307611996|ref|NP_001182654.1| coagulation factor IX [Oryctolagus cuniculus]  clstr ali  42  99SNPCLNGGSCKDDI---NAYECWCQYGFEGKNCELD.... 131
136 8.000e-09NEWGM CIOIN ENSCINP00000006548 pep:novel scaffold:JGI2:scaffold_96:143800:147382:-1 gene:ENSCING00000017574 transcript:ENSCINT00000006548|C  ali  29  5SNPCQNEGVCNNE--DGTTYNCTCPCGWNGTNCEIQIDE. 41
137 8.000e-09gi|351714573|gb|EHB17492.1| Urokinase-type plasminogen activator [Heterocephalus glaber]  clstr ali  69  32.CGCLNGGSCVTYKYFSGIRRCNCPKRFQGEHCEIDAWKT 70
138 8.000e-09gi|334325774|ref|XP_001369090.2| PREDICTED: versican core protein [Monodelphis domestica]  clstr ali  38 3172SNPCRNGATCVD---GFNTFTCLCLPSYVGALCEQDT-ET 3207
139 9.000e-09gi|148230907|ref|NP_001083161.1| coagulation factor 10 precursor [Xenopus laevis]  clstr ali  34  91SNPCQYGGSCKD---GINEYTCFCNPGFEGKNCET..... 122
140 9.000e-09NEWGM BOMMO Bmb029161|Bombyx mori (silk moth)|Beijing Genomics Institute  ali  43  477..PCRNGGSCVNREPG---YRCHCPEGFWGENCEL..... 506
141 1.000e-08gi|410923004|ref|XP_003974972.1| PREDICTED: tissue-type plasminogen activator-like [Takifugu rubripes]  clstr ali  48  84...CYNGGTCKEAVYTSD-YICQCPTGFSGTHCEINTNE. 118
142 1.000e-08NEWGM BRAFL jgi|Brafl1|113027|fgenesh2_pg.scaffold_1867000001|Branchiostoma floridae|JGI  ali  38  55SDPCQNGGTC---EGQVNGYNCTCAPGYDGVHCETGI... 88
143 1.000e-08NEWGM STRPU GLEAN3_08337|Strongylocentrotus purpuratus|Baylor  ali  39  87SSSCQHGGTCSDNV---NQYNCSCIPGYEGTDCETD.... 119
144 1.000e-08gi|149057625|gb|EDM08868.1| coagulation factor VII, isoform CRA_b [Rattus norvegicus]  clstr ali  41  83SNPCQNGGTCQDHLK---SYVCFCPLDFEGRNCE...... 113
145 1.000e-08NEWGM STRPU GLEAN3_05820|Strongylocentrotus purpuratus|Baylor  ali  37  14SMPCRNGGTCT---YGINSYTCDCTTGYEGTNCETDIDE. 50
146 1.000e-08NEWGM BRAFL jgi|Brafl1|68722|fgenesh2_pg.scaffold_20000070|Branchiostoma floridae|JGI  ali  34  32SDPCQNGGICTDIV---NGYTCVCAPGYEGDNCET..... 63
147 1.000e-08NEWGM STRPU GLEAN3_12230|Strongylocentrotus purpuratus|Baylor  ali  41  398SNPCMNGGNCMDLV---DGYTCSCPDGFIGTHCE...... 428
148 1.000e-08gi|241715954|ref|XP_002413541.1| agrin, putative [Ixodes scapularis]  clstr ali  50  36.NPCQNGAECV---GHGNSYRCNCPKGFSGPNCE...... 65
149 1.000e-08NEWGM BRAFL jgi|Brafl1|109937|fgenesh2_pg.scaffold_720000004|Branchiostoma floridae|JGI  ali  45  641SDPCKNGGTCVD---GLDSYSCNCTDGFSGDTCE...... 671
150 1.000e-08gi|327290489|ref|XP_003229955.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein-like [Anolis carolinensis]  clstr ali  41 1057SSPCQNGGTCIDEI---NAFVCLCLPSYGGNLCERDT... 1090
151 1.000e-08gi|30580855|sp|Q28858.1|CSPG2_MACNE RecName: Full=Versican core protein; AltName: Full=Chondroitin sulfate proteoglycan core protein 2; Short=Chondro  clstr ali  36  762SNPCRNGATCAD---GFNTFRCLCLPSYVGALCEQDI-ET 797
152 1.000e-08gi|73661202|ref|NP_032005.1| coagulation factor IX precursor [Mus musculus]  clstr ali  39  99SNPCLNGGICKDDI---SSYECWCQVGFEGRNCELD.... 131
153 1.000e-08gi|327267979|ref|XP_003218776.1| PREDICTED: coagulation factor VII-like [Anolis carolinensis]  clstr ali  40  92SNPCQNGGTCTDQ---FQNYICICPIDYEGRNCEI..... 123
154 1.000e-08gi|94536958|ref|NP_001035400.1| coagulation factor IX precursor [Danio rerio]  clstr ali  38  94SSPCQNGGKCED---GMNTYTCWCPARFSGKNCELEM... 127
155 1.000e-08gi|348527140|ref|XP_003451077.1| PREDICTED: tissue-type plasminogen activator-like [Oreochromis niloticus]  clstr ali  45  87...CYNGGTCKEAVYTSD-YICQCPQGFTGAQCEINTNE. 121
156 1.000e-08gi|348557897|ref|XP_003464755.1| PREDICTED: coagulation factor IX [Cavia porcellus]  clstr ali  38  94SNPCLNGGICKDSI---DAYECWCQLGFEGRNCELDASC. 129
157 1.000e-08gi|137111|sp|P15120.1|UROK_CHICK RecName: Full=Urokinase-type plasminogen activator; Short=U-plasminogen activator; Short=uPA; Contains: RecName: Ful  clstr ali  53  39ECQCLNGGTCITYRFFSQIKRCLCPEGYGGLHCEIDTNS. 77
158 1.000e-08gi|395857515|ref|XP_003801137.1| PREDICTED: tissue-type plasminogen activator [Otolemur garnettii]  clstr ali  52  187...CFNGGTCWQALYFS-HFVCQCPEGFTGTRCEIDARAT 222
159 1.000e-08NEWGM STRPU GLEAN3_15205|Strongylocentrotus purpuratus|Baylor  ali  36  159SSPCQNGGTCHERR---GEYSCKCKTGYGDSNCEIE.... 191
160 1.000e-08gi|391338388|ref|XP_003743540.1| PREDICTED: neural-cadherin-like [Metaseiulus occidentalis]  clstr ali  50 2818..PCLNGGTCVNRRNGEGFY-CICPEGFGGELC....... 2847
161 2.000e-08gi|156350060|ref|XP_001622124.1| predicted protein [Nematostella vectensis]  clstr ali  37  143.NPCKNGGTCHFKSPGV--FSCTCAAGFSGNQCETDID.. 177
162 2.000e-08NEWGM STRPU GLEAN3_03042|Strongylocentrotus purpuratus|Baylor  ali  48  175.NPCQNGGACVD---GLDSYTCNCAKGYGGANCEI..... 205
163 2.000e-08gi|260821932|ref|XP_002606357.1| hypothetical protein BRAFLDRAFT_67600 [Branchiostoma floridae]  clstr ali  29 1255.NPCQHDGDCTDRV---NGFSCSCKPGYAGDTCETDLD.. 1288
164 2.000e-08gi|260797332|ref|XP_002593657.1| hypothetical protein BRAFLDRAFT_131951 [Branchiostoma floridae]  clstr ali  41  291...CQNGAACVNQP-GQNGYTCNCLPGWEGPHCET..... 321
165 2.000e-08gi|390369821|ref|XP_001191674.2| PREDICTED: deleted in malignant brain tumors 1 protein-like, partial [Strongylocentrotus purpuratus]  clstr ali  45  459SNPCMNGGNCKDLV---NGYTCSCPEGFIGTHCE...... 489
166 2.000e-08gi|338721040|ref|XP_001489324.2| PREDICTED: tissue-type plasminogen activator isoform 1 [Equus caballus]  clstr ali  55  94...CFNGGTCWQALYFSD-FVCQCPEGFVGKRCEIDASAT 129
167 2.000e-08gi|334314255|ref|XP_003340014.1| PREDICTED: LOW QUALITY PROTEIN: urokinase-type plasminogen activator-like [Monodelphis domestica]  clstr ali  64  73NCGCLNNGVCISYKYFSKIHRCSCPENFIGEHCEIDV... 109
168 2.000e-08gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  41 1147SNPCQNGGTCIDEI---NSFVCLCLPSYGGATCE...... 1177
169 2.000e-08gi|47229646|emb|CAG06842.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  53 1588.NPCLNGGTCVNL---WGSFSCDCPLGFGGKSCE...... 1617
170 2.000e-08gi|260811448|ref|XP_002600434.1| hypothetical protein BRAFLDRAFT_99624 [Branchiostoma floridae]  clstr ali  50 2485..PCLNGGRCVGPESDPDCFTCNCPVGFEGRHCEIN.... 2529
171 2.000e-08gi|403283170|ref|XP_003933000.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1, partial [Saimiri boliviensis boliviensis]  clstr ali  57 1404...CQNGGTCVNR---WNMYLCECPLQFGGKNCE...... 1431
172 2.000e-08gi|312074472|ref|XP_003139986.1| hypothetical protein LOAG_04401 [Loa loa]  clstr ali  40 1388..PCENEGTCI--PSGQKTYNCVCPPRYTGNNCEID.... 1419
173 2.000e-08NEWGM BRAFL jgi|Brafl1|99961|fgenesh2_pg.scaffold_350000059|Branchiostoma floridae|JGI  ali  50 2707..PCLNGGRCVSRSDGFHDYTCECPVGFEGRHCEIN.... 2751
174 3.000e-08NEWGM BRAFL jgi|Brafl1|250115|e_gw.556.52.1|Branchiostoma floridae|JGI  ali  38  7SNPCQNGGTCHDDV---NSYSCSCLPGYTGDKCE...... 37
175 3.000e-08gi|58332150|ref|NP_001011223.1| coagulation factor 9 precursor [Xenopus (Silurana) tropicalis]  clstr ali  33  92SNPCLNGGVCKDDV---SDYVCWCQQGYSGKNCELE.... 124
176 3.000e-08gi|123704351|ref|NP_001074046.1| cadherin EGF LAG seven-pass G-type receptor 2 precursor [Danio rerio]  clstr ali  51 1648NNPCLNGGSCVSL---WGSFRCDCALGFGGRNCE...... 1678
177 3.000e-08gi|395507536|ref|XP_003758079.1| PREDICTED: tissue-type plasminogen activator [Sarcophilus harrisii]  clstr ali  51  83...CFNGGTCQQALYFSD-FICQCPRGFSGKQCEIDNKA. 117
178 3.000e-08gi|395537667|ref|XP_003770815.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Sarcophilus harrisii]  clstr ali  53 1560...CQNGGTCVN---KWNTYICDCPLRYGGKNCE...... 1587
179 3.000e-08gi|260811472|ref|XP_002600446.1| hypothetical protein BRAFLDRAFT_109206 [Branchiostoma floridae]  clstr ali  47 4592ENPCLNGGRCVSRSDGFHDYTCNCTVGFEGRHCEIN.... 4638
180 3.000e-08NEWGM THETRA AMSG_00600T0 | AMSG_00600 | Thecamonas trahens ATCC 50062 hypothetical protein (16622 aa)|Thecamonas trahens|BROAD  ali  50  609SCPCLNGGECKNNA-------CECPPGFSGDSCECDTACT 642
181 4.000e-08gi|334312708|ref|XP_001382080.2| PREDICTED: fibulin-7 [Monodelphis domestica]  clstr ali  41  142SHPCQNGGTCVE---GVNQYKCTCPQGWTGNNCQ...... 172
182 4.000e-08gi|260792092|ref|XP_002591061.1| hypothetical protein BRAFLDRAFT_69384 [Branchiostoma floridae]  clstr ali  37  109SSPCPQNATCVDHV---NGYTCQCPPGFTGNSCETDIN.. 143
183 4.000e-08gi|345787551|ref|XP_541924.3| PREDICTED: neurocan core protein [Canis lupus familiaris]  clstr ali  41 1050SSPCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1083
184 4.000e-08gi|326665358|ref|XP_002661027.2| PREDICTED: neurocan core protein [Danio rerio]  clstr ali  35  143SNPCENGGTCIDKE---DSFVCLCLPSYSGDRCERDT... 176
185 4.000e-08gi|301769973|ref|XP_002920408.1| PREDICTED: coagulation factor IX-like [Ailuropoda melanoleuca]  clstr ali  41  119SDPCLNGGICKDDI---NSYECWCQAGFEGKNCELDV... 152
186 4.000e-08gi|208879560|gb|ACI31317.1| plasminogen activator [Carollia perspicillata]  clstr ali  50  92...CFNGGTCRQLLYFSD-FVCQCPEGYTGKLCEVDASAT 127
187 4.000e-08gi|292616627|ref|XP_002663097.1| PREDICTED: tissue-type plasminogen activator [Danio rerio]  clstr ali  45  87...CYNGGTCKEALYSSD-FICQCPPGFTGTQCEINTLE. 121
188 4.000e-08gi|326678531|ref|XP_003201086.1| PREDICTED: hypothetical protein LOC100537459 [Danio rerio]  clstr ali  38 1005.NPCLHGGSCL---IEGGGYSCLCPQGYSGESCEI..... 1035
189 5.000e-08gi|72141999|ref|XP_780758.1| PREDICTED: protocadherin Fat 1-like [Strongylocentrotus purpuratus]  clstr ali  34  59SNPCQNGGTCYEKFGALSYYRCFCTTQWIGRHCET..... 93
190 5.000e-08gi|348525655|ref|XP_003450337.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Oreochromis niloticus]  clstr ali  42 1221SCECLNGASCVNLPAGSGEYVCVCPDGFTGKRCEVDID.. 1261
191 5.000e-08gi|301753971|ref|XP_002912791.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein-like [Ailuropoda melanoleuca]  clstr ali  41 1075SSPCENGGTCIDEV---NAFVCLCLPSYGGSLCEKDT... 1108
192 5.000e-08gi|338716565|ref|XP_001916629.2| PREDICTED: LOW QUALITY PROTEIN: hyaluronan-binding protein 2 [Equus caballus]  clstr ali  41  155.NPCQNGGTCSRHRRRSK-FICTCPDGFQGRLCEIGSD.. 190
193 5.000e-08gi|301619787|ref|XP_002939269.1| PREDICTED: LOW QUALITY PROTEIN: hepatocyte growth factor activator-like [Xenopus (Silurana) tropicalis]  clstr ali  34  113ENPCEHGGTCHNIAER-GTYHCICPEGYTGKDCEIE.... 147
194 5.000e-08gi|405969700|gb|EKC34654.1| Deleted in malignant brain tumors 1 protein [Crassostrea gigas]  clstr ali  36  285.NPCQNAATCSRDYYYSTNYYCSCPRGYSGRNCE...... 317
195 5.000e-08NEWGM CAP jgi|Capca1|203378|fgenesh1_pg.C_scaffold_13000052|Capitella sp.1|JGI  ali  38  911SNPCQNGGVCVDQLKK---YECNCAIDYTGRNCE...... 941
196 5.000e-08gi|301765976|ref|XP_002918410.1| PREDICTED: tissue-type plasminogen activator-like isoform 3 [Ailuropoda melanoleuca]  clstr ali  52  91...CFNGGMCRQALYFSD-FVCQCPEGFLGKRCEIDASAT 126
197 6.000e-08gi|260833750|ref|XP_002611875.1| hypothetical protein BRAFLDRAFT_83101 [Branchiostoma floridae]  clstr ali  45  504.NPCLNGGTCNDFVGF---YNCTCPDSFTGSNCEEDVDE. 538
198 6.000e-08gi|328705698|ref|XP_003242878.1| PREDICTED: cubilin-like [Acyrthosiphon pisum]  clstr ali  41  151SNPCQNGGICVDLY---NGFQCNCPNNWQGRLCELDVDE. 186
199 6.000e-08NEWGM STRPU GLEAN3_28718|Strongylocentrotus purpuratus|Baylor  ali  40  322SDPCINGGSCTDLV---NAYSCSCPSGYAGDRCEI..... 353
200 6.000e-08gi|316980673|dbj|BAJ51985.1| green fluorescnet protein-PG-M/versican (V3) fusion protein [Cloning vector pInSRT-GFPV3]  clstr ali  38  654SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 689
201 6.000e-08gi|395753562|ref|XP_002831313.2| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1-like [Pongo abelii]  clstr ali  57  318...CQNGGTCVNR---WNMYLCECPLRFGGKNCE...... 345
202 7.000e-08JCVI_PEP_1096668994039 /source_dna_id=JCVI_ORF_1096668994038 /offset=0 /translation_table=11 /length=272 /full_length=272  ali  33  179SSPCQNGATCSDSELGAWEYSCACVDGFEGVNCEIDIDE. 222
203 7.000e-08NEWGM CIOSA ENSCSAVP00000015496 pep:novel reftig:CSAV2.0:reftig_0:1716198:1723939:-1 gene:ENSCSAVG00000009089 transcript:ENSCSAVT0000001567  ali  28  119SKPCLNNGVCTNVL---SSYTCSCMPGFNGNNCQTNID.. 153
204 7.000e-08gi|405969017|gb|EKC34032.1| Neurogenic locus notch-like protein 2 [Crassostrea gigas]  clstr ali  34  113SNPCMNGGVCSHR---FNDFVCICPNGYTGKLCQHDVD.. 147
205 7.000e-08gi|30583865|gb|AAP36181.1| Homo sapiens plasminogen activator, tissue [synthetic construct]  clstr ali  52  91...CFNGGTCQQALYFSD-FVCQCPEGFAGKCCEIDTRAT 126
206 7.000e-08gi|194374979|dbj|BAG62604.1| unnamed protein product [Homo sapiens]  clstr ali  52  91...CFNGGTCQQALYFSD-FVCQCPEGFAGKCCEIDTRAT 126
207 7.000e-08gi|130492452|ref|NP_001076238.1| tissue-type plasminogen activator precursor [Oryctolagus cuniculus]  clstr ali  51  92...CLNGGTCSQALYFSD-FVCQCPEGFVGKRCEVDTRA. 126
208 8.000e-08NEWGM CAP jgi|Capca1|141333|e_gw1.224.105.1|Capitella sp.1|JGI  ali  38  63SNPCLNGGSCMN---GINAYICECDSGFTGTNCEINIDE. 98
209 8.000e-08gi|156353169|ref|XP_001622947.1| predicted protein [Nematostella vectensis]  clstr ali  40  94.CPCQHGGTCHPHPYHSGQYECAFPAGFNGSRCESDID.. 133
