current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

d2i9aa1
Query: d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}, from SCOP175

Results of PSI-BLAST search in nr85s
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# E-value Template Links and tools%idFirst NCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTLast
1 1.000e-13gi|405973659|gb|EKC38360.1| Cartilage matrix protein, partial [Crassostrea gigas]  clstr ali  38  142SNPCQNGGTCSN---GNNQYTCTCLPGWTGSNCEIDIDE. 177
2 3.000e-12gi|556747303|ref|XP_005985933.1| PREDICTED: LOW QUALITY PROTEIN: MCF.2 cell line derived transforming sequence-like [Pantholops hodgsonii]  clstr ali  39 1280SSPCQNGGSCEDQLQ---AYICFCPDGFEGRNCETD.... 1312
3 3.000e-12gi|507640740|ref|XP_004701473.1| PREDICTED: urokinase-type plasminogen activator [Echinops telfairi]  clstr ali  70  30NCTCLNGGTCVSYKHFSHIQRCHCPKNFQGEHCEIDTLKT 69
4 4.000e-12gi|585176309|ref|XP_006739931.1| PREDICTED: slit homolog 2 protein-like, partial [Leptonychotes weddellii]  clstr ali  31  623SNPCQHGGTCHLKEGEKDGFWCICADGFEGENCEVNVD.. 660
5 6.000e-12gi|594057035|ref|XP_006052703.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Bubalus bubalis]  clstr ali  75  78NCGCLNGGKCVTYKYFSNIQRCSCPKKFQGEHCEIDTSKT 117
6 3.000e-11gi|313676|emb|CAA25806.1| pot. pro-plasminogen activator [Sus scrofa]  clstr ali  75  32NCGCLNGGKCVSYKYFSNIQRCSCPKKFQGEHCEIDTSQT 71
7 3.000e-11gi|195376839|ref|XP_002047200.1| GJ13308 [Drosophila virilis]  clstr ali  54  581NNHCFHGGTCM-LLPFLNIYYCNCPEGFTGQRCE...... 613
8 5.000e-11gi|641658202|ref|XP_008180635.1| PREDICTED: cubilin-like [Acyrthosiphon pisum]  clstr ali  44  50SNPCQNGGTCVDLY---NGFQCNCPNNWQGKMCELDVDE. 85
9 6.000e-11gi|612045201|ref|XP_007501313.1| PREDICTED: coagulation factor VII isoform X2 [Monodelphis domestica]  clstr ali  45  92SNPCQNGGTCVDQFQ---SYICFCPARFEGRNCETDKD.. 126
10 7.000e-11gi|537270935|gb|ERE91955.1| urokinase-type plasminogen activator-like protein [Cricetulus griseus]  clstr ali  70  48NCGCQNGGICVSYKYFSSIRRCSCPKRFQGEHCEIDTSKT 87
11 8.000e-11gi|507548357|ref|XP_004658004.1| PREDICTED: urokinase-type plasminogen activator [Jaculus jaculus]  clstr ali  77  31NCGCLNGGTCVTYKYFSHILRCSCPKKFQGEHCEIDKSKT 70
12 8.000e-11gi|642924126|ref|XP_008194016.1| PREDICTED: neural-cadherin isoform X1 [Tribolium castaneum]  clstr ali  46 2798..PCLNGGTCVNLEPRFR-YRCHCPDGFWGENCEL..... 2829
13 9.000e-11gi|403273068|ref|XP_003928348.1| PREDICTED: coagulation factor VII [Saimiri boliviensis boliviensis]  clstr ali  37  179SSPCQNGGSCEDQLQ---SYICFCPLGFEGRNCETNKD.. 213
14 9.000e-11gi|334346827|ref|XP_001374277.2| PREDICTED: coagulation factor VII isoform X1 [Monodelphis domestica]  clstr ali  45  92SNPCQNGGTCVDQFQ---SYICFCPARFEGRNCETDKD.. 126
15 1.000e-10gi|554540138|ref|XP_005864719.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Myotis brandtii]  clstr ali  80  32SCGCLNGGTCVSYKYFSNIHRCNCPKKFQGEHCEIDTSAT 71
16 1.000e-10gi|432106779|gb|ELK32431.1| Urokinase-type plasminogen activator [Myotis davidii]  clstr ali  80  29SCGCLNGGTCVSYKYFSNIHRCNCPKKFQGEHCEIDTSAT 68
17 1.000e-10gi|564389932|ref|XP_006253491.1| PREDICTED: coagulation factor VII isoform X1 [Rattus norvegicus]  clstr ali  38  77SNPCQNGGTCQDHLK---SYVCFCPLDFEGRNCEKNKNE. 112