210 8.000e-08NEWGM STRPU GLEAN3_27588|Strongylocentrotus purpuratus|Baylor  ali  38  243SGPCMNGGTCVD---GENRYSCDCTDSYTGTNCETGI... 276
211 8.000e-08gi|338718707|ref|XP_003363880.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein-like [Equus caballus]  clstr ali  41  869SSPCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 902
212 8.000e-08gi|391330169|ref|XP_003739536.1| PREDICTED: crumbs homolog 1-like [Metaseiulus occidentalis]  clstr ali  48  14NNPCKNGGTCSPLDDFS-EYQCICPPGFRGGQCE...... 46
213 9.000e-08NEWGM STRPU GLEAN3_09585|Strongylocentrotus purpuratus|Baylor  ali  45  207DNPCENGGTCLELL---SGYMCNCPPGFTRQNCE...... 237
214 9.000e-08gi|15030028|gb|AAH11256.1| Plasminogen activator, tissue [Mus musculus]  clstr ali  50  88...CFNGGTCQQALYFSD-FVCQCPDGFVGKRCDIDTRAT 123
215 9.000e-08gi|60392241|sp|P16293.2|FA9_PIG RecName: Full=Coagulation factor IX; AltName: Full=Christmas factor; Contains: RecName: Full=Coagulation factor IXa l  clstr ali  43  55.NPCLNGGLCKDDI---NSYECWCQVGFEGKNCELD.... 86
216 9.000e-08gi|1351380|sp|P15638.2|URT2_DESRO RecName: Full=Salivary plasminogen activator alpha 2; AltName: Full=BAT-PA; AltName: Full=DSPA alpha-2; AltName: Fu  clstr ali  47  92...CFNGGTCWQAASFSD-FVCQCPKGYTGKQCEVDTHAT 127
217 9.000e-08gi|339263904|ref|XP_003366920.1| putative cadherin domain protein [Trichinella spiralis]  clstr ali  43 2219SNPCLNGGTCVAD---FDGYKCQCSYAYTGRNCEI..... 2250
218 1.000e-07gi|26005794|dbj|BAC41349.1| receptor protein Notch1 [Cynops pyrrhogaster]  clstr ali  30  758SNPCMNGGTCKDM---TSGYLCACRDGFSGPNCQTNINE. 793
219 1.000e-07gi|410898553|ref|XP_003962762.1| PREDICTED: protein delta homolog 1-like [Takifugu rubripes]  clstr ali  36  130SSPCQNGGTCIDGDGPSAYSSCLCPPGFSGDFCEMLVD.. 167
220 1.000e-07gi|405950185|gb|EKC18187.1| Cubilin [Crassostrea gigas]  clstr ali  22  482SNPCRNGALCQNS---GSTYNCVCQPGYEGNQCQTNTNE. 517
221 1.000e-07gi|395513129|ref|XP_003760782.1| PREDICTED: neurocan core protein [Sarcophilus harrisii]  clstr ali  41 1094SSPCLNGGTCIDEV---NSFICLCLPSYGGSLCDKDT... 1127
222 1.000e-07NEWGM BRAFL jgi|Brafl1|110106|fgenesh2_pg.scaffold_735000016|Branchiostoma floridae|JGI  ali  47  546SNPCENGGTCTERQFFA-GYYCTCPTGYGGSHCEI..... 579
223 1.000e-07gi|260785516|ref|XP_002587807.1| hypothetical protein BRAFLDRAFT_92256 [Branchiostoma floridae]  clstr ali  37 3908SQPCLNNGTCTD---GQTSYSCQCGFGEKGDNCEI..... 3939
224 1.000e-07gi|47522924|ref|NP_999219.1| tissue-type plasminogen activator precursor [Sus scrofa]  clstr ali  52  91...CFNGGTCLQAIYFSD-FVCQCPVGFIGRQCEIDARAT 126
225 1.000e-07gi|157278399|ref|NP_001098301.1| tissue-type plasminogen activator precursor [Oryzias latipes]  clstr ali  45  87...CYNGGTCKESVYTSD-YICQCPQGFKGAQCEINSNE. 121
226 1.000e-07gi|300796742|ref|NP_001180011.1| neurocan core protein precursor [Bos taurus]  clstr ali  41 1078SSPCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 1111
227 1.000e-07gi|426230254|ref|XP_004009192.1| PREDICTED: neurocan core protein [Ovis aries]  clstr ali  41 1085SSPCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 1118
228 1.000e-07gi|339242823|ref|XP_003377337.1| putative cadherin domain protein [Trichinella spiralis]  clstr ali  43 2379SNPCLNGGTCVAD---FDGYKCQCSYAYTGRNCEI..... 2410
229 2.000e-07NEWGM CAP jgi|Capca1|141298|e_gw1.224.99.1|Capitella sp.1|JGI  ali  38  57SNPCLNGGSCMN---GINAYICECDSGFTGTNCEINIDE. 92
230 2.000e-07NEWGM BRAFL jgi|Brafl1|89646|fgenesh2_pg.scaffold_188000105|Branchiostoma floridae|JGI  ali  35  202.NPCNNGGTCTD---GVNSYTCQCAAGYTGNNCQT..... 232
231 2.000e-07gi|260817936|ref|XP_002603841.1| hypothetical protein BRAFLDRAFT_101343 [Branchiostoma floridae]  clstr ali  43  622SGPCQNGGQCQD---GDNSYTCDCPDGFLGERCEI..... 653
232 2.000e-07gi|301613762|ref|XP_002936378.1| PREDICTED: hypothetical protein LOC779471 [Xenopus (Silurana) tropicalis]  clstr ali  40 1325SNPCQNGGTCIDEI---NSFLCLCLSSYGGSTC....... 1354
233 2.000e-07gi|326678529|ref|XP_003201085.1| PREDICTED: neurocan core protein [Danio rerio]  clstr ali  41  45SNPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 78
234 2.000e-07gi|47228965|emb|CAG09480.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  45  121SNPCQNGGTCV---AGLNQYRCTCPQRWSGSHCQ...... 151
235 2.000e-07gi|410951063|ref|XP_003982221.1| PREDICTED: neurocan core protein [Felis catus]  clstr ali  41 1078SSPCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1111
236 2.000e-07gi|208879564|gb|ACI31319.1| plasminogen activator [Diaemus youngi]  clstr ali  44  92...CFNGGTCWEALHFSE-FVCQCPERYTGKWCEVDTHAT 127
237 2.000e-07gi|386118337|gb|AFI99116.1| seven transmembrane protocadherin flamingo [Clytia hemisphaerica]  clstr ali  42 1858DSPC-NTGTCKHSSSSLSGYVCDCPIGFTGEHCEIAKQK. 1895
238 2.000e-07gi|2499868|sp|Q28198.1|TPA_BOVIN RecName: Full=Tissue-type plasminogen activator; Short=t-PA; Short=t-plasminogen activator; Short=tPA; Contains: Rec  clstr ali  50  92...CFNGGTCRQALYSSD-FVCQCPEGFMGKLCEIDATAT 127
239 3.000e-07gi|148668664|gb|EDL00983.1| mCG116562, isoform CRA_c [Mus musculus]  clstr ali  38  451SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 486
240 3.000e-07NEWGM STRPU GLEAN3_03907|Strongylocentrotus purpuratus|Baylor  ali  50  260..PCLNGGTCVDFQTFG---FCLCPPGYSGVICQI..... 289
241 3.000e-07gi|410901334|ref|XP_003964151.1| PREDICTED: fibulin-7-like [Takifugu rubripes]  clstr ali  45  118SNPCQNGGTCVE---GVNQYKCTCPQRWSGSHCQ...... 148
242 3.000e-07gi|397493977|ref|XP_003817872.1| PREDICTED: neurocan core protein [Pan paniscus]  clstr ali  42 1092.SPCENGGTCIDEV---NGFVCLCLPSYGGSFCEKDT... 1124
243 3.000e-07gi|94732897|emb|CAK03590.1| novel protein similar to vertebrate cadherin EGF LAG seven-pass G-type receptor 1 (celsr1) [Danio rerio]  clstr ali  51  186NNPCLNGGSCVSL---WGSFRCDCALGFGGRNCE...... 216
244 3.000e-07NEWGM ANOCA ENSACAP00000012390 pep:novel scaffold:AnoCar1.0:scaffold_3018:560:10215:-1 gene:ENSACAG00000012619 transcript:ENSACAT0000001264  ali  40  442DQPCQNGGVCRDSE--SSSYVCECPQGFAGSNCE...... 473
245 3.000e-07gi|334312618|ref|XP_001381925.2| PREDICTED: tissue-type plasminogen activator-like [Monodelphis domestica]  clstr ali  48  84...CFNGGTCKQALYFPD-FICHCPRGFAGKQCEIDSNS. 118
246 4.000e-07gi|94733063|emb|CAK04018.1| novel protein similar to vertebrate chondroitin sulfate proteoglycan family (CSPG) [Danio rerio]  clstr ali  41  44SNPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 77
247 4.000e-07gi|390347626|ref|XP_780954.3| PREDICTED: uncharacterized protein LOC575460 [Strongylocentrotus purpuratus]  clstr ali  41  270SDPCQNGGTCED---GVNGYVCICVDGWGGGDCE...... 300
248 4.000e-07NEWGM HYDMA Hma2.213289 |Hydra magnipapillata (freshwater polyp)|JGI  ali  44  151.SPCQNGGTCLKSGKHFNDYNCRCPLGFSGKNCEI..... 187
249 4.000e-07gi|410924479|ref|XP_003975709.1| PREDICTED: neurocan core protein-like [Takifugu rubripes]  clstr ali  35  592SEPCENGGTCIDKI---DSFLCLCLPSYEGDRCEKDI... 625
250 4.000e-07gi|332253713|ref|XP_003275977.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein-like [Nomascus leucogenys]  clstr ali  42 1127.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1159
251 4.000e-07gi|1709255|sp|P55066.1|NCAN_MOUSE RecName: Full=Neurocan core protein; AltName: Full=Chondroitin sulfate proteoglycan 3; Flags: Precursor  clstr ali  42 1005.SPCENGGTCIDEV---NGFICLCLPSYGGSLCEKDT... 1037
252 4.000e-07gi|344238919|gb|EGV95022.1| Salivary plasminogen activator alpha 2 [Cricetulus griseus]  clstr ali  47  291...CFNGGACQQALYFSD-FVCQCPDGFVGKRCDIDTRAT 326
253 4.000e-07gi|47226395|emb|CAG08411.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  35  807ENPCANGGSC---RPKWDSYECDCPLGYDGKHCQ...... 837
254 4.000e-07gi|410896294|ref|XP_003961634.1| PREDICTED: von Willebrand factor A domain-containing protein 2-like [Takifugu rubripes]  clstr ali  56  303..PCLNGGTCVSE--GSEGYRCVCPPGYGGDHC....... 332
255 4.000e-07gi|345323236|ref|XP_003430692.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1-like [Ornithorhynchus anatinus]  clstr ali  53  270...CQNGGTCVN---KWSTYLCDCPLRFGGKNCE...... 297
256 5.000e-07NEWGM STRPU GLEAN3_09654|Strongylocentrotus purpuratus|Baylor  ali  38  101..PCKNNGTCVD---GTDYYECYCLQGFNGANCEIEVAE. 134
257 5.000e-07gi|301619356|ref|XP_002939057.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Xenopus (Silurana) tropicalis]  clstr ali  34 1186.CGCINGGSCVNFPPGQGEYLCLCPNGFEGDNCQVNIDE. 1226
258 5.000e-07NEWGM BRAFL jgi|Brafl1|69486|fgenesh2_pg.scaffold_23000193|Branchiostoma floridae|JGI  ali  41  625.NVCQNGGNCTSCFNGSSTF-CDCPDGFEGEFCEINID.. 660
259 5.000e-07gi|390351298|ref|XP_003727630.1| PREDICTED: neurogenic locus notch homolog protein 1-like [Strongylocentrotus purpuratus]  clstr ali  36  264SQPCFNGGTCRNLE---DRFTCECAPGYEGQNCKIDQNE. 299
260 5.000e-07NEWGM CAP jgi|Capca1|228840|estExt_fgenesh1_pg.C_32110002|Capitella sp.1|JGI  ali  38  61DSPCENGGTCSESEPYKWGYFCICPPNYGGRTCEVD.... 97
261 5.000e-07NEWGM STRPU GLEAN3_23879|Strongylocentrotus purpuratus|Baylor  ali  41  393SQPCSNGGTCRNLK---DRFICECAPGYEGQNCEIDQNE. 428
262 5.000e-07NEWGM CAP jgi|Capca1|223573|estExt_fgenesh1_pg.C_2170013|Capitella sp.1|JGI  ali  30  114NNPCRNGATCIDL---FDAYLCQCTNGWKGRQCDEDINE. 149
263 5.000e-07gi|403303604|ref|XP_003942416.1| PREDICTED: neurocan core protein [Saimiri boliviensis boliviensis]  clstr ali  42 1135.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1167
264 5.000e-07gi|344283059|ref|XP_003413290.1| PREDICTED: neurocan core protein [Loxodonta africana]  clstr ali  42 1043.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1075
265 6.000e-07NEWGM CAP jgi|Capca1|143690|e_gw1.7.176.1|Capitella sp.1|JGI  ali  36  44SDPCQNGGDCEDLV---NGFICHCRPGWTGKHCEHDINE. 79
266 6.000e-07NEWGM CAP jgi|Capca1|118218|e_gw1.418.27.1|Capitella sp.1|JGI  ali  37  53SNPCLNGATCYDRI---GGYKCECAKGFSGPQCDQDID.. 87
267 6.000e-07NEWGM BRAFL jgi|Brafl1|90363|fgenesh2_pg.scaffold_197000030|Branchiostoma floridae|JGI  ali  46  263...CENGGTCRD---GINEYTCDCADGFEGTHCETDRD.. 294
268 6.000e-07gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  33 2278...CLNGGSCH---KNGAVHTCSCAPGYAGDRCQTEFDE. 2310
269 6.000e-07gi|324507404|gb|ADY43139.1| Delta-like protein C [Ascaris suum]  clstr ali  43  286NSPCQNGGKC-SSGGFQNYYYCNCTIGFTGRNCEVEVD.. 322
270 7.000e-07gi|260793926|ref|XP_002591961.1| hypothetical protein BRAFLDRAFT_79554 [Branchiostoma floridae]  clstr ali  29  659SNPCHNNGICRDL---TNGFRCDCRPGWTGFNCQTDV... 692
271 7.000e-07gi|260821750|ref|XP_002606266.1| hypothetical protein BRAFLDRAFT_83982 [Branchiostoma floridae]  clstr ali  35  444..PCQNGGVCTSS---GDSYTCECVDGWGGPDCQTDDDE. 477
272 7.000e-07gi|291234311|ref|XP_002737092.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 3-like, partial [Saccoglossus kowalevskii]  clstr ali  38  982SNPCYNGGTCTNTP---SGYVCECSTEFEGPNCE...... 1012
273 7.000e-07gi|348558724|ref|XP_003465166.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein-like [Cavia porcellus]  clstr ali  42 1042.SPCENGGTCIDEV---NSFVCLCLPSYGGNLCEKDT... 1074
274 7.000e-07gi|354473864|ref|XP_003499152.1| PREDICTED: neurocan core protein [Cricetulus griseus]  clstr ali  42 1005.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1037
275 7.000e-07gi|332826030|ref|XP_003311747.1| PREDICTED: tissue-type plasminogen activator isoform 1 [Pan troglodytes]  clstr ali  52  91...CFNGGTCQQALYFSD-FVCQCPEGFAGKCCEIGNS.. 124
276 8.000e-07gi|291231561|ref|XP_002735734.1| PREDICTED: neurogenic locus notch homolog protein 2-like [Saccoglossus kowalevskii]  clstr ali  48  173.NPCQNGGSCVD---GVDAYTCNCVDGFVGFHCEI..... 203
277 8.000e-07gi|327263044|ref|XP_003216331.1| PREDICTED: versican core protein-like [Anolis carolinensis]  clstr ali  36  390SSPCRNGATCID---GVNTFTCLCLPSYVGALCEKDT-ET 425
278 8.000e-07NEWGM CAP jgi|Capca1|229022|estExt_fgenesh1_pg.C_280074|Capitella sp.1|JGI  ali  35 1417SSPCQNGGKCFDSYGF---YQCDCFDNYAGLNCE...... 1447
279 8.000e-07gi|344241310|gb|EGV97413.1| Neurocan core protein [Cricetulus griseus]  clstr ali  42  971.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1003
280 8.000e-07gi|61162135|dbj|BAD91056.1| Cj-cadherin [Caridina japonica]  clstr ali  36 2263.NPCYNGGRCIEGKSGI---RCKCPEGYDGPRCQ...... 2292
281 8.000e-07gi|345306462|ref|XP_003428469.1| PREDICTED: tissue-type plasminogen activator isoform 2 [Ornithorhynchus anatinus]  clstr ali  48  84...CYNGGTCYQALYFSD-FICSCPSGFDGKQCEINVNA. 118
282 8.000e-07gi|405973235|gb|EKC37959.1| Protocadherin Fat 1 [Crassostrea gigas]  clstr ali  38 2992SSPCKNGGSCIE---GPSSFICHCPPGFTGLECE...... 3022
283 9.000e-07NEWGM STRPU GLEAN3_05426|Strongylocentrotus purpuratus|Baylor  ali  41  131SDPCQNGGTCED---GVNGYVCICVDGWGGGDCE...... 161
284 9.000e-07gi|183396436|gb|ACC62112.1| coagulation factor VII (predicted) [Rhinolophus ferrumequinum]  clstr ali  40  92SNPCKNGGSCEDN---FQSYICLCPDDFEGRNCETNKN.. 126
285 9.000e-07gi|242014336|ref|XP_002427847.1| protocadherin-16 precursor, putative [Pediculus humanus corporis]  clstr ali  32 3956.NPCRNGGSCRQSPDGSSFF-CLCRPGYRGNHCETTSDS. 3992
286 1.000e-06NEWGM BRAFL jgi|Brafl1|237111|e_gw.342.20.1|Branchiostoma floridae|JGI  ali  30  953SDPCENGGDCRSISAG---YVCDCVAGYTGVNCEVEIDE. 988
287 1.000e-06gi|260826500|ref|XP_002608203.1| hypothetical protein BRAFLDRAFT_90357 [Branchiostoma floridae]  clstr ali  42  141...CENGGTCRD---GINEYSCDCADGFNGDTCQIDTNE. 173
288 1.000e-06gi|405966781|gb|EKC32021.1| Fibropellin-3, partial [Crassostrea gigas]  clstr ali  36  120SGPCQNYGTCTDLL---NDYNCSCVPGFNGTNCENN.... 152
289 1.000e-06gi|156368057|ref|XP_001627513.1| predicted protein [Nematostella vectensis]  clstr ali  23 1453.NPCKHASACDNTP---GGYTCTCKPGYTGQNCDVDIN.. 1486
290 1.000e-06gi|260819852|ref|XP_002605250.1| hypothetical protein BRAFLDRAFT_92276 [Branchiostoma floridae]  clstr ali  36  358.NVCQNGGFCKSCFNGSP--MCACSPGYTGVFCETDINE. 393
291 1.000e-06gi|348500902|ref|XP_003438010.1| PREDICTED: hypothetical protein LOC100704480 [Oreochromis niloticus]  clstr ali  38 1042SEPCANGGTCIDKI---DSFLCLCLPSYGGDMCEKDV... 1075
292 1.000e-06gi|344257115|gb|EGW13219.1| Protocadherin Fat 4 [Cricetulus griseus]  clstr ali  29 4080.SPCKNGAVCQN---FPGGFNCVCKTGYTGKMCESSVN.. 4113
293 1.000e-06NEWGM CAP jgi|Capca1|181613|estExt_Genewise1Plus.C_7690019|Capitella sp.1|JGI  ali  36  38...CQNGGTCQVAPTYWAGYRCSCPPGFIGLTCQIKVDE. 73
294 1.000e-06gi|405958597|gb|EKC24709.1| Oncoprotein-induced transcript 3 protein [Crassostrea gigas]  clstr ali  45  27...CYNGGTCIAYNNGYPGYYCNCPSGFTGLHCQ...... 57
295 1.000e-06NEWGM BRAFL jgi|Brafl1|126683|estExt_fgenesh2_pg.C_2240039|Branchiostoma floridae|JGI  ali  40 2525.NPCQNGATCHNTE---GSYFCNCTANTNGLHCE...... 2554
296 1.000e-06gi|291223058|ref|XP_002731529.1| PREDICTED: fat-like [Saccoglossus kowalevskii]  clstr ali  37 4436SDPCLNNGTCI---PQDAGYLCICPKNYTGPQCDT..... 4467
297 1.000e-06gi|405972121|gb|EKC36908.1| WD repeat-containing protein 68 [Crassostrea gigas]  clstr ali  38  117.NRCQNGGIC-SYLNGSLNYICECPTGYTGDWCEIKQD.. 152
298 1.000e-06NEWGM STRPU GLEAN3_18197|Strongylocentrotus purpuratus|Baylor  ali  51 2230..PCLNGGTCRD---FSGYFICRCPPGFQGETCQ...... 2258
299 2.000e-06gi|260791940|ref|XP_002590985.1| hypothetical protein BRAFLDRAFT_69464 [Branchiostoma floridae]  clstr ali  34  192SAPCQNEATCQD---GVNSFTCQCAPGFTGTLCET..... 223
300 2.000e-06gi|405957080|gb|EKC23316.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  36  471..PCQNNGTCTDLV---NDYHCDCVAGFNGTNCDINVD.. 503
301 2.000e-06gi|260817932|ref|XP_002603839.1| hypothetical protein BRAFLDRAFT_101341 [Branchiostoma floridae]  clstr ali  43 1891SRPCQNGGQCQD---GVNSYTCDCPDGYLGEHCEI..... 1922
302 2.000e-06NEWGM STRPU GLEAN3_08028|Strongylocentrotus purpuratus|Baylor  ali  32  83SNPCQNNGTCYDLI---DDYNCICVPEYEGKNCE...... 113
303 2.000e-06NEWGM BOMMO Bmb004636|Bombyx mori (silk moth)|Beijing Genomics Institute  ali  38  315...CLNGGRCVDAV---NNYTCDCTAGYTGARCETNVNE. 348
304 2.000e-06NEWGM STRPU GLEAN3_18671|Strongylocentrotus purpuratus|Baylor  ali  33  288.NPCLNGASCINEP---GSYTCECADGYTGNNCE...... 317
305 2.000e-06NEWGM STRPU GLEAN3_22557|Strongylocentrotus purpuratus|Baylor  ali  37  234SSPCLNGGSCLD---GVDGYVCQCLPNYTGTHCEISLD.. 268
306 2.000e-06gi|47551053|ref|NP_999703.1| fibropellin-3 precursor [Strongylocentrotus purpuratus]  clstr ali  37  334SSPCLNGGSCLD---GVDGYVCQCLPNYTGTHCEISLD.. 368
307 2.000e-06NEWGM BRAFL jgi|Brafl1|82263|fgenesh2_pg.scaffold_110000034|Branchiostoma floridae|JGI  ali  41  151SDPCQYGGTCVD---GVNSYTCQCVPGFIGDRCE...... 181
308 2.000e-06gi|405958595|gb|EKC24707.1| Deleted in malignant brain tumors 1 protein [Crassostrea gigas]  clstr ali  41  322.NPCNNGGTCYHN-YGYPGYYCTCPSGYSGRNC....... 352
309 2.000e-06gi|334326659|ref|XP_003340783.1| PREDICTED: neurocan core protein-like [Monodelphis domestica]  clstr ali  41  653SSPCLNGGTCIDEV---NSFICLCLPSYGGSLCDKDT... 686
310 2.000e-06gi|405958946|gb|EKC25025.1| Neurogenic locus notch-like protein 1 [Crassostrea gigas]  clstr ali  48  245...CLNGGSCVQENLKEEWYFCDCPVNFTGKHCE...... 275
311 2.000e-06gi|157104467|ref|XP_001648421.1| cubulin [Aedes aegypti]  clstr ali  36  35.NPCQHGGTC---TPFIDRYVCSCPPGYTGMRCQ...... 64
312 2.000e-06NEWGM TAEGU ENSTGUP00000012202 pep:novel chromosome:taeGut3.2.4:7:34258541:34286644:-1 gene:ENSTGUG00000011843 transcript:ENSTGUT0000001233  ali  43  443.CSCLNGGTCVTYPPGLGEYLCLCPNGFDGEFCQEDIR.. 482
313 2.000e-06gi|260811932|ref|XP_002600675.1| hypothetical protein BRAFLDRAFT_67738 [Branchiostoma floridae]  clstr ali  47 3647.CDCHNGGTCIERVNGFAAAVCQCLPGFGGEHCEIDIDA. 3689
314 2.000e-06gi|59860161|gb|AAX09643.1| mini-agrin [Mus musculus]  clstr ali  45  739DNPCLNGGSCIPRE---ATYECLCPGGFSGLHCE...... 769
315 2.000e-06gi|187607167|ref|NP_001120289.1| uncharacterized protein LOC100145345 precursor [Xenopus (Silurana) tropicalis]  clstr ali  38  87ENPCQNGGICQQYHY---SYTCLCPPSYSGRYCE...... 117
316 2.000e-06gi|405951958|gb|EKC19822.1| Kinesin-related motor protein Eg5 2 [Crassostrea gigas]  clstr ali  39  213DSPCQNNGTCLQRK---DSYNCSCPHGFVGENCDIE.... 245
317 2.000e-06gi|328721195|ref|XP_001944272.2| PREDICTED: cadherin-related tumor suppressor-like [Acyrthosiphon pisum]  clstr ali  28 3903NNPCMNGGSCKQTQDNIG-YFCLCRPGYRGNICELSADS. 3940
318 2.000e-06gi|321459270|gb|EFX70325.1| hypothetical protein DAPPUDRAFT_300527 [Daphnia pulex]  clstr ali  41 2186NNPCHNGGRCVEGRYGV---TCQCPSGYDGPRCQ...... 2216
319 3.000e-06gi|327285304|ref|XP_003227374.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Anolis carolinen  clstr ali  38 1213..PCHNSGTCK---QVGSGYICICPPGYGGLKCEKDIDE. 1246
320 3.000e-06NEWGM STRPU GLEAN3_16440|Strongylocentrotus purpuratus|Baylor  ali  34  123SQPCGNEGICQDEE---NGYTCTCEDGWTGTHCET..... 154
321 3.000e-06gi|405970071|gb|EKC35006.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  37  554..PCQNNGTCIDQV---NHFQCECVPGYNGTTCE...... 582
322 3.000e-06gi|126334857|ref|XP_001374633.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Monodelphis domestica  clstr ali  27 1348SDPCLNNAVCEDQI---GGFLCKCLPGFRGTRCEKNVDE. 1383
323 3.000e-06gi|395541765|ref|XP_003772809.1| PREDICTED: protocadherin Fat 4 [Sarcophilus harrisii]  clstr ali  35 4336NSPCQHGGTCTDHWSWQ---QCQCKEGLTGKYCE...... 4366
324 3.000e-06gi|156366074|ref|XP_001626966.1| predicted protein [Nematostella vectensis]  clstr ali  45 1059.CPCINGGVCHPHPYGSGRYTCTCPEGFTGNLCE...... 1094
325 3.000e-06gi|339235507|ref|XP_003379308.1| putative laminin G domain protein [Trichinella spiralis]  clstr ali  48  355..PCLNGGTCNDQ---WNSYVCQCVENFTGRNCE...... 383
326 3.000e-06gi|292628237|ref|XP_001920772.2| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Danio rerio]  clstr ali  35 1349..PCQNNGKCRSKE---GGYTCECPQDFTGERCEVNARS. 1382
327 3.000e-06gi|292622519|ref|XP_001921123.2| PREDICTED: neural-cadherin-like [Danio rerio]  clstr ali  48 1785..PCLNGGTCVDSELG---YRCKCPPMFDGPECQ...... 1813
328 3.000e-06gi|326668004|ref|XP_002662132.2| PREDICTED: hypothetical protein LOC116993 [Danio rerio]  clstr ali  38 4858.NPCRNGGTCID---GLNSFTCLCLPSYAGALCEQDTE.. 4891
329 4.000e-06NEWGM STRPU GLEAN3_04068|Strongylocentrotus purpuratus|Baylor  ali  36  139..PCLNDGTCTD---GYNSYYCTCDSDYTGIHCQTEID.. 171
330 4.000e-06NEWGM STRPU GLEAN3_00834|Strongylocentrotus purpuratus|Baylor  ali  35  829..PCRNGGTCMDLI---DGYQCSCLDGYKGKDCEISI... 862
331 4.000e-06gi|326932705|ref|XP_003212454.1| PREDICTED: tissue-type plasminogen activator-like [Meleagris gallopavo]  clstr ali  37  89.NKCYNGGQCSQAYYSPQLFICLCHHGFSGKQCEIDTE.. 125
332 4.000e-06gi|345497351|ref|XP_001603064.2| PREDICTED: hypothetical protein LOC100119261 [Nasonia vitripennis]  clstr ali  48  252..PCQNGGVCSSPG------RCTCPKGFTGNYCQIDVDE. 282
333 4.000e-06gi|327279116|ref|XP_003224304.1| PREDICTED: pikachurin-like [Anolis carolinensis]  clstr ali  46  684EASCINGGTCTASK--ADRYICLCPLGFKGRHCE...... 715
334 4.000e-06gi|345479135|ref|XP_001602595.2| PREDICTED: cadherin-related tumor suppressor-like [Nasonia vitripennis]  clstr ali  31 3892SSPCRNGGSCKESPDGSSFF-CLCRAGYRGNHCEVLTDS. 3929
335 5.000e-06gi|260791906|ref|XP_002590968.1| hypothetical protein BRAFLDRAFT_119097 [Branchiostoma floridae]  clstr ali  31  383SNPCQNGATCL---HGHNNYYCHCSFGYEGHNCQGDID.. 417
336 5.000e-06NEWGM BRAFL jgi|Brafl1|125151|estExt_fgenesh2_pg.C_1700013|Branchiostoma floridae|JGI  ali  38  289...CQNGAACVNQP-GQNGYTCNCLPGWEGPQCET..... 319
337 5.000e-06gi|260817802|ref|XP_002603774.1| hypothetical protein BRAFLDRAFT_86604 [Branchiostoma floridae]  clstr ali  41 2270...CENGGKCMD---GVDEYTCACPDGFSGVYCEV..... 2298
338 5.000e-06gi|410914515|ref|XP_003970733.1| PREDICTED: protocadherin Fat 4-like [Takifugu rubripes]  clstr ali  28 4374SNPCKNGALCQN---FPGGFNCLCKSGFAGKTCDSIIN.. 4408
339 5.000e-06NEWGM STRPU GLEAN3_26662|Strongylocentrotus purpuratus|Baylor  ali  36  498SNPCQNGGT---FSDIHGSLQCYCPEGFKGDYCQTD.... 530
340 5.000e-06gi|125835070|ref|XP_693952.2| PREDICTED: protocadherin Fat 1-like [Danio rerio]  clstr ali  43 4043SNPCLYGGTCIQNNL---DYSCKCRGKYSGQRCQI..... 4074
341 5.000e-06gi|340714879|ref|XP_003395950.1| PREDICTED: hypothetical protein LOC100648555 [Bombus terrestris]  clstr ali  48  224..PCLNGGVCTSPG------RCTCPKGFTGNQCQTDIDE. 254
342 5.000e-06gi|351698253|gb|EHB01172.1| Coagulation factor X [Heterocephalus glaber]  clstr ali  36  226NNPCQNQGTCRD---GLSEYECSCQEGFEGKNCELSTRK. 261
343 5.000e-06NEWGM TAEGU ENSTGUP00000007830 pep:known chromosome:taeGut3.2.4:12:9193095:9239982:1 gene:ENSTGUG00000007509 transcript:ENSTGUT00000007915|  ali  43 1256SSPCKNGGTC---SVSWGTYSCLCPVGFGGKDC....... 1285
344 6.000e-06NEWGM CAP jgi|Capca1|141247|e_gw1.224.44.1|Capitella sp.1|JGI  ali  32  37SDPCQNGATCID---GIESYACQCVPGYTGQ......... 64
345 6.000e-06NEWGM BRAFL jgi|Brafl1|85742|fgenesh2_pg.scaffold_144000115|Branchiostoma floridae|JGI  ali  44 1099...CQNGGNCVD---GIDSYTCDCAVGFEGTHCET..... 1127
346 6.000e-06gi|260793537|ref|XP_002591768.1| hypothetical protein BRAFLDRAFT_83542 [Branchiostoma floridae]  clstr ali  28 1232..PCANGATCLD---GLDLYTCVCGPGYTGYNCSVEI... 1263
347 6.000e-06NEWGM BRAFL jgi|Brafl1|87886|fgenesh2_pg.scaffold_167000026|Branchiostoma floridae|JGI  ali  44  203SNPCSNGGTCVDKL---NGYSCACPKGVAGQYCEALLDE. 238
348 6.000e-06gi|351712034|gb|EHB14953.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Heterocephalus glaber]  clstr ali  35 1148..PCLNSGICEDRV---GEFICECPSGYTGQLCEENINE. 1181
349 6.000e-06gi|301627960|ref|XP_002943134.1| PREDICTED: protein delta homolog 2-like [Xenopus (Silurana) tropicalis]  clstr ali  37  411..PCQNNGRCYDRV---GDYECYCPEGFMGKSCEIPI... 442
350 6.000e-06gi|260814370|ref|XP_002601888.1| hypothetical protein BRAFLDRAFT_124580 [Branchiostoma floridae]  clstr ali  36 2114SNPCRNGGNCVDRV---DGYTCTCVGHYMGTHC....... 2143
351 6.000e-06gi|260781661|ref|XP_002585922.1| hypothetical protein BRAFLDRAFT_90332 [Branchiostoma floridae]  clstr ali  37 2369.NPCYNGGTCVRTGLTTD-FTCTCPSDYTGDTCQ...... 2400
352 6.000e-06NEWGM PRIPA PPA26626 | PP14663 | WBGene00116180 | status:Predicted|Pristionchus pacificus|Wormbase  ali  42  65.CPCKNGGRCSPLSIRTPSAVCQCPLGFTGPHCE...... 97
353 6.000e-06NEWGM STRPU GLEAN3_26587|Strongylocentrotus purpuratus|Baylor  ali  42  16NASCLNGATCRPRASSDAGYICKCKKNFIGKHCERDAD.. 53
354 6.000e-06gi|291232409|ref|XP_002736151.1| PREDICTED: FAT tumor suppressor homolog 1-like [Saccoglossus kowalevskii]  clstr ali  41 1882SNPCYNGGTCTNTPSG---YVCKCSKGFEGPDCE...... 1912
355 7.000e-06gi|126311310|ref|XP_001381642.1| PREDICTED: delta-like 1 [Monodelphis domestica]  clstr ali  34  423SSPCSNGAQCVDL---GNSYLCQCQAGFTGRHCDNNMD.. 457
356 7.000e-06NEWGM BRAFL jgi|Brafl1|88138|fgenesh2_pg.scaffold_170000012|Branchiostoma floridae|JGI  ali  35  449...CQNGAACVNQP-GQNGYTCNCLPGWEGPQCQT..... 479
357 7.000e-06NEWGM STRPU GLEAN3_11771|Strongylocentrotus purpuratus|Baylor  ali  34 1069..PCQNGGRCIN---GQGRYTCTCRLGYSGLNCE...... 1097
358 7.000e-06gi|321466601|gb|EFX77596.1| hypothetical protein DAPPUDRAFT_30003 [Daphnia pulex]  clstr ali  27 1147SGPCHQGATCLDKILG---YVCVCPPGMAGSRCELEVDE. 1182
359 7.000e-06gi|390341181|ref|XP_790463.3| PREDICTED: uncharacterized protein LOC585547 [Strongylocentrotus purpuratus]  clstr ali  27  125SNPCEDGGECNDD---GGSYTCTCTSGFMGENCEQVIGE. 160
360 7.000e-06gi|198412866|ref|XP_002119207.1| PREDICTED: similar to predicted protein [Ciona intestinalis]  clstr ali  37  436STPCLNGGTCTD---GVASFTCACVNGYIGDICET..... 467
361 7.000e-06NEWGM CAP jgi|Capca1|226460|estExt_fgenesh1_pg.C_1850042|Capitella sp.1|JGI  ali  38 1625SDPCQNGGTCSNRV---NKYRCTCTGNWTGSMCE...... 1655
362 7.000e-06gi|326923110|ref|XP_003207784.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Meleagris gallopavo]  clstr ali  44 1090.CSCLNGGTCVTNPPGLGEYLCLCPNGFDGGLCQEDINE. 1130