18 1.000e-10gi|149414214|ref|XP_001510562.1| PREDICTED: urokinase-type plasminogen activator [Ornithorhynchus anatinus]  clstr ali  65  36.CHCQNGGECVSYKLFSRIHRCNCPKGFEGEHCEIDSQE. 73
19 1.000e-10gi|532049887|ref|XP_005367711.1| PREDICTED: urokinase-type plasminogen activator [Microtus ochrogaster]  clstr ali  75  35NCGCLNGGICVSYKYFSSIRRCNCPKRFQGEHCEIDTSKT 74
20 1.000e-10gi|617589769|ref|XP_007520446.1| PREDICTED: urokinase-type plasminogen activator [Erinaceus europaeus]  clstr ali  75  30NCYCLNGGTCVFYKYFSNIHRCNCPRNFEGEHCEIESSKT 69
21 1.000e-10gi|6679377|ref|NP_032899.1| urokinase-type plasminogen activator precursor [Mus musculus]  clstr ali  70  31NCGCQNGGVCVSYKYFSRIRRCSCPRKFQGEHCEIDASKT 70
22 1.000e-10gi|602714709|ref|XP_007467567.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Lipotes vexillifer]  clstr ali  79  33.CGCLNGGKCVSYKYFSNIQRCNCPKKFQGEHCEIDTSKT 71
23 2.000e-10gi|545494833|ref|XP_005618919.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Canis lupus familiaris]  clstr ali  82  142NCSCLNGGTCVSYKYFSNIQRCNCPKKFQGEHCEIDTSKT 181
24 2.000e-10gi|548488963|ref|XP_005687848.1| PREDICTED: coagulation factor VII [Capra hircus]  clstr ali  39  103SSPCQNGGSCEDQLQ---AYICFCPDGFEGRNCETD.... 135
25 2.000e-10gi|528972008|ref|XP_005214051.1| PREDICTED: coagulation factor VII isoform X1 [Bos taurus]  clstr ali  39  96SSPCQNGGSCEDQLR---SYICFCPDGFEGRNCETD.... 128
26 2.000e-10gi|326923580|ref|XP_003208013.1| PREDICTED: urokinase-type plasminogen activator-like [Meleagris gallopavo]  clstr ali  52  40.CHCLNGGTCITYQFFSQMKRCLCPEGYGGLHCEIDTDS. 77
27 2.000e-10gi|254692796|ref|NP_001157065.1| urokinase-type plasminogen activator precursor [Ovis aries]  clstr ali  72  32DCGCLNGGKCVSYKYFSNIQRCSCPKKFQGEYCEIDTSKT 71
28 2.000e-10gi|505843936|ref|XP_004615464.1| PREDICTED: urokinase-type plasminogen activator [Sorex araneus]  clstr ali  70  32DCGCLNGGTCVSYKHFSYIRGCLCPSKFEGEHCEIDTSKT 71
29 2.000e-10gi|395501552|ref|XP_003755157.1| PREDICTED: urokinase-type plasminogen activator [Sarcophilus harrisii]  clstr ali  60  30DCGCLNNGVCISYKYF-KIHRCSCPENFIGEHCEIDISQ. 67
30 3.000e-10gi|119608837|gb|EAW88431.1| coagulation factor IX (plasma thromboplastic component, Christmas disease, hemophilia B), isoform CRA_a [Homo sapiens] :_  clstr ali  44  99SNPCLNGGSCKDDI---NSYECWCPFGFEGKNCELDV... 132
31 3.000e-10gi|397482274|ref|XP_003812356.1| PREDICTED: coagulation factor IX [Pan paniscus]  clstr ali  44  99SNPCLNGGSCKDDI---NSYECWCPFGFEGKNCELDV... 132
32 3.000e-10gi|504142458|ref|XP_004583665.1| PREDICTED: urokinase-type plasminogen activator [Ochotona princeps]  clstr ali  72  32HCSCLNGGKCVSYKYFSNIWRCDCPKNFQGEHCEIDKSTT 71
33 3.000e-10gi|533151554|ref|XP_005389993.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Chinchilla lanigera]  clstr ali  70  52NCGCLNGGICVSYKYFSSMRRCSCPKKFQGEHCEIDTAKT 91
34 4.000e-10gi|507644906|ref|XP_004631267.1| PREDICTED: coagulation factor VII [Octodon degus]  clstr ali  36  101SNPCQNGGTCQDHHQL---YICFCLLGFSGRNCETN.... 133
35 4.000e-10gi|587004568|ref|XP_006937958.1| PREDICTED: urokinase-type plasminogen activator [Felis catus]  clstr ali  80  32NCGCLNGGTCVSYKYFSNIQRCSCPKKFQGEHCEIDTSKT 71
36 4.000e-10gi|344274298|ref|XP_003408954.1| PREDICTED: urokinase-type plasminogen activator-like [Loxodonta africana]  clstr ali  82  13NCSCLNGGTCVSYKYFSNIQRCNCPKKFQGEHCEIDTSKT 52
37 4.000e-10gi