363 7.000e-06NEWGM HYDMA Hma2.217516 |Hydra magnipapillata (freshwater polyp)|JGI  ali  32  65.NPCFNGATCTNLIPRDKNYKCNCANGWTGVNCELTTS.. 101
364 8.000e-06gi|499686|gb|AAA29995.1| fibropellin Ia, partial [Heliocidaris erythrogramma]  clstr ali  42  293SGPCQNGGTCVD---GVNGFVCQCPPNYTGTYCEISLD.. 327
365 8.000e-06NEWGM STRPU GLEAN3_05139|Strongylocentrotus purpuratus|Baylor  ali  44  70...CLNGGTCMDDV---NGFSCKCAPGYTGRTC....... 96
366 8.000e-06NEWGM STRPU GLEAN3_20273|Strongylocentrotus purpuratus|Baylor  ali  37  44SNPCLNSGVCNDAV---NGYSCACVGGYEGTHCET..... 75
367 8.000e-06gi|345493993|ref|XP_003427197.1| PREDICTED: LOW QUALITY PROTEIN: neural-cadherin-like [Nasonia vitripennis]  clstr ali  38 2306NNPCHNGGRCVEGRFGL---TCQCPAGYNGPRCQ...... 2336
368 1.000e-05gi|260807529|ref|XP_002598561.1| hypothetical protein BRAFLDRAFT_66952 [Branchiostoma floridae]  clstr ali  35  411.NPCENNATCVD---GVNNYSCVCTPGWEGHDCDI..... 441
369 1.000e-05gi|390364043|ref|XP_795071.3| PREDICTED: uncharacterized protein LOC590372 [Strongylocentrotus purpuratus]  clstr ali  32  730..PCRNGGTCMDLI---DGYLCSCLDGYKGKDCTRDNNE. 763
370 1.000e-05gi|301626998|ref|XP_002942667.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Xenopus (Siluran  clstr ali  29 1766..PCRNNGICIDRV---GEFDCQCLSGFSGTLCEENINE. 1799
371 1.000e-05gi|405971641|gb|EKC36466.1| Fibropellin-3 [Crassostrea gigas]  clstr ali  34  677.SPCRNAGTCVNSV---SGYSCDCQNGYTGKNCESE.... 708
372 1.000e-05gi|405960948|gb|EKC26815.1| Sushi, nidogen and EGF-like domain-containing protein 1 [Crassostrea gigas]  clstr ali  31  353SSPCVHG-NCTDQV---NGYVCECIPGYTGVICETD.... 384
373 1.000e-05gi|327262361|ref|XP_003215993.1| PREDICTED: protein delta homolog 2-like [Anolis carolinensis]  clstr ali  36  220..PCANGATCLD---GMNRFSCQCQAGFEGRFCTINID.. 252
374 1.000e-05gi|426219726|ref|XP_004004069.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Ovis aries]  clstr ali  32 1217..PCHNNGICKDRV---GEFICECPSGYTGQLCEENVNE. 1250
375 1.000e-05gi|47215753|emb|CAG05764.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  30  523SAPCQNGGLCKD---GMGEFQCQCKPGFLGSLCEAEVNE. 558
376 1.000e-05gi|47227548|emb|CAG04696.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  28 1464SNPCKNGALCQN---FPGGFNCLCKSGFSGKTCDSIIN.. 1498
377 1.000e-05gi|297674308|ref|XP_002815174.1| PREDICTED: protocadherin Fat 4 [Pongo abelii]  clstr ali  33 4211.SPCQHGGTCMDYWSWQ---QCHCKEGLTGKYCE...... 4240
378 1.000e-05gi|119625608|gb|EAX05203.1| FAT tumor suppressor homolog 4 (Drosophila) [Homo sapiens]  clstr ali  33 4118.SPCQHGGTCMDYWSWQ---QCHCKEGLTGKYCE...... 4147
379 1.000e-05gi|426355516|ref|XP_004045163.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Gorilla gorilla gorilla]  clstr ali  52 1180SCDCLNGGSCVSDRNFSGVYLCVCLPGFHGSLCEVDIS.. 1220
380 1.000e-05gi|307173920|gb|EFN64668.1| Protein eyes shut [Camponotus floridanus]  clstr ali  50  73NHPCLNNGTCVDY----DGIICQCPEGYSGDYCEIDAS.. 106
381 1.000e-05gi|405969234|gb|EKC34217.1| Plasminogen [Crassostrea gigas]  clstr ali  37  999SNPCLNGGTCKN---EGDTFTCTCFPGYQGDRCENEESTT 1035
382 1.000e-05gi|327260668|ref|XP_003215156.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Anolis carolinensis]  clstr ali  51 1106.CGCLNGGTCITNVNFPSGYLCICPNEFEGEHCQ...... 1141
383 1.000e-05gi|297492037|gb|ADI40742.1| tissue plasminogen activator [Xiphophorus nigrensis]  clstr ali  42  87...CYNGGTCKEAVYSSD-YICQCPQGRSGARCEINTNE. 121
384 1.000e-05gi|348605110|ref|NP_001025574.2| tissue-type plasminogen activator precursor [Xenopus (Silurana) tropicalis]  clstr ali  50  96...CYNGGRCQQAVY-STHHLCRCPSGFKGEHCETDTKET 131
385 1.000e-05gi|260791552|ref|XP_002590793.1| hypothetical protein BRAFLDRAFT_121935 [Branchiostoma floridae]  clstr ali  41  612..PCQNGGTCINLE---NSYRCQCPEQYKGVNCD...... 640
386 1.000e-05gi|357612923|gb|EHJ68236.1| hypothetical protein KGM_05707 [Danaus plexippus]  clstr ali  30 1545NNPCLHGGKCVDRDP-ARRYDCICTFGYAGHDCELELLAS 1583
387 2.000e-05gi|345308810|ref|XP_003428748.1| PREDICTED: crumbs homolog 2-like, partial [Ornithorhynchus anatinus]  clstr ali  27  186SRPCVNGGHCQDLVAG---FRCHCLPGYSGVTCMVDVDE. 221
388 2.000e-05gi|344306729|ref|XP_003422037.1| PREDICTED: LOW QUALITY PROTEIN: delta-like protein 1-like [Loxodonta africana]  clstr ali  37  410SSPCSNGAQCVDL---GSSYLCRCPAGFSGQHCDGNVD.. 444
389 2.000e-05gi|260782456|ref|XP_002586303.1| hypothetical protein BRAFLDRAFT_82909 [Branchiostoma floridae]  clstr ali  45  182...CQNGGICTSCFNDSAAF-CDCPAGFDGKTCEIDIDE. 216
390 2.000e-05gi|328702918|ref|XP_003242041.1| PREDICTED: cubilin-like [Acyrthosiphon pisum]  clstr ali  30  474SNPCQNNGLCLPELE-PGDYTCTCTSGYYGQYCE...... 506
391 2.000e-05gi|358413651|ref|XP_002705103.2| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Bos taurus]  clstr ali  32 1104..PCHNNGICKDRV---GEFICECPSGYTGQLCEDNVNE. 1137
392 2.000e-05gi|410930456|ref|XP_003978614.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Takifugu rubripe  clstr ali  30 1240SAPCQNGGLCND---GMGEFQCDCKPGFIGAVCEAEVNE. 1275
393 2.000e-05gi|198424579|ref|XP_002124481.1| PREDICTED: similar to Notch [Ciona intestinalis]  clstr ali  41  106SNPCENGGLCVNRNV---DFVCSCPRDFMGEKCE...... 136
394 2.000e-05NEWGM STRPU GLEAN3_11364|Strongylocentrotus purpuratus|Baylor  ali  44  628..PCFNGGTCRN---FKDRFTCECAPGYEGQNCE...... 656
395 2.000e-05gi|301784025|ref|XP_002927441.1| PREDICTED: delta-like protein 3-like [Ailuropoda melanoleuca]  clstr ali  38  306DGPCFNGGLCVGGADPDSAYVCHCPPGFQGSNCE...... 339
396 2.000e-05NEWGM SARC SARC_12508T0 | SARC_12508 | Sphaeroforma arctica JP610 hypothetical protein (470 aa)  ali  44  293NCDCKNGGTCKVAPTDTSEGLCQCAFGFEGANCETDIS.. 330
397 2.000e-05gi|395502468|ref|XP_003755602.1| PREDICTED: lactadherin [Sarcophilus harrisii]  clstr ali  50  33...CLNGGTCLN-GSESSTFYCLCPDGFTGQNCQ...... 62
398 2.000e-05gi|350588817|ref|XP_003130225.3| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Sus scrofa]  clstr ali  46 1252SCDCLNGGSCVSDPPGSGAYLCVCLPGFQGDLCEEDVTE. 1293
399 2.000e-05gi|326925635|ref|XP_003209017.1| PREDICTED: coagulation factor X-like [Meleagris gallopavo]  clstr ali  50  96.NPCKNGGVCKIRRY---SYFCICPPKFGGDNCE...... 125
400 2.000e-05gi|355755827|gb|EHH59574.1| hypothetical protein EGM_09716 [Macaca fascicularis]  clstr ali  38  317DGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCE...... 350
401 2.000e-05gi|260819590|ref|XP_002605119.1| hypothetical protein BRAFLDRAFT_84207 [Branchiostoma floridae]  clstr ali  35 1261.CECENGGSCVTYPAGSGMYMCVCPPGYQGERCQDNVD.. 1300
402 2.000e-05NEWGM CAP jgi|Capca1|220507|estExt_fgenesh1_pg.C_650026|Capitella sp.1|JGI  ali  41  646SNPCANGGTCEDHI---NGFTCRCPNGYTGPLCE...... 676
403 2.000e-05NEWGM DROPS Contig1714_Contig4288|GENSCAN_predicted_peptide_94|4058_aa|Drosophila pseudoobscura|Baylor  ali  41 1985..PCQNGGSCVRRE---GGYTCVCPDSHTGLNCETTVSK. 2018
404 2.000e-05gi|354474447|ref|XP_003499442.1| PREDICTED: LOW QUALITY PROTEIN: protocadherin Fat 2-like [Cricetulus griseus]  clstr ali  42 3966NCPCQEGGTCVSSPEGTS---CNCPHPYTGDRCEMEAR.. 4003
405 2.000e-05gi|395817724|ref|XP_003782306.1| PREDICTED: protocadherin Fat 2 [Otolemur garnettii]  clstr ali  42 3956NCPCLEGGTCISSPEGAS---CNCPHPYTGDRCEMEAR.. 3993
406 2.000e-05gi|61162132|dbj|BAD91055.1| Af2-cadherin [Artemia franciscana]  clstr ali  36 2225.NPCFNGGRCTETR---NGAMCQCPSGYDGPRCQ...... 2254
407 2.000e-05gi|198475483|ref|XP_002132931.1| GA26093 [Drosophila pseudoobscura pseudoobscura]  clstr ali  33 2368.NPCHNGGRCIDTRFGPH---CSCPVGYTGPRCQ...... 2397
408 2.000e-05gi|340722540|ref|XP_003399662.1| PREDICTED: neural-cadherin-like [Bombus terrestris]  clstr ali  38 2265NSPCYNGGRCVEGRFGLS---CQCPAGYNGPRCQ...... 2295
409 3.000e-05gi|390369733|ref|XP_003731696.1| PREDICTED: neurogenic locus notch homolog protein 1-like, partial [Strongylocentrotus purpuratus]  clstr ali  29  167..PCENGGRCSD---GVDSFTCACAPGYTGSTCGKDNNE. 200
410 3.000e-05NEWGM CAP jgi|Capca1|220964|estExt_fgenesh1_pg.C_1180022|Capitella sp.1|JGI  ali  25  267SDPCQNGAECI----HGAAYECTCVYGYTGVNCETLFDE. 301
411 3.000e-05gi|348536618|ref|XP_003455793.1| PREDICTED: cubilin-like [Oreochromis niloticus]  clstr ali  29  362NNPCVNG-QCVDITSNP-GYICNCNSGWEGVNCDQNINE. 398
412 3.000e-05gi|145046212|dbj|BAF56477.1| SED-1 like protein [Halocynthia roretzi]  clstr ali  35  96SNPCMNGGTCNDEICR---FHCDCPFGYVGTICQ...... 126
413 3.000e-05gi|260791908|ref|XP_002590969.1| hypothetical protein BRAFLDRAFT_69480 [Branchiostoma floridae]  clstr ali  31  157SAPCQNGAICQD---GVNSFTCQCASGYYGTLCE-DIDE. 191
414 3.000e-05gi|405953973|gb|EKC21529.1| Protocadherin Fat 4 [Crassostrea gigas]  clstr ali  44 4032...CKNGGRCVEEWEG---FSCRCTLGFSGTTCEI..... 4060
415 3.000e-05gi|390360995|ref|XP_787781.3| PREDICTED: uncharacterized protein LOC582746 [Strongylocentrotus purpuratus]  clstr ali  35  854..PCRNGGTCMDLI---DGYQCSCLDGYKGKDCEISI... 887
416 3.000e-05gi|395859768|ref|XP_003802204.1| PREDICTED: delta-like protein 3 [Otolemur garnettii]  clstr ali  38  318DGPCFNGGLCVGGADPDSAYVCHCPPGFQGSNCE...... 351
417 3.000e-05gi|426336841|ref|XP_004031663.1| PREDICTED: uncharacterized protein LOC101127200 [Gorilla gorilla gorilla]  clstr ali  44  535..PCQNGGTCVE---GVNQYRCICPPGRTGNRCQ...... 563
418 3.000e-05gi|297288789|ref|XP_002803427.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Macaca mulatta]  clstr ali  47 1315SCDCLNGGSCVSDPPGSGVYLCVCLPGFHGSLCEVNTS.. 1355
419 3.000e-05gi|301617622|ref|XP_002938236.1| PREDICTED: pikachurin-like [Xenopus (Silurana) tropicalis]  clstr ali  38  783NIPCANGGSC---RPQHDSYECDCPLGFDGKNCQ...... 813
420 3.000e-05gi|157115805|ref|XP_001658290.1| cadherin [Aedes aegypti]  clstr ali  41  907..PCLNGGRCSDTKSGI---RCSCPPGYSGPRCQ...... 935
421 3.000e-05gi|403285668|ref|XP_003934135.1| PREDICTED: protocadherin Fat 2 [Saimiri boliviensis boliviensis]  clstr ali  39 4009NCPCLEGGTCIPSPKGAS---CNCPHPYTGDRCEMEAR.. 4046
422 3.000e-05gi|158298600|ref|XP_318800.4| AGAP009723-PA [Anopheles gambiae str. PEST]  clstr ali  41  960..PCLNGGRCTDSKSGIK---CSCPPGYTGPRCQ...... 988
423 3.000e-05gi|322793232|gb|EFZ16889.1| hypothetical protein SINV_09531 [Solenopsis invicta]  clstr ali  38 1083NSPCYNGGRCVEDRFGLS---CQCPSGYNGPRCQ...... 1113
424 3.000e-05NEWGM LOTGI jgi|Lotgi1|104487|e_gw1.3.538.1|Lottia gigantea |JGI  ali  47 4170.NPCYGGGTCISNN---NNYRCECTKDRIGRHCEDNVS.. 4203
425 4.000e-05gi|301619337|ref|XP_002939051.1| PREDICTED: cubilin [Xenopus (Silurana) tropicalis]  clstr ali  23  362.NPCVNG-QCKPTV---SGYECRCNPGWTGTNCTENIDE. 395
426 4.000e-05NEWGM STRPU GLEAN3_03040|Strongylocentrotus purpuratus|Baylor  ali  32  541..PCMNDATCMEVGQG---YQCQCASGFTGSRCETE.... 571
427 4.000e-05gi|260790079|ref|XP_002590071.1| hypothetical protein BRAFLDRAFT_123438 [Branchiostoma floridae]  clstr ali  46  547..PCMNGGTCLDRV---NGYVCRCPEGYGGHNC....... 574
428 4.000e-05NEWGM STRPU GLEAN3_07916|Strongylocentrotus purpuratus|Baylor  ali  34  277SSPCLQG-SCVD---GANEYMCICIAGFTGTICETNINE. 311
429 4.000e-05gi|348513583|ref|XP_003444321.1| PREDICTED: hypothetical protein LOC100691449 [Oreochromis niloticus]  clstr ali  35 2688SNPCLNGGVC---RGYRRNYLCMCKDGFFGDQCQ...... 2718
430 4.000e-05gi|156408065|ref|XP_001641677.1| predicted protein [Nematostella vectensis]  clstr ali  35 1194.NPCLNNGACVDQV---NGYTCTCKAGFAGSRCDRNVD.. 1227
431 4.000e-05gi|354483445|ref|XP_003503903.1| PREDICTED: delta-like protein 3-like [Cricetulus griseus]  clstr ali  41  281.NPCANGGSCSEV---SGSFECTCPRGFYGLRCEV..... 311
432 4.000e-05gi|357620129|gb|EHJ72435.1| crumbs [Danaus plexippus]  clstr ali  39 1317NEPCLRHGTCISRH---DKYECHCTARYTGNNCEVD.... 1349
433 4.000e-05gi|387915488|gb|AFK11353.1| coagulation factor X [Callorhinchus milii]  clstr ali  40  92..PCLNNGNCKD---GINLYSCQCPEGFKGKNCELET... 123
434 4.000e-05gi|405952046|gb|EKC19901.1| Protein SpAN [Crassostrea gigas]  clstr ali  43  691.NPCQNGGTCYVY---GGSYSCQCPPSYGGANCE...... 720
435 4.000e-05gi|354468247|ref|XP_003496578.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Cricetulus griseus]  clstr ali  52 1236SCDCLNGGSCVSDRKFSGAYLCVCLPGFHGNLCEVDAS.. 1276
436 4.000e-05gi|281344076|gb|EFB19660.1| hypothetical protein PANDA_017200 [Ailuropoda melanoleuca]  clstr ali  38  266DGPCFNGGLCVGGADPDSAYVCHCPPGFQGSNCE...... 299
437 4.000e-05gi|395818947|ref|XP_003782869.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Otolemur garnettii]  clstr ali  47 1181SCDCLNGGSCVSDPPGNGMYLCVCLPGFQGSLCEVDAS.. 1221
438 4.000e-05NEWGM STRPU GLEAN3_00216|Strongylocentrotus purpuratus|Baylor  ali  42  407.NPCQNGGNCLPIQGQCAAYQCQCPANFGGLHCE...... 439
439 4.000e-05gi|195120792|ref|XP_002004905.1| GI19343 [Drosophila mojavensis]  clstr ali  38 1487..PCQNGGSCVRRE---GGFTCVCPDTHTGANCETSINK. 1520
440 4.000e-05gi|307174406|gb|EFN64925.1| Neural-cadherin [Camponotus floridanus]  clstr ali  38  966NSPCYNGGRCVEDRFGLS---CQCPSGYNGPRCQ...... 996
441 5.000e-05gi|260790297|ref|XP_002590179.1| hypothetical protein BRAFLDRAFT_233395 [Branchiostoma floridae]  clstr ali  41  85SDPCQYGGTCVD---GVNSYTCHCVPGFTGDDCE...... 115
442 5.000e-05gi|348523037|ref|XP_003449030.1| PREDICTED: delta-like protein C-like [Oreochromis niloticus]  clstr ali  38  379..PCFNGGTCIQEDTG--GYTCRCPSNFTGSNCEKRMD.. 412
443 5.000e-05gi|351708128|gb|EHB11047.1| Crumbs-like protein 1 [Heterocephalus glaber]  clstr ali  38  689SDPCLHGGVCRDLP---NGFQCLCDVPFAGERCELDI... 722
444 5.000e-05gi|328723934|ref|XP_001949468.2| PREDICTED: hypothetical protein LOC100162025 [Acyrthosiphon pisum]  clstr ali  37 2185..PCLLGAACTDLI---NDFKCACPPGFTGKRCETKI... 2216
445 5.000e-05gi|156383342|ref|XP_001632793.1| predicted protein [Nematostella vectensis]  clstr ali  35  45SSPCKNGGNCTDQV---NNYICTCQPGYTGRNCE...... 75
446 5.000e-05NEWGM BRAFL jgi|Brafl1|86078|fgenesh2_pg.scaffold_148000016|Branchiostoma floridae|JGI  ali  35  372...CQNGGNCIACFSDFS--MCRCHPGYTGAFCEIDIDE. 405
447 5.000e-05gi|260835699|ref|XP_002612845.1| hypothetical protein BRAFLDRAFT_118409 [Branchiostoma floridae]  clstr ali  34 1893...CQNDATC---EPDGESFKCICPKGYAGTMCETNVD.. 1924
448 5.000e-05gi|47214446|emb|CAF95781.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  51  90..PCQNNGVCVS---MGNAYQCLCPEGFNGRHCE...... 118
449 5.000e-05gi|334311255|ref|XP_001381084.2| PREDICTED: coagulation factor XII-like [Monodelphis domestica]  clstr ali  41  293DNPCLHGGMCLEAEGQS---VCHCPPNYVGHFCEIDTSA. 328
450 5.000e-05gi|156362527|ref|XP_001625828.1| predicted protein [Nematostella vectensis]  clstr ali  53  123..SCLNGGTCQ--KTDEDAFRCTCPPEFIGKHCE...... 152
451 5.000e-05gi|383850315|ref|XP_003700741.1| PREDICTED: protein eyes shut-like [Megachile rotundata]  clstr ali  47  113NHPCLNNGTCLDY----DGITCQCPDGYSGDYCEIDAS.. 146
452 5.000e-05gi|307194561|gb|EFN76853.1| Cadherin-related tumor suppressor [Harpegnathos saltator]  clstr ali  28 2180SNPCRNGGSCRTSPDNFSFF-CLCRAGYKGNHCEAVTDS. 2217
453 5.000e-05gi|327274092|ref|XP_003221812.1| PREDICTED: protocadherin Fat 4-like [Anolis carolinensis]  clstr ali  31 3853.NPCQNGGSCLRKLGVSPTFTCKCMPGYDGTLCETDVDE. 3909
454 5.000e-05gi|328714938|ref|XP_001945353.2| PREDICTED: neural-cadherin-like [Acyrthosiphon pisum]  clstr ali  38 1542SSPCLNGGRCSDTRNGP---TCECPNGFNGPRCQ...... 1572
455 6.000e-05gi|74095907|ref|NP_001027780.1| coagulation factor VIIb precursor [Takifugu rubripes]  clstr ali  55  92..PCQNNGVCVS---MGNTYQCHCPEGFGGQRCE...... 120
456 6.000e-05gi|395502109|ref|XP_003755428.1| PREDICTED: hyaluronan-binding protein 2 [Sarcophilus harrisii]  clstr ali  45  417.NPCKNGGICKRNRRRSK-FTCSCPDGFRGKFCEI..... 449
457 6.000e-05gi|410949641|ref|XP_003981529.1| PREDICTED: protocadherin Fat 2 [Felis catus]  clstr ali  39 4016NCPCLEGGTCIPSPEGAS---CNCPHPYMGDRCEMEAR.. 4053
458 6.000e-05NEWGM APIME gnl|Amel|GB12853-PA GLEAN3_00221|Apis mellifera (honeybee)|Baylor  ali  35 2340SSPCYNGGRCVEGRFGLS---CQCPAGYNGPRCQ...... 2370
459 7.000e-05gi|260795571|ref|XP_002592778.1| hypothetical protein BRAFLDRAFT_65357 [Branchiostoma floridae]  clstr ali  37  369.NLCQNGGNCTSCFGGSTTF-CDCLEGYGGTLCEINIDE. 405
460 7.000e-05NEWGM CAP jgi|Capca1|141250|e_gw1.224.110.1|Capitella sp.1|JGI  ali  35  354SDPCLNNGTCWDQV---DGYICNCTDNFTGDTCEVDTDE. 396
461 7.000e-05gi|260826369|ref|XP_002608138.1| hypothetical protein BRAFLDRAFT_126258 [Branchiostoma floridae]  clstr ali  38  156SNPCWLGGTCLDHV---NGYSCACPEDVTGKNCE...... 186
462 7.000e-05gi|340712800|ref|XP_003394943.1| PREDICTED: cubilin-like [Bombus terrestris]  clstr ali  37  196...CQNGATCHNLP---GSYSCDCTAGWYGLHC....... 222
463 7.000e-05gi|410963047|ref|XP_003988078.1| PREDICTED: protein delta homolog 1 [Felis catus]  clstr ali  37  331STPCANNGTCVNLE--SGHYECSCAPGFSGKDCQ...... 362
464 7.000e-05gi|327274828|ref|XP_003222178.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Anolis carolinensis]  clstr ali  40 1180.CNCLNGGSCVTNPPGSGKYLCVCLPGFEGDLCQVNTD.. 1219
465 7.000e-05NEWGM HELRO jgi|Helro1|161680|Helobdella robusta|JGI  ali  32  53..PCVNGGKCIELGNCTSQFKCVCPFGFTGARCEVEVKE. 89
466 7.000e-05gi|403305447|ref|XP_003943278.1| PREDICTED: delta-like protein 3 [Saimiri boliviensis boliviensis]  clstr ali  38  287DGPCFNGGLCVGGADPDSAYVCHCPPGFQGSNCE...... 320
467 7.000e-05gi|195117884|ref|XP_002003475.1| GI22312 [Drosophila mojavensis]  clstr ali  37 2495..PCHNGGRCVDTRFGPH---CSCPVGYTGPRCQ...... 2523
468 7.000e-05gi|195035601|ref|XP_001989264.1| GH10146 [Drosophila grimshawi]  clstr ali  37 1558..PCHNGGRCVDTRFGPH---CSCPAGYTGPRCQ...... 1586
469 8.000e-05NEWGM STRPU GLEAN3_19670|Strongylocentrotus purpuratus|Baylor  ali  20  266SNPCKEG----DCLDGIREYTCVCTPGYTGVDCEVEIDE. 300
470 8.000e-05gi|390359510|ref|XP_794599.3| PREDICTED: uncharacterized protein LOC589875 [Strongylocentrotus purpuratus]  clstr ali  31 2013..PCMNGGACTD---GVDSFTCVCVAGYTGSTCDTDI... 2044
471 8.000e-05gi|359322880|ref|XP_003433421.2| PREDICTED: sushi, nidogen and EGF-like domains 1 [Canis lupus familiaris]  clstr ali  40  393SGPCLNGGSCVDLV---GNFTCLCTEPFEGARCET..... 424
472 8.000e-05NEWGM STRPU GLEAN3_07715|Strongylocentrotus purpuratus|Baylor  ali  40  133.NPCENGGICENLV---DDYNCLCPEGFNGTDCE...... 162
473 8.000e-05gi|405964130|gb|EKC29647.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  26  250SYPCKHESVCVRQGTTQN-YTCYCVPGYTGSLCETDINE. 287
474 8.000e-05gi|380015973|ref|XP_003691968.1| PREDICTED: neurogenic locus protein delta-like [Apis florea]  clstr ali  25  307.SPCHHGASCEDDSLH--GYVCRCPPGYTGNDCESQLD.. 341
475 8.000e-05gi|260791910|ref|XP_002590970.1| hypothetical protein BRAFLDRAFT_69479 [Branchiostoma floridae]  clstr ali  33  158SAPCRNGATCQD---GANSFTCQCVPGYVGTLC....... 187
476 8.000e-05gi|332020477|gb|EGI60892.1| Cubilin [Acromyrmex echinatior]  clstr ali  37  217...CQNGATCRNLP---GSYRCDCLPGWFGLHC....... 243
477 8.000e-05gi|405978776|gb|EKC43139.1| Deleted in malignant brain tumors 1 protein [Crassostrea gigas]  clstr ali  32  217SNVCYNGGVCTATYTGYPGYYCQCPYGFSGLNCQ...... 250
478 8.000e-05gi|242021153|ref|XP_002431010.1| predicted protein [Pediculus humanus corporis]  clstr ali  40  941.SPCYNGGRCVEGRYGL---SCVCPSGYNGPRCQ...... 970
479 8.000e-05gi|291389979|ref|XP_002711510.1| PREDICTED: delta-like 3 protein [Oryctolagus cuniculus]  clstr ali  38  319DGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCE...... 352
480 8.000e-05gi|345779906|ref|XP_539440.3| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Canis lupus familiaris]  clstr ali  43 1550SCDCLNGGLCVSDPPGSGMYLCVCLPGFQGSLCEVNVTE. 1591
481 9.000e-05NEWGM CIOSA ENSCSAVP00000011562 pep:novel reftig:CSAV2.0:reftig_60:674897:791456:1 gene:ENSCSAVG00000006778 transcript:ENSCSAVT00000011696|  ali  29 1122..PCDNEGTCEPSPAG---FICICQAGYVGTNCETNFDE. 1155
482 9.000e-05gi|344299110|ref|XP_003421231.1| PREDICTED: LOW QUALITY PROTEIN: sushi, nidogen and EGF-like domain-containing protein 1-like [Loxodonta africana] :_  clstr ali  31  658.SPCLNGATCENL---GTDFSCRCRAGFTGRRCQAEVDC. 692
483 9.000e-05gi|195470577|ref|XP_002087583.1| GE17758 [Drosophila yakuba]  clstr ali  32  798.NPCMNGGSCV---GNSTHFRCDCAPGFTGPLCQHSLNE. 834
484 9.000e-05gi|386768962|ref|NP_001245842.1| weary, isoform C [Drosophila melanogaster]  clstr ali  32  784.NPCMNGGSCV---GNSTHFRCDCAPGFTGPLCQHSLNE. 820
485 9.000e-05gi|296190554|ref|XP_002806559.1| PREDICTED: LOW QUALITY PROTEIN: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [  clstr ali  37 1275.SPCLNKGICVD---GVAGYHCRCVKGYVGLHCEAEVNE. 1309
486 9.000e-05NEWGM CAP jgi|Capca1|181868|estExt_Genewise1Plus.C_230107|Capitella sp.1|JGI  ali  35  253SQPCQNGATCVD---GEDSYICQCSPGYVGINCE...... 283
487 9.000e-05gi|167534724|ref|XP_001749037.1| hypothetical protein [Monosiga brevicollis MX1]  clstr ali  46 4872SNPCLNGGVCVSLE---ATFECVCPQGFTGDTCEL..... 4903
488 9.000e-05gi|156362038|ref|XP_001625589.1| predicted protein [Nematostella vectensis]  clstr ali  43  177.NPCLNGGKCK-HGTMNETFRCICPKGFEGLNCE...... 208
489 1.000e-04NEWGM BRAFL jgi|Brafl1|86276|fgenesh2_pg.scaffold_150000035|Branchiostoma floridae|JGI  ali  40  674SQPCHNGGTCRDAVA---SFTCFCPHGFGGDLCQV..... 705
490 1.000e-04gi|301764164|ref|XP_002917513.1| PREDICTED: protein delta homolog 1-like [Ailuropoda melanoleuca]  clstr ali  37  136STPCTNNGTCVNL--DSGHYECSCAPGFSGKDCQ...... 167
491 1.000e-04gi|260791942|ref|XP_002590986.1| hypothetical protein BRAFLDRAFT_69463 [Branchiostoma floridae]  clstr ali  28  665SNPCQNDGLCNN---GVNSYFCHCTVGYGRDNCQTDLD.. 699
492 1.000e-04NEWGM STRPU GLEAN3_01855|Strongylocentrotus purpuratus|Baylor  ali  38  123SSPCLNGAQCFE---GANAYACICVPEFTGVNCE...... 153
493 1.000e-04gi|405958724|gb|EKC24823.1| Sushi, nidogen and EGF-like domain-containing protein 1 [Crassostrea gigas]  clstr ali  36  280..PCQNHGNCVDLI---NNYQCHCTDGFNGTHCLNNID.. 312
494 1.000e-04gi|260833680|ref|XP_002611840.1| hypothetical protein BRAFLDRAFT_123361 [Branchiostoma floridae]  clstr ali  44  772..PCQNEGTCEDLV---NGFKCTCPKGITGDLCE...... 800
495 1.000e-04gi|390341240|ref|XP_783491.3| PREDICTED: uncharacterized protein LOC578210 [Strongylocentrotus purpuratus]  clstr ali  32  782..PCMNDATCMEV---GQGYQCQCASGFTGSRCETE.... 812
496 1.000e-04gi|344239219|gb|EGV95322.1| Sushi, nidogen and EGF-like domain-containing protein 1 [Cricetulus griseus]  clstr ali  55  941...CQNGGTCV---PGANAHSCDCRPGFKGRHCEL..... 969
497 1.000e-04gi|260841558|ref|XP_002613979.1| hypothetical protein BRAFLDRAFT_67440 [Branchiostoma floridae]  clstr ali  41 1438SSPCLNRAYCEDKI---NSYLCHCAPGFGGTHCE...... 1468
498 1.000e-04gi|260796455|ref|XP_002593220.1| hypothetical protein BRAFLDRAFT_120134 [Branchiostoma floridae]  clstr ali  41  217SNPCSNGATCVD---GDNAYTCDCIFGSIGTHCE...... 247
499 1.000e-04gi|291237608|ref|XP_002738726.1| PREDICTED: neurogenic locus notch homolog protein 2-like, partial [Saccoglossus kowalevskii]  clstr ali  38 1036SNPCYFGGTCIDEE---NGYTCQCQDGFIGPNCE...... 1066
500 1.000e-04gi|297473534|ref|XP_002686666.1| PREDICTED: sushi, nidogen and EGF-like domains 1 [Bos taurus]  clstr ali  36  606...CQNGGWCRAEGGAAA---CVCPAGYTGAACETDVDE. 638
501 1.000e-04gi|345481600|ref|XP_001606223.2| PREDICTED: hypothetical protein LOC100122612 [Nasonia vitripennis]  clstr ali  30 2424..PCLLGANCTDLV---DDFTCDCPPGFTGKRCHEKID.. 2456
502 1.000e-04gi|499688|gb|AAA29996.1| fibropellin III, partial [Heliocidaris erythrogramma]  clstr ali  37  248..PCQNGATCID---GIDMYTCQCRQGYTGVHCE...... 276
503 1.000e-04NEWGM TRICA TG1638-PA (bi|42457|bcm|Contig798_Contig4094-89) predicted by FGENESH, similar to Q9VM55_DROME (Q9VM55) CG9138-PA [Eval: 0.0]|T  ali  30 1850..PCLLGANCTDLVA---DFSCSCPPGFTGKRCQEKID.. 1882
504 1.000e-04NEWGM STRPU GLEAN3_00410|Strongylocentrotus purpuratus|Baylor  ali  34  315SQPCRNQGICQDEE---NGYTCTCEDGWTGTHCET..... 346
505 1.000e-04gi|291226450|ref|XP_002733205.1| PREDICTED: neurogenic locus notch homolog protein 2-like [Saccoglossus kowalevskii]  clstr ali  33  798SSPCHSDGTCVNHE---NSYQCICKLGFRGTSCEYEVDE. 833
506 1.000e-04gi|307192393|gb|EFN75628.1| Neurogenic locus protein delta [Harpegnathos saltator]  clstr ali  40  252SAPCQNGGTCRNRV---NGFLCDCPDGWYGDTC....... 281
507 1.000e-04gi|260789858|ref|XP_002589961.1| hypothetical protein BRAFLDRAFT_81597 [Branchiostoma floridae]  clstr ali  32  259SN-CVNGATCKGCFNSLIT-TCDCQAGFTGERCEININE. 295
508 1.000e-04gi|307176866|gb|EFN66210.1| Cubilin [Camponotus floridanus]  clstr ali  29  437.NPCVHG-TCV--PNGANGFTCTCNPGYSGTTCNTPTD.. 470
509 1.000e-04gi|383847633|ref|XP_003699457.1| PREDICTED: LOW QUALITY PROTEIN: cubilin-like [Megachile rotundata]  clstr ali  37  196...CQNGATCLNLP---GSYRCECASGWYGLHC....... 222
510 1.000e-04gi|307214185|gb|EFN89302.1| Cubilin [Harpegnathos saltator]  clstr ali  37  174...CQNGATCRNLP---GSYRCDCLPGWFGLHC....... 200
511 1.000e-04gi|405953712|gb|EKC21321.1| Versican core protein [Crassostrea gigas]  clstr ali  29  69SNPCENQATCNNYV---NFFNCTCLPGFTGYRCQKGI... 102
512 1.000e-04gi|195589621|ref|XP_002084549.1| GD12774 [Drosophila simulans]  clstr ali  40  207...CLNNGQCINTP---GSYRCVCRNGFTGTHC....... 233
513 1.000e-04gi|24371292|ref|NP_571810.1| slit homolog 2 protein precursor [Danio rerio]  clstr ali  36 1066.NKCKNGAQCIDAV---NGYTCVCPEGYSGLFCE...... 1095
514 1.000e-04gi|195493596|ref|XP_002094485.1| GE20177 [Drosophila yakuba]  clstr ali  32  431..PCQNNGTCIQSGRGT---TCICQPGYTGAVC....... 458
515 1.000e-04gi|301604928|ref|XP_002932104.1| PREDICTED: protocadherin Fat 4 [Xenopus (Silurana) tropicalis]  clstr ali  28 2186STPCKNGAVCQN---FPGGFNCVCKAGSTGKLCESAVN.. 2220
516 1.000e-04gi|148703183|gb|EDL35130.1| mCG142341 [Mus musculus]  clstr ali  28 1812.SPCKHGAICQN---FPGGFNCVCKTGYTGKHCELN.... 1846
517 1.000e-04gi|410956898|ref|XP_003985073.1| PREDICTED: protocadherin Fat 4 [Felis catus]  clstr ali  27 4104.SPCQHGGICTDYWSWQ---QCHCKEGLTGKYCEKSI... 4136
518 1.000e-04NEWGM CAP jgi|Capca1|138082|e_gw1.23.146.1|Capitella sp.1|JGI  ali  35  104SQPCQNGATCVD---GEDSYICQCSPGYVGINCE...... 134
519 1.000e-04gi|410896310|ref|XP_003961642.1| PREDICTED: uncharacterized protein LOC101069348 [Takifugu rubripes]  clstr ali  32  595.NPCKNGASCI---KGDRRFQCACPEGYTGKFCET..... 625
520 1.000e-04gi|403259486|ref|XP_003922243.1| PREDICTED: hyaluronan-binding protein 2 isoform 2 [Saimiri boliviensis boliviensis]  clstr ali  44  168.NPCQNGGTCSRHKRKSK-FTCVCPDQFKGRFCEIGSD.. 203
521 1.000e-04NEWGM CAP jgi|Capca1|137289|e_gw1.769.3.1|Capitella sp.1|JGI  ali  38  35NGSCQNGGTCQVAPTYWAGYRCSCPPGFIGLTCQIN.... 70
522 1.000e-04gi|296233785|ref|XP_002807880.1| PREDICTED: LOW QUALITY PROTEIN: delta-like protein 3 [Callithrix jacchus]  clstr ali  38  318DGPCFNGGLCVGGADPDSAYVCHCPPGFQGSNCE...... 351
523 1.000e-04gi|226466536|emb|CAX69403.1| Neurogenic locus notch protein homolog precursor [Schistosoma japonicum]  clstr ali  35  89..PCQNRGQCIQDANDSMLYQCICIPGYKGDHCEIE.... 122
524 1.000e-04gi|348562839|ref|XP_003467216.1| PREDICTED: LOW QUALITY PROTEIN: delta-like protein 3-like [Cavia porcellus]  clstr ali  38  314DGPCFNGGLCVGGADPDSAYVCHCPPGFQGSNCE...... 347
525 1.000e-04gi|397482228|ref|XP_003812334.1| PREDICTED: delta-like protein 3 [Pan paniscus]  clstr ali  38  237DGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCE...... 270
526 1.000e-04gi|296477759|gb|DAA19874.1| delta-like 3 [Bos taurus]  clstr ali  38  318DGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCE...... 351
527 1.000e-04gi|47215505|emb|CAG01167.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  35  209..PCKNNGRCRSRE---GGYTCECMDDFTGENCEVNASS. 242
528 1.000e-04gi|380020280|ref|XP_003694018.1| PREDICTED: LOW QUALITY PROTEIN: fat-like cadherin-related tumor suppressor homolog [Apis florea]  clstr ali  35 4209.NPCIHGGVC---EEGNNGPICKC-QGFMGDRCETDINE. 4242
529 1.000e-04NEWGM APIME gnl|Amel|GB16822-PA GLEAN3_04683|Apis mellifera (honeybee)|Baylor  ali  35 3092.NPCVHGGVC---EEGNNGPICKC-QGFMGDRCETDINE. 3125
530 1.000e-04gi|195344744|ref|XP_002038939.1| GM17111 [Drosophila sechellia]  clstr ali  37 2404..PCHNGGRCVDTRFGPH---CSCPVGYAGPRCQ...... 2432
531 2.000e-04gi|156363847|ref|XP_001626251.1| predicted protein [Nematostella vectensis]  clstr ali  25  308SNPCQNNAVCV---GGVDKFQCICRPGFSGTLCQFNDD.. 342
532 2.000e-04gi|349502614|gb|AEP83811.1| jagged [Hydra vulgaris]  clstr ali  45  261SNPCLNNGSCIDLHA---NFECVCPGKYGGKQCEID.... 293
533 2.000e-04gi|260792066|ref|XP_002591048.1| hypothetical protein BRAFLDRAFT_69398 [Branchiostoma floridae]  clstr ali  41 1194.NVCQNGGNCTSCFNGSSTF-CDCPDGFEGRTCEITPD.. 1229
534 2.000e-04NEWGM BRAFL jgi|Brafl1|125935|estExt_fgenesh2_pg.C_1990054|Branchiostoma floridae|JGI  ali  37  651.NVCQNGGICTSCFNDTAVF-CDCPAGFDGKLCEINIDE. 687
535 2.000e-04gi|194227387|ref|XP_001493183.2| PREDICTED: crumbs homolog 1 [Equus caballus]  clstr ali  29  81SSPCQGNATCVNTP-GERSFLCKCPPGYNGTTCET..... 114
536 2.000e-04gi|47212306|emb|CAF90569.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  38  445..PCSNGGRCVDNPEG--GYFCQCPRGHAGFNCEKKID.. 478
537 2.000e-04gi|347968469|ref|XP_312182.5| AGAP002739-PA [Anopheles gambiae str. PEST]  clstr ali  31 2131.NPCGNGATCVALQQGR--FRCECTAGWEGHLCSINTD.. 2165
538 2.000e-04gi|148234148|ref|NP_001079551.1| putative ortholog of delta-like protein C precursor (SwissPro) precursor [Xenopus laevis]  clstr ali  34  354..PCFNGGTCIEKSSGV-GYVCRCPFNYHGSNCEKKID.. 388
539 2.000e-04gi|157821099|ref|NP_001100652.1| crumbs homolog 1 precursor [Rattus norvegicus]  clstr ali  25  193SDPCMNEAVCLNEI---GRYTCVCPQEYSGVNCELEIDE. 228
540 2.000e-04gi|224048577|ref|XP_002192118.1| PREDICTED: similar to spacemaker [Taeniopygia guttata]  clstr ali  26  237.NPCLHG-RCIDLI---DGYQCSCEPGWTSSRCEININE. 270
541 2.000e-04NEWGM BRAFL jgi|Brafl1|112727|fgenesh2_pg.scaffold_1485000001|Branchiostoma floridae|JGI  ali  26  359..PCYSLATCLDRV---NGYECVCPSGWTGEQCDVNIDE. 392
542 2.000e-04gi|426339189|ref|XP_004033542.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 [Gorilla gorilla gorilla]  clstr ali  43  760..PCLNGGSCVDLV---GNYTCLCAEPFKGLRCET..... 789
543 2.000e-04gi|260791922|ref|XP_002590976.1| hypothetical protein BRAFLDRAFT_69473 [Branchiostoma floridae]  clstr ali  35  168SAPCQNGATCQ-GELNSFEFTCQCAPGFFGTLCE-DFDE. 204
544 2.000e-04gi|198421456|ref|XP_002124792.1| PREDICTED: zinc finger protein [Ciona intestinalis]  clstr ali  38  497...CQHGGTCQ--HAAVTGFKCECKKGYEGTTCQID.... 527
545 2.000e-04gi|260803838|ref|XP_002596796.1| hypothetical protein BRAFLDRAFT_211833 [Branchiostoma floridae]  clstr ali  37  290SNPCRNGGTCTD---GVNSYTCVCRPGFAGTRCQT..... 321
546 2.000e-04gi|224587109|gb|ACN58604.1| Delta-like protein D precursor [Salmo salar]  clstr ali  40  100.NPCHNGATCHERK---NRYVCACVPGYGGHNCQ...... 129
547 2.000e-04NEWGM BOMMO Bmb025867|Bombyx mori (silk moth)|Beijing Genomics Institute  ali  29 1156.SPCENGGQCMD---GIDDFNCVCETGFTGKKCQHTID.. 1189
548 2.000e-04gi|260791944|ref|XP_002590987.1| hypothetical protein BRAFLDRAFT_69462 [Branchiostoma floridae]  clstr ali  42  487SSPCLGGGTCVDQI---GSYKCNCPKGTAGDRCEAVVD.. 521
549 2.000e-04gi|190337599|gb|AAI63538.1| Slit homolog 1a (Drosophila) [Danio rerio]  clstr ali  44 1085...CQNGAQCVDEL---NGYSCVCQKGYSGQLCEV..... 1113
550 2.000e-04gi|296192729|ref|XP_002744200.1| PREDICTED: slit homolog 3 protein-like [Callithrix jacchus]  clstr ali  42  412...CRHGAQCVDAV---NGYTCTCPQGFSGLFCE...... 439
551 2.000e-04gi|260819294|ref|XP_002604972.1| hypothetical protein BRAFLDRAFT_92614 [Branchiostoma floridae]  clstr ali  36  233...CQNQGSCVDLV---NDFLCNCTAGWEGRLCENETNE. 265
552 2.000e-04gi|260791938|ref|XP_002590984.1| hypothetical protein BRAFLDRAFT_69465 [Branchiostoma floridae]  clstr ali  46  191SNPCWFGGTCVD---GIRDFICVCPKGFEGEKCEI..... 222
553 2.000e-04gi|12055236|emb|CAC20782.1| fibrosurfin [Paracentrotus lividus]  clstr ali  35  230SDPCMNGGVCVD---GENSVTCTCTQSYTGVLCETGI... 263
554 2.000e-04gi|395542983|ref|XP_003773402.1| PREDICTED: slit homolog 2 protein, partial [Sarcophilus harrisii]  clstr ali  26 1110.NPCQHDSKCILTPKG---YKCDCTPGYVGEHCDIDYD.. 1143
555 2.000e-04gi|405974180|gb|EKC38846.1| Protocadherin Fat 1, partial [Crassostrea gigas]  clstr ali  38  1.NGCQNFASCVADATDSKGYRCLCPSGFTGEKCEI..... 34
556 2.000e-04gi|198427732|ref|XP_002123603.1| PREDICTED: similar to notch homolog 2 [Ciona intestinalis]  clstr ali  43  214.NPCRNEGTCNKIPA---NYTCSCVKGFSGQNCEND.... 245
557 2.000e-04gi|24940351|emb|CAD45190.1| Delta1 protein [Cupiennius salei]  clstr ali  38  530SNPCFNGGTCEDLV---NEFVCHCADGFQGKQCQ...... 560
558 2.000e-04gi|344236948|gb|EGV93051.1| Delta-like protein 3 [Cricetulus griseus]  clstr ali  41  243.NPCANGGSCSEV---SGSFECTCPRGFYGLRCEV..... 273
559 2.000e-04gi|405969900|gb|EKC34844.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Crassostrea gigas]  clstr ali  28  516...CQNDATCVADQTSTEGYRCQCKTGYTGLRCESLIN.. 550
560 2.000e-04gi|345497484|ref|XP_001600457.2| PREDICTED: fat-like cadherin-related tumor suppressor homolog [Nasonia vitripennis]  clstr ali  32 3920.........CIPD-SSVQGYSCQCPEGFAGQTCDIDIDES 3953
561 2.000e-04gi|390342174|ref|XP_001192064.2| PREDICTED: fibrillin-1-like, partial [Strongylocentrotus purpuratus]  clstr ali  44  215..PCFNGGTCRN---FKDRFTCECAPGYEGQNCE...... 243
562 2.000e-04gi|293346655|ref|XP_001057162.2| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Rattus norvegicus]  clstr ali  42 1167SCDCLNGGSCVTDPPGTGAYLCDCLPGFSGDLCEVEAS.. 1207
563 2.000e-04gi|324521302|gb|ADY47825.1| Protocadherin Fat 4, partial [Ascaris suum]  clstr ali  46  128SNPCLNNGTCRTTRGFS-TFFCDCPPKFGGKYCDIAVGET 166
564 2.000e-04gi|354495771|ref|XP_003510002.1| PREDICTED: agrin-like isoform 1 [Cricetulus griseus]  clstr ali  50 1815.NPCLNGGSCVPRE---ATYECLCPGGFSGLHCE...... 1844
565 2.000e-04gi|426228311|ref|XP_004008256.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Ovis aries]  clstr ali  43  853SCDCLNGGSCVSDPPGSGAYLCVCLPGFHGDLCEKNVTE. 894
566 2.000e-04gi|50749801|ref|XP_421761.1| PREDICTED: hyaluronan-binding protein 2 [Gallus gallus]  clstr ali  38  165.NPCKNGGICVRHRIRSK-FTCKCPERYRGRFCEIEPD.. 200
567 2.000e-04NEWGM HELRO jgi|Helro1|103882|Helobdella robusta|JGI  ali  29  955SNPCMNGGKCLPIHAGSS-YKCQCEPGYTGLNCSEDID.. 991
568 2.000e-04gi|126273418|ref|XP_001377824.1| PREDICTED: hyaluronan-binding protein 2-like [Monodelphis domestica]  clstr ali  41  135.NPCKNGGVCRRNRRRSK-FTCSCPDGFKGKFCEIGPD.. 170
569 2.000e-04gi|338724292|ref|XP_001495789.3| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Equus caballus]  clstr ali  43 1181SCDCLNGGSCVSDPPGSGAYLCVCLPGFQGGLCEVEVTE. 1222
570 2.000e-04gi|380022847|ref|XP_003695247.1| PREDICTED: protein eyes shut-like [Apis florea]  clstr ali  47  108NQPCLNNGTCLDY----DGITCQCPDGYSGDYCEIDAS.. 141
571 2.000e-04gi|391335272|ref|XP_003742019.1| PREDICTED: delta and Notch-like epidermal growth factor-related receptor-like [Metaseiulus occidentalis]  clstr ali  36  680.NPCQHGGSCW---PSMDTFYCSCPPGFAGDNCE...... 709
572 2.000e-04gi|224052827|ref|XP_002194468.1| PREDICTED: hyaluronan binding protein 2 [Taeniopygia guttata]  clstr ali  51  129.NPCRNGGTCKRNRYRSK-FTCECPEPFRGRFCEI..... 161
573 2.000e-04gi|296209590|ref|XP_002751576.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Callithrix jacchus]  clstr ali  47 1183SCDCLNGGSCVSDPPGSGVYLCVCLPGFYGSLCDVDIS.. 1223
574 2.000e-04gi|260784536|ref|XP_002587322.1| hypothetical protein BRAFLDRAFT_100988 [Branchiostoma floridae]  clstr ali  40  8SNPCLNGGVCSERHP--DGYFCACPTGFVGNDCE...... 39
575 2.000e-04gi|343887436|ref|NP_001230619.1| hyaluronan-binding protein 2 [Sus scrofa]  clstr ali  41  154.NPCQNGGTCSRHRRRSK-FTCTCPDQFKGRFCEIGSD.. 189
576 2.000e-04NEWGM BRAFL jgi|Brafl1|223653|e_gw.97.2.1|Branchiostoma floridae|JGI  ali  35 1122.CECENGGSCVTYPAGSGMYMCVCPPGYQGERCQDNVD.. 1161
577 2.000e-04gi|332259108|ref|XP_003278631.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1, partial [Nomascus leucogenys]  clstr ali  33 1264SNPCGANGRCRSRE---GGYTCECFEDFTGEHCEVDARS. 1299
578 3.000e-04gi|254071775|gb|ACT64631.1| delta protein [Panulirus argus]  clstr ali  26  58..PCVNGASCIDTATG---YRCECHAGYEGTNCERPVNE. 91
579 3.000e-04NEWGM STRPU GLEAN3_14830|Strongylocentrotus purpuratus|Baylor  ali  37  291.NPCMNGGSCTD---GVNTFTCVCADGFNGDTC....... 319
580 3.000e-04gi|47217388|emb|CAG00748.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  46  689.NPCLNGGTCSST---WDDFTCTCPPQTAGRRCE...... 718
581 3.000e-04gi|354474212|ref|XP_003499325.1| PREDICTED: LOW QUALITY PROTEIN: sushi, nidogen and EGF-like domain-containing protein 1-like [Cricetulus griseus] :_  clstr ali  38  349..PCLNGGSCIDLV---GNYSCICVEPFEGPRCETE.... 379
582 3.000e-04NEWGM BRAFL jgi|Brafl1|110088|fgenesh2_pg.scaffold_734000017|Branchiostoma floridae|JGI  ali  30 2028.SPCQNNGSCV-LGVDKWSYYCTCAAGFEGPQCQT..... 2060
583 3.000e-04gi|16923547|gb|AAL31528.1|AF426384_1 deltaD protein [Danio rerio]  clstr ali  36  486.NPCHNGATCHEM---DNRYVCACIPGYGGRNCQ...... 515
584 3.000e-04gi|198428437|ref|XP_002122245.1| PREDICTED: similar to Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Ciona inte  clstr ali  45  261..PCLNGGTCVDMI---NAYRCSCAPTFAGEACQNE.... 291
585 3.000e-04gi|348577283|ref|XP_003474414.1| PREDICTED: LOW QUALITY PROTEIN: sushi, nidogen and EGF-like domain-containing protein 1-like [Cavia porcellus]  clstr ali  43  435SAPCQNGGTCVDAGPGH---VCECPEGFMGLDC....... 464
586 3.000e-04NEWGM STRPU GLEAN3_27090|Strongylocentrotus purpuratus|Baylor  ali  30  448SRPCQNGAVCVD---GVNGFVCTCSAGYTGVLCETVTDE. 483
587 3.000e-04gi|348536415|ref|XP_003455692.1| PREDICTED: crumbs homolog 1-like [Oreochromis niloticus]  clstr ali  41 1064.NPCLNGGECQDL---FNAYNCSCPEGWAGRCC....... 1092
588 3.000e-04gi|390338133|ref|XP_001199955.2| PREDICTED: neurogenic locus notch homolog protein 2-like [Strongylocentrotus purpuratus]  clstr ali  28  349..PCENGAICQNE--GLDDYSCACGDGWKGTNCEVDVNE. 383
589 3.000e-04gi|260786234|ref|XP_002588163.1| hypothetical protein BRAFLDRAFT_68801 [Branchiostoma floridae]  clstr ali  26  50SNPCQNEGICLDA---DGKYTCLCKAGWKGTNC....... 79
590 3.000e-04gi|344265714|ref|XP_003404927.1| PREDICTED: slit homolog 3 protein [Loxodonta africana]  clstr ali  27  899SSPCKNNGTCSQDPVEL--YRCACPYGYKGKDCSMPIN.. 934
591 3.000e-04NEWGM STRPU GLEAN3_02783|Strongylocentrotus purpuratus|Baylor  ali  38  648SAPCMNGGTCVD---GFNNVTCNCTDDYEGNMCEHRVDE. 683
592 3.000e-04gi|259013422|ref|NP_001158418.1| delta protein precursor [Saccoglossus kowalevskii]  clstr ali  38  543SNPCHNGGICANHI---NGYVCACSEGFYGRDCE...... 573
593 3.000e-04NEWGM DROPS Contig1006_Contig943|GENSCAN_predicted_peptide_193|934_aa|Drosophila pseudoobscura|Baylor  ali  26  187...CQHGGECMEGPGLE--FTCDCPAGWHGRICQEEINE. 220
594 3.000e-04gi|260836180|ref|XP_002613084.1| hypothetical protein BRAFLDRAFT_125704 [Branchiostoma floridae]  clstr ali  36  340SQPCLNQGRCFDIV---NGYGCFCRYGWIGTHCDIN.... 372
595 3.000e-04gi|325698132|gb|ADZ44640.1| delta-like protein 1 [Coturnix coturnix]  clstr ali  36  181SNPCENGGTCTDI---GAGFSCLCPHGYTGKLC....... 210
596 3.000e-04gi|242004578|ref|XP_002423159.1| class D atypical G-protein coupled receptor GPRstn1, putative [Pediculus humanus corporis]  clstr ali  27 1734SNPCKNGGKCKEE---WGTFLCECKEGHGGKDCSQSIQSS 1770
597 3.000e-04gi|326429504|gb|EGD75074.1| notch-1 [Salpingoeca sp. ATCC 50818]  clstr ali  45 4929...CANGGTCVQD-TQARHYMCACPVEFEGPTCNI..... 4959
598 3.000e-04gi|326678462|ref|XP_003201064.1| PREDICTED: hypothetical protein LOC100537349 [Danio rerio]  clstr ali  51  133.CVCMNGGSCVTNIRFSGEYLCICPSGFHGDHCQ...... 168
599 3.000e-04gi|395505240|ref|XP_003756951.1| PREDICTED: coagulation factor XII [Sarcophilus harrisii]  clstr ali  41  145DNPCLHGGKCLEAEGQS---VCHCPPSYAGHFCEIDTSA. 180
600 3.000e-04gi|345324065|ref|XP_001513341.2| PREDICTED: hyaluronan-binding protein 2 [Ornithorhynchus anatinus]  clstr ali  42  134.NPCQNGGVCSRHRRRSK-FTCDCPVGFSGKFCEI..... 166
601 3.000e-04gi|399021|sp|P25304.2|AGRIN_RAT RecName: Full=Agrin; Flags: Precursor  clstr ali  50 1719.NPCLNGGSCVPRE---ATYECLCPGGFSGLHCE...... 1748
602 3.000e-04gi|348578597|ref|XP_003475069.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein-like [Cavia porcellus]  clstr ali  43 1181SCDCLNGGSCVPDRKFSGAYLCICLPGFHGGLCEVAVDA. 1222
603 3.000e-04gi|327265667|ref|XP_003217629.1| PREDICTED: coagulation factor XII-like [Anolis carolinensis]  clstr ali  40  262.NPCQNGGICEARKIG---FHCICRPGFHGRNCERD.... 293
604 3.000e-04gi|126273824|ref|XP_001370487.1| PREDICTED: lactadherin-like [Monodelphis domestica]  clstr ali  36  181.NPCLNNGQCVTESRRGDVYVCECPEGYEGPHCQ...... 218
605 3.000e-04gi|301605091|ref|XP_002932182.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 2-like [Xenopus (Silurana) tropicalis]  clstr ali  23 1745.NPCQHQSTCVKRTSYPHGYMCDCASGYYGTYCENRLDQ. 1782
606 3.000e-04gi|357610242|gb|EHJ66890.1| hypothetical protein KGM_21712 [Danaus plexippus]  clstr ali  39 4290..PCLNGATCLNEP---GSFRCLCPPDKTGMNC....... 4317
607 4.000e-04gi|157167660|ref|XP_001661628.1| neurogenic locus delta protein [Aedes aegypti]  clstr ali  43  522SSPCKNGGTCVNRV---NSFQCVCAGGFRGSTC....... 551
608 4.000e-04gi|395507858|ref|XP_003758235.1| PREDICTED: protein jagged-1 [Sarcophilus harrisii]  clstr ali  25  341SDPCHNGGSCLETFMG---FECRCLPGWTGPTCTTNID.. 375
609 4.000e-04gi|395528346|ref|XP_003766291.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 [Sarcophilus harrisii]  clstr ali  40  577SDPCLNGGKCVDLVA---NYTCLCSEPFTGPRCEL..... 608
610 4.000e-04gi|156369995|ref|XP_001628258.1| predicted protein [Nematostella vectensis]  clstr ali  43  273SNPCVNGGTCADLV---NGFNCTCPPGYKGTKCEI..... 304
611 4.000e-04gi|405977490|gb|EKC41937.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  36  130..PCENNGTCTDLV---NDYQWNCMLGFNGTNCENNID.. 162
612 4.000e-04gi|156340398|ref|XP_001620440.1| hypothetical protein NEMVEDRAFT_v1g148151 [Nematostella vectensis]  clstr ali  42  203.NPCANGGTCKD---GINGFTCECPVGYSGSTCEIGKDC. 237
613 4.000e-04gi|221132728|ref|XP_002161897.1| PREDICTED: similar to notch [Hydra magnipapillata]  clstr ali  31 1553.NPCLKNSTCEDLI---NDFKCNCIPGYVGKLCDVDIDE. 1587
614 4.000e-04gi|354485111|ref|XP_003504727.1| PREDICTED: crumbs homolog 1 [Cricetulus griseus]  clstr ali  25  210SDPCMNEAVCLNEI---GRYICVCPQEYSGVNCELEIDE. 245
615 4.000e-04gi|345307044|ref|XP_001513446.2| PREDICTED: sushi, nidogen and EGF-like domains 1 [Ornithorhynchus anatinus]  clstr ali  36  355...CQNGGECQAENGTA---VCVCQSGYMGEDCEIDINE. 387
616 4.000e-04gi|260841562|ref|XP_002613981.1| hypothetical protein BRAFLDRAFT_118457 [Branchiostoma floridae]  clstr ali  19 1106SMPCYSLATCLDRVAG---YECVCASGWTGERCDVNIDE. 1141
617 4.000e-04gi|348504269|ref|XP_003439684.1| PREDICTED: crumbs homolog 1-like [Oreochromis niloticus]  clstr ali  33 1319...CANDGVCNDGLWGAN---CTCMPGFTGTRCEMEINE. 1351
618 4.000e-04NEWGM APIME gnl|Amel|GB20122-PA GLEAN3_03290|Apis mellifera (honeybee)|Baylor  ali  30 2022..PCLLGANCTDLIA---DFTCDCPPGFTGKRCHEKID.. 2054
619 4.000e-04gi|260821746|ref|XP_002606264.1| hypothetical protein BRAFLDRAFT_83984 [Branchiostoma floridae]  clstr ali  35  525..PCQNSGVCIND---GDSYVCECVEGFRGAICETD.... 555
620 4.000e-04gi|405951848|gb|EKC19723.1| Fibropellin-1, partial [Crassostrea gigas]  clstr ali  36 1070..PCMNNGTCIDLI---SDYKCVCLGGFNGTNCTI..... 1099
621 4.000e-04NEWGM CAP jgi|Capca1|141302|e_gw1.224.17.1|Capitella sp.1|JGI  ali  38  286...CLNGGRCVD---GINNYTCECVGGWTGLHCETNIDE. 321
622 4.000e-04gi|260827625|ref|XP_002608765.1| hypothetical protein BRAFLDRAFT_73991 [Branchiostoma floridae]  clstr ali  46  799.NPCFNGGICLEVN---GTYICDCPEGFNGVHCEID.... 830
623 4.000e-04gi|47226149|emb|CAG08296.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  36  923.NKCQHGAECVDAV---NGYICVCKEGFSGLFCE...... 952
624 4.000e-04NEWGM STRPU GLEAN3_25788|Strongylocentrotus purpuratus|Baylor  ali  34  796SRPCQNDGQC--FGESGGRHRCECINGFGGTNCETAI... 830
625 4.000e-04gi|260792245|ref|XP_002591126.1| hypothetical protein BRAFLDRAFT_105530 [Branchiostoma floridae]  clstr ali  37  512SRPCANGGECID---GLNSFTCNCTLAFSGLQCESAVD.. 546
626 4.000e-04NEWGM STRPU GLEAN3_02112|Strongylocentrotus purpuratus|Baylor  ali  40 2046..PCANGGSCRD---GVNQYVCSCTTNFQGPRCRI..... 2075
627 4.000e-04gi|350594431|ref|XP_003134124.3| PREDICTED: slit homolog 3 protein [Sus scrofa]  clstr ali  32 1309.NLCQHEAKCVSLDRG---FRCDCPPGYSGKLCEVDND.. 1342
628 4.000e-04gi|405951582|gb|EKC19482.1| Sodium-dependent neutral amino acid transporter B(0)AT3 [Crassostrea gigas]  clstr ali  35 1600.....NHGTCSNIY---GDYVCNCNSGFTGPNCLQDVDE. 1630
629 4.000e-04gi|165993279|emb|CAP71951.1| slit1b [Danio rerio]  clstr ali  31 1051.NPCQRGSTCIPTVSGP---KCICPPGFVGDDCSVDYNE. 1085
630 4.000e-04gi|198437917|ref|XP_002124095.1| PREDICTED: similar to SLIT2 [Ciona intestinalis]  clstr ali  35  904..PCNNGGRCIARD--EAVYTCECPVGFSGDRCEVNVD.. 937
631 4.000e-04NEWGM HYDMA Hma2.210936 |Hydra magnipapillata (freshwater polyp)|JGI  ali  34  173ENNCLNGATCINQL---EDYICICPVGYSGKNCSININ.. 207
632 4.000e-04gi|395833454|ref|XP_003789748.1| PREDICTED: protein eyes shut homolog [Otolemur garnettii]  clstr ali  47 1277...CLNGGICISRP--GNTFDCRCLPGFSGQFCEININE. 1310
633 4.000e-04gi|74226559|dbj|BAE23941.1| unnamed protein product [Mus musculus]  clstr ali  51  49...CQNGGTCV---PGADAHSCDCRPGFKGRHCEL..... 77
634 4.000e-04gi|328704748|ref|XP_001952607.2| PREDICTED: hypothetical protein LOC100162487 [Acyrthosiphon pisum]  clstr ali  37  707.NPCKNGGECVPSRRWRGTYSCICPLGYSGENCEIDRD.. 758
635 4.000e-04gi|291243842|ref|XP_002741800.1| PREDICTED: conserved hypothetical protein-like, partial [Saccoglossus kowalevskii]  clstr ali  33 3692..PCMNGATCQD---GNNAYSCICPNGYEGSRCQNNID.. 3724
636 4.000e-04gi|332234442|ref|XP_003266417.1| PREDICTED: LOW QUALITY PROTEIN: protocadherin Fat 2-like [Nomascus leucogenys]  clstr ali  39 3647NCSCLEGGTCILSPKGAS---CNCPHPYTGDRCEMEAR.. 3684
637 4.000e-04gi|297261317|ref|XP_001111116.2| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 1 [Macaca mulatta]  clstr ali  33 1412SNPCGANGRCRSRE---GGYTCECFQDFTGEHCEVDARS. 1447
638 5.000e-04gi|148227866|ref|NP_001081074.1| neurogenic locus notch protein homolog precursor [Xenopus laevis]  clstr ali  25  721SNPCIHGA-CHD---GVNGYKCDCEAGWSGSNCDINNNE. 755
639 5.000e-04NEWGM CAP jgi|Capca1|123363|e_gw1.17.152.1|Capitella sp.1|JGI  ali  35  54SNPCQHGGSCVDDI---NAFHCICPPGVEGD......... 81
640 5.000e-04gi|351713254|gb|EHB16173.1| Sushi, nidogen and EGF-like domain-containing protein 1 [Heterocephalus glaber]  clstr ali  33  921..PCRNGSSCRDLP---GAFICQCSAGFVGVHCETEVD.. 953
641 5.000e-04gi|348508470|ref|XP_003441777.1| PREDICTED: delta and Notch-like epidermal growth factor-related receptor [Oreochromis niloticus]  clstr ali  34  363SQPCKNGATCFSSLAGP---RCYCPEGYQGATCEQKVD.. 397
642 5.000e-04gi|119591637|gb|EAW71231.1| hCG2013435, isoform CRA_d [Homo sapiens]  clstr ali  43  270..PCLNGGSCVDLV---GNYTCLCAEPFKGLRCET..... 299
643 5.000e-04NEWGM BRAFL jgi|Brafl1|92314|fgenesh2_pg.scaffold_221000044|Branchiostoma floridae|JGI  ali  30  289SNPCLNNGSCHDYI---NFYICECVGGWKGVHCDDNNDE. 324
644 5.000e-04NEWGM CAP jgi|Capca1|227694|estExt_fgenesh1_pg.C_230059|Capitella sp.1|JGI  ali  36  464.NPCLNEGVCED---GVSSYTCRCQADYNGTHCE...... 493
645 5.000e-04NEWGM CAP jgi|Capca1|123468|e_gw1.17.230.1|Capitella sp.1|JGI  ali  39  93SNPCENGGTCQDDY---GHYTCVCPSGWTGQ......... 120
646 5.000e-04gi|11526769|gb|AAG36772.1|AF210320_1 Slit3 [Danio rerio]  clstr ali  36 1073.NKCQHGAECVDAI---NGYTCVCKEGFSGLFCE...... 1102
647 5.000e-04gi|47214975|emb|CAG01309.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  41  13SSPCRNGATCLDNL---DDYVCLCPKGFMGRNCE...... 46
648 5.000e-04gi|350589368|ref|XP_003482842.1| PREDICTED: crumbs homolog 1 [Sus scrofa]  clstr ali  36  359...CYNGGNCTESQGEL---QCTCRPGFTGEWCERDVDE. 391
649 5.000e-04gi|350408086|ref|XP_003488297.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus protein delta-like [Bombus impatiens]  clstr ali  35  558SAPCRNGGTCLNRV---NGFLCQCPEGWHGDTCSEEV... 591
650 5.000e-04gi|291227215|ref|XP_002733582.1| PREDICTED: neurogenic locus notch homolog protein 2-like [Saccoglossus kowalevskii]  clstr ali  36 1192...CRNGGTCTNLP---GSYSCDCASGFRGTSCNEDINE. 1224
651 5.000e-04gi|241672093|ref|XP_002411438.1| neurogenic locus notch, putative [Ixodes scapularis]  clstr ali  33 1186..PCAEGSTCVDL---GSTYTCACPEGLVGPNCENNID.. 1218
652 5.000e-04gi|405966854|gb|EKC32089.1| Neurogenic locus notch-like protein 2 [Crassostrea gigas]  clstr ali  33  792NSPCLHNGTCINNN---GSYGCICTEGWEDKTCDTD.... 824
653 5.000e-04gi|242007941|ref|XP_002424773.1| hypothetical protein Phum_PHUM150870 [Pediculus humanus corporis]  clstr ali  38  171...CLNGGLCIEGPGLT--FNCICPLGWSGQLCENNLDE. 204
654 5.000e-04gi|348529464|ref|XP_003452233.1| PREDICTED: slit homolog 2 protein [Oreochromis niloticus]  clstr ali  29 1053.NPCQHDSKCILIPQG---YKCECIPGFIGEHCELDYD.. 1086
655 5.000e-04gi|241826792|ref|XP_002414716.1| neurogenic locus protein delta, putative [Ixodes scapularis]  clstr ali  38  513..PCSNGGRCVDLV---NDFACRCPPGFSGKDCSVSLDE. 546
656 5.000e-04NEWGM SARC SARC_08905T0 | SARC_08905 | Sphaeroforma arctica JP610 hypothetical protein (398 aa)  ali  31  226.NPCLNNGLCVND--GTGMYQCTCLEGYEGVNCQV..... 257
657 5.000e-04gi|344294176|ref|XP_003418795.1| PREDICTED: delta-like protein 4 [Loxodonta africana]  clstr ali  37  409.NPCANGGQCLNRGPNS---LCRCRPGFTGARCELPISS. 443
658 5.000e-04gi|391330789|ref|XP_003739836.1| PREDICTED: protein slit-like [Metaseiulus occidentalis]  clstr ali  40 1075...CENNGTCVDRI---NGYSCLCPMPYTGEFCETKMN.. 1106
659 5.000e-04gi|194762320|ref|XP_001963298.1| GF14011 [Drosophila ananassae]  clstr ali  32  842.NPCMNGGSCV---GNSTHFRCDCTPGFTGPLCQHSLNE. 878
660 5.000e-04gi|312378893|gb|EFR25337.1| hypothetical protein AND_09419 [Anopheles darlingi]  clstr ali  38  73.NTCQNGGKCKSLIKEDGYYRCECPTGYKGRNCEI..... 106
661 5.000e-04NEWGM CAP jgi|Capca1|115228|e_gw1.217.58.1|Capitella sp.1|JGI  ali  32  315SNPCQNGGTCSPRGSRGDAYTCVCTDRYTGTHCQ...... 348
662 5.000e-04gi|410923407|ref|XP_003975173.1| PREDICTED: versican core protein-like [Takifugu rubripes]  clstr ali  34  404SNPCRNGGTCID---GLASFTCVCLPSYSGLYCEEDTQ.. 438
663 5.000e-04gi|61162130|dbj|BAD91054.1| Af1-cadherin [Artemia franciscana]  clstr ali  53 1148...CFNGGTCILNGLFP---RCECPDNFEGPRCE...... 1175
664 6.000e-04gi|363740489|ref|XP_415420.3| PREDICTED: neurogenic locus notch homolog protein 1 [Gallus gallus]  clstr ali  37  56NNPCRNGGTC--DLVTLSEYKCRCPPGWSGKTCQ...... 87
665 6.000e-04gi|332024482|gb|EGI64680.1| Neurogenic locus protein delta [Acromyrmex echinatior]  clstr ali  45  190SKPCLNGGTCTSRQQHRRSYRCTCPPGWRGRHCEI..... 244
666 6.000e-04gi|291236801|ref|XP_002738326.1| PREDICTED: neurogenic locus notch homolog protein 2-like [Saccoglossus kowalevskii]  clstr ali  30 3317SDPCHNGGNCIDEV---DGYRCECSDGWEGENC....... 3346
667 6.000e-04gi|390336919|ref|XP_785416.3| PREDICTED: uncharacterized protein LOC580251 [Strongylocentrotus purpuratus]  clstr ali  28 2401SSPCSNGATCLDDV---DGFTCTCTEEFTGPTCDDNTD.. 2435
668 6.000e-04gi|195128855|ref|XP_002008875.1| GI13732 [Drosophila mojavensis]  clstr ali  40  465.NPCQNNGVCHLLP--GNKHQCVCPAGFTGSSC....... 494
669 6.000e-04gi|347970808|ref|XP_310433.5| AGAP003873-PA [Anopheles gambiae str. PEST]  clstr ali  31  728SNPCSKGSSCVDQVA---NFTCMCVPGMTGRLCEIDID.. 762
670 6.000e-04NEWGM BRAFL jgi|Brafl1|90383|fgenesh2_pg.scaffold_197000050|Branchiostoma floridae|JGI  ali  51  253...CDNGGTCVD---GINEYSCDCADGFFGDHCET..... 281
671 6.000e-04NEWGM HELRO jgi|Helro1|158374|Helobdella robusta|JGI  ali  33  318SNPCLRGATCVDLVAG---FSCKCEDGYGGLLCADDLDE. 353
672 6.000e-04NEWGM CAP jgi|Capca1|207760|fgenesh1_pg.C_scaffold_46000009|Capitella sp.1|JGI  ali  25  428SHPCQNGASCINDVA---SFTCQCANGYIGILCQ...... 458
673 6.000e-04NEWGM CAP jgi|Capca1|217414|fgenesh1_pg.C_scaffold_557000009|Capitella sp.1|JGI  ali  45 1212SSPCLNGGTCFNAI---DHYQCLCLKDFSSVHCE...... 1242
674 6.000e-04gi|345304718|ref|XP_001511628.2| PREDICTED: EGF-like repeat and discoidin I-like domain-containing protein 3-like [Ornithorhynchus anatinus]  clstr ali  37  275..PCKNGGICTDLIA---NYSCECPGEFMGRNCQ...... 303
675 6.000e-04gi|390341179|ref|XP_784291.3| PREDICTED: uncharacterized protein LOC579064 [Strongylocentrotus purpuratus]  clstr ali  27  581.NPCLNGASCINTPGIGG-----CATGWYGANCDLDIDE. 613
676 6.000e-04gi|395505064|ref|XP_003756866.1| PREDICTED: slit homolog 3 protein [Sarcophilus harrisii]  clstr ali  32  902.NDCENNSTCLD---GINNYVCVCPPNYTGELCDEVID.. 935
677 6.000e-04NEWGM CAP jgi|Capca1|141264|e_gw1.224.39.1|Capitella sp.1|JGI  ali  26  55SMPCMNGGQCQDLE----SFNCSCLPGYTDRLCESEID.. 88
678 6.000e-04gi|195433705|ref|XP_002064848.1| GK15151 [Drosophila willistoni]  clstr ali  36 1266.NPCQYGGTCVQFP--GSGYLCLCPLGKHGHYCEHN.... 1298
679 6.000e-04gi|405974833|gb|EKC39446.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  36  984SSPCQNGGSCNDLV---NRFECTCSGRYNGTVCEKD.... 1016
680 6.000e-04NEWGM STRPU GLEAN3_10895|Strongylocentrotus purpuratus|Baylor  ali  32  157..PCRNGGSCTDLI---DGFQCSCLDGYKGKHCTQDNNE. 190
681 6.000e-04gi|260828675|ref|XP_002609288.1| hypothetical protein BRAFLDRAFT_86801 [Branchiostoma floridae]  clstr ali  37  176...CANGGTCIDKV---NDYECYCAPGFTGKDCGRNIDCT 210
682 6.000e-04gi|189237687|ref|XP_969192.2| PREDICTED: similar to Neural-cadherin precursor (Cadherin-N protein) (DN-cadherin) [Tribolium castaneum]  clstr ali  38 2268NTPCYNGGRCIETRYSL---SCSCPATYNGPRCQ...... 2298
683 6.000e-04gi|348554764|ref|XP_003463195.1| PREDICTED: protein jagged-2-like [Cavia porcellus]  clstr ali  40  420..PCVNGGTCINVEP--DQYRCACPDGYSGKNCE...... 449
684 6.000e-04NEWGM ANOCA ENSACAP00000006162 pep:novel scaffold:AnoCar1.0:scaffold_39:949727:965037:1 gene:ENSACAG00000006272 transcript:ENSACAT000000062  ali  44  135.NPCLNGGLCLELKSSW---VCGCPEGFSGSLCDIDHNQT 170
685 6.000e-04gi|29837359|gb|AAP05764.1| notch-like transmembrane receptor LIN-12 [Caenorhabditis remanei]  clstr ali  42  551ENPCANGGTCHQNR---ESFSCECPSGFYGERCELEKR.. 585
686 6.000e-04gi|358333946|dbj|GAA52401.1| protein slit, partial [Clonorchis sinensis]  clstr ali  34  564.NPCLNGATCTQLP--GNKYRCECERGWSGKNCHINQD.. 598
687 6.000e-04gi|61162128|dbj|BAD91053.1| Fc2-cadherin [Folsomia candida]  clstr ali  41  913...CYNGGRCIETKSGP---VCHCPPGRDGPRCQI..... 941
688 6.000e-04gi|61162123|dbj|BAD91051.1| Gb2-cadherin [Gryllus bimaculatus]  clstr ali  38  412SSPCHNGGRCVEGRYGLS---CSCPSGYNGPRCQ...... 442
689 7.000e-04gi|291225152|ref|XP_002732565.1| PREDICTED: neurogenic locus notch homolog protein 2-like [Saccoglossus kowalevskii]  clstr ali  35  900SSPCQHGGTCHDLVYR---FECECIPGYNGTVCE...... 930
690 7.000e-04gi|157120683|ref|XP_001659721.1| crumbs [Aedes aegypti]  clstr ali  31  601SNPCTKGSTCRDRVA---NFTCVCIPGMTGRLCEIDID.. 635
691 7.000e-04gi|109018989|ref|XP_001110878.1| PREDICTED: crumbs homolog 1-like isoform 1 [Macaca mulatta]  clstr ali  36 1156...CYNGGNCTEFQAEL---KCMCRPGFTGERCEKDIDE. 1188
692 7.000e-04gi|260815565|ref|XP_002602543.1| hypothetical protein BRAFLDRAFT_227194 [Branchiostoma floridae]  clstr ali  35  131SGPCQHGGACIDLV---NSYSCSCASGFQGTNCE...... 161
693 7.000e-04gi|395851578|ref|XP_003798330.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 [Otolemur garnettii]  clstr ali  40  393SAPCLNGGSCVNLV---GNYTCMCAQPFIGPRCET..... 424
694 7.000e-04gi|33186657|gb|AAP97498.1| notch ligand [Danio rerio]  clstr ali  40  302..PCLNGGTCSN--TGPDKYQCSCEDGYSGVNCE...... 331
695 7.000e-04NEWGM STRPU GLEAN3_10532|Strongylocentrotus purpuratus|Baylor  ali  32  161..PCWNGAICDETV---DGFSCTCAEGFSGPLCEEDINE. 194
696 7.000e-04gi|667063|emb|CAA35572.1| epidermal growth factor [Strongylocentrotus purpuratus]  clstr ali  34  84..PCQNGGLCID---GIAGYTCQCRLGYIGVNCE...... 112
697 7.000e-04gi|4377995|gb|AAD19336.1| SLIT1 protein, partial [Homo sapiens]  clstr ali  42  510...CRHGAQCVDTI---NGYTCTCPQGFSGPFCE...... 537
698 7.000e-04gi|241599043|ref|XP_002404947.1| cubilin, putative [Ixodes scapularis]  clstr ali  31  288SDPCQNNGTCHND--GPTGVACTCTPEWTGPLCE...... 319
699 7.000e-04gi|121949534|sp|A0A1F4.1|EYS_DROME RecName: Full=Protein eyes shut; AltName: Full=Protein spacemaker  clstr ali  36 1316.NPCQYGGTCVQFP--GSGYLCLCPLGKHGHYCEHN.... 1348
700 7.000e-04gi|18858545|ref|NP_571019.1| delta-like protein C precursor [Danio rerio]  clstr ali  44  466..PCQNGGTCYTHFSGP---VCQCPAGFMGTQCE...... 494
701 7.000e-04gi|405957347|gb|EKC23565.1| Neurogenic locus notch-like protein 2 [Crassostrea gigas]  clstr ali  35 1886..PCKNGATCIDLDT---TFYCKCDSRFTGRHCDVDVNE. 1919
702 7.000e-04gi|348507537|ref|XP_003441312.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 2 [Oreochromis niloticus]  clstr ali  40 1433...CKNGGTCVNLLVG--GFKCECPPGYEKPYCE...... 1462
703 7.000e-04gi|390335924|ref|XP_001198702.2| PREDICTED: fibropellin-1-like [Strongylocentrotus purpuratus]  clstr ali  45  820..SCSNGGTCVSLVQGSTDYICECPVGYFGDRCEIDINE. 856
704 7.000e-04gi|427796811|gb|JAA63857.1| Putative prolow-density lipoprotein receptor-related protein 1, partial [Rhipicephalus pulchellus]  clstr ali  41 4431SCGCLHGATCITTKHEEGTQRCVCPAGFTGERCE...... 4465
705 7.000e-04gi|321478607|gb|EFX89564.1| hypothetical protein DAPPUDRAFT_233379 [Daphnia pulex]  clstr ali  35 5352SSPCLFNGRCYNLN---NDYRCECPARLSGKRCE...... 5382
706 8.000e-04NEWGM STRPU GLEAN3_25494|Strongylocentrotus purpuratus|Baylor  ali  30  56SFPCFNYEECLD---GRNGYSCICKSGFDGTHCDVDIDE. 91
707 8.000e-04gi|47209058|emb|CAF90766.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  34  919SEPCLNGGACEDQ---FDQFSCACLPGWGGERCQSDLD.. 953
708 8.000e-04gi|291234025|ref|XP_002736953.1| PREDICTED: neurogenic locus notch homolog protein 2-like [Saccoglossus kowalevskii]  clstr ali  35  907..PCLNGGQCID---GINSFTCVCAGGYTGVICDININE. 940
709 8.000e-04gi|307219280|gb|ADN39445.1| RT09974p [Drosophila melanogaster]  clstr ali  29  727..PCQNQAQCVALPQRE--YQCLCQPGYHGKHCEFMID.. 760
710 8.000e-04gi|41327708|ref|NP_957705.1| crumbs homolog 1 isoform 1 precursor [Homo sapiens]  clstr ali  40  450...CLNNGTCIPHQDGQHGFSCLCPSGYTGSLCEI..... 482
711 8.000e-04gi|405966340|gb|EKC31636.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  29 3176SNPCLHGGRCIDLI---GQYQCDCSEGYSGINC....... 3206
712 8.000e-04gi|260791912|ref|XP_002590971.1| hypothetical protein BRAFLDRAFT_69478 [Branchiostoma floridae]  clstr ali  36  118SNPCWGGGTCIDKV---DGYSCVCPEGFAGETC....... 147
713 8.000e-04gi|358340571|dbj|GAA48434.1| hypothetical protein CLF_101604 [Clonorchis sinensis]  clstr ali  46  568...CQNGGQCVSHGMTT---QCNCPVGFAGPMCEVEIN.. 599
714 8.000e-04gi|195450244|ref|XP_002072428.1| GK22329 [Drosophila willistoni]  clstr ali  37  318.NPCKNNAACV-VLSGSPSISCECPKGYAGKMCEIDTDE. 354
715 8.000e-04NEWGM STRPU GLEAN3_22974|Strongylocentrotus purpuratus|Baylor  ali  50 3280..PCLHGGKCV------GPYSCECPYGFTGSRCE...... 3305
716 8.000e-04gi|301614560|ref|XP_002936761.1| PREDICTED: slit homolog 2 protein-like [Xenopus (Silurana) tropicalis]  clstr ali  26 1046.NPCQHDSKCILTLKG---YKCDCTPGYIGEHCDIDYD.. 1079
717 8.000e-04gi|195039613|ref|XP_001990916.1| GH12407 [Drosophila grimshawi]  clstr ali  23  465SKPCKNDGRCIP-IPETDGFLCQCQPGYQGRLCDV..... 498
718 8.000e-04NEWGM STRPU GLEAN3_09660|Strongylocentrotus purpuratus|Baylor  ali  25  186SNPCMNGAACVD---GIDSFTCTCVAGYEGTTCDTNINE. 221
719 8.000e-04NEWGM PRIPA PPA12472 | PP16491 | WBGene00102026 | status:Predicted|Pristionchus pacificus|Wormbase  ali  50  154..PCLNGGTCIDAHL---AYSCQCPSNFKGTNCEI..... 183
720 8.000e-04gi|410048850|ref|XP_510206.4| PREDICTED: LOW QUALITY PROTEIN: protein jagged-2 [Pan troglodytes]  clstr ali  45  429...CQHGGTCKDLV---NGYQCVCPRGFGGRHCELERDE. 461
721 8.000e-04gi|301614291|ref|XP_002936624.1| PREDICTED: protein delta homolog 1-like [Xenopus (Silurana) tropicalis]  clstr ali  41  147..PCQNGGKCTDNNGFASYASCQCPPGFIGNYCEIQID.. 182
722 8.000e-04gi|341865456|dbj|BAK53861.1| delta [Gryllus bimaculatus]  clstr ali  46  305..PCLNGGTCFN--TGQGLYTCTCPPGFTGTDCE...... 334
723 8.000e-04gi|242006694|ref|XP_002424182.1| protocadherin fat 2 precursor, putative [Pediculus humanus corporis]  clstr ali  42 3929..................GYSCQCPDGFTGEFCELDISQ. 3949
724 9.000e-04gi|340376769|ref|XP_003386904.1| PREDICTED: protein jagged-2-like [Amphimedon queenslandica]  clstr ali  32  364..PCYNNGTCIEGEPG--SFNCICPIGWKGDSCEDKID.. 397
725 9.000e-04gi|402896704|ref|XP_003911429.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Papio anubis]  clstr ali  48 3454..PCLNGGRCVAP------YQCDCPPGWTGSRCHI..... 3480
726 9.000e-04NEWGM APIME gnl|Amel|GB12464-PA GLEAN3_08354|Apis mellifera (honeybee)|Baylor  ali  35  576STPCRNGGTCVNRV---NGFLCQCADGWHGDTCADEI... 609
727 9.000e-04NEWGM CAP jgi|Capca1|181612|estExt_Genewise1Plus.C_7690018|Capitella sp.1|JGI  ali  38  35NGSCQNGGTCQVAPTYWAGYRCSCPPGFIGLTCQIN.... 70
728 9.000e-04NEWGM LOTGI jgi|Lotgi1|229585|estExt_fgenesh2_pg.C_sca_80179|Lottia gigantea |JGI  ali  41  126.NPCLNGATC--YSYRNGCYKCHCPYGYEGYNCE...... 156
729 9.000e-04gi|119593835|gb|EAW73429.1| cadherin, EGF LAG seven-pass G-type receptor 1 (flamingo homolog, Drosophila), isoform CRA_b [Homo sapiens]  clstr ali  35 1371..PCGANGRCRSRE---GGYTCECFEDFTGEHCEVDARS. 1404
730 1.000e-03gi|355753041|gb|EHH57087.1| Crumbs-like protein 2, partial [Macaca fascicularis]  clstr ali  25  229SSPCQHGGRCLQRSDHAAGFVCHCPPGFEGADCGVEVDE. 285
731 1.000e-03gi|348529025|ref|XP_003452015.1| PREDICTED: slit homolog 1 protein-like [Oreochromis niloticus]  clstr ali  42 1020.....NGATCID---GVNNYTCFCPPYYTGEMCE...... 1045
732 1.000e-03NEWGM CAP jgi|Capca1|170418|estExt_Genewise1Plus.C_1610002|Capitella sp.1|JGI  ali  37  50SSPCENHGICVLNETLTDGFYCKCIEGFEGEFCEI..... 84
733 1.000e-03gi|260792062|ref|XP_002591046.1| hypothetical protein BRAFLDRAFT_119075 [Branchiostoma floridae]  clstr ali  22  501NSPCVHG-SCIDAI---GGYTCTCQNGWEGTNCDLNINE. 535
734 1.000e-03gi|170046765|ref|XP_001850920.1| serrate protein [Culex quinquefasciatus]  clstr ali  44  289..PCRNGGECVDLI---GNFKCICPLGFSGTLCE...... 317
735 1.000e-03gi|260782452|ref|XP_002586301.1| hypothetical protein BRAFLDRAFT_82907 [Branchiostoma floridae]  clstr ali  40  256SSPCWLGGTCLDHV---NGYSCVCPKDTTGKNCET..... 287
736 1.000e-03NEWGM STRPU GLEAN3_23185|Strongylocentrotus purpuratus|Baylor  ali  41  454SGPCLNEGTCVNRL---NSFTCNCTEGWFGTYCQ...... 484
737 1.000e-03gi|348561405|ref|XP_003466503.1| PREDICTED: delta-like protein 1-like [Cavia porcellus]  clstr ali  31  530SAPCSSGARCVDL---GDAYLCRCQAGFSGRHCEDNVD.. 564
738 1.000e-03gi|403301580|ref|XP_003941465.1| PREDICTED: neurogenic locus notch homolog protein 1 [Saimiri boliviensis boliviensis]  clstr ali  34  90SNPCRNGGTC--DLLTLMEFKCRCPPGWSGKSCQ...... 121
739 1.000e-03gi|351714659|gb|EHB17578.1| Delta-like protein 1 [Heterocephalus glaber]  clstr ali  31  412SAPCSSGAKCVDL---GDAYLCRCQAGFSGRHCEDNVD.. 446
740 1.000e-03gi|154147745|ref|NP_001093689.1| delta-like 1 precursor [Xenopus (Silurana) tropicalis]  clstr ali  36  490.NPCHNGATCHERN---NRYVCQCARGYGGNNCQ...... 519
741 1.000e-03NEWGM SARC SARC_07472T0 | SARC_07472 | Sphaeroforma arctica JP610 hypothetical protein (1162 aa)  ali  29  546.NPCYNDGGCID---GVNAYTCGCAVGYSGHNCEVQTD.. 579
742 1.000e-03gi|363736446|ref|XP_003641718.1| PREDICTED: crumbs homolog 1 [Gallus gallus]  clstr ali  31  431...CQNNGICIPHLNGHHGFSCICSPGYTGIHCET..... 463
743 1.000e-03gi|113195657|ref|NP_001037825.1| Notch precursor [Ciona intestinalis]  clstr ali  33 1238...CFNSGNCVD---GIGGFTCTCVPGYAGPRCEGDVNE. 1270
744 1.000e-03gi|326924893|ref|XP_003208657.1| PREDICTED: crumbs homolog 1-like [Meleagris gallopavo]  clstr ali  31  296...CQNNGICIPHLNGHHGFSCICSPGYTGIHCET..... 328
745 1.000e-03gi|327280294|ref|XP_003224887.1| PREDICTED: protein delta homolog 1-like [Anolis carolinensis]  clstr ali  41  178.NPCENGGTCTDI---GRGFHCHCPMGFSGALC....... 206
746 1.000e-03gi|66363480|gb|AAY45762.1| notch [Strigamia maritima]  clstr ali  35  46.NPCLSGGICTDLI---NSYKCLCPNGYAGKRCQINID.. 79
747 1.000e-03gi|301605180|ref|XP_002932223.1| PREDICTED: crumbs homolog 1-like [Xenopus (Silurana) tropicalis]  clstr ali  43  258SYPCLNGGLCID---GDNGYTCECMVGFIGMHCE...... 289
748 1.000e-03gi|301754874|ref|XP_002913305.1| PREDICTED: delta-like protein 4-like [Ailuropoda melanoleuca]  clstr ali  39  486SGPCFNGATCYPGLSE-DSFVCNCPYGFVGSRCE...... 518
749 1.000e-03gi|410979128|ref|XP_003995938.1| PREDICTED: crumbs homolog 2 [Felis catus]  clstr ali  28  243SGPCQHGGQCLQRSDHAEGFLCRCPPGFEGDECDVDVDE. 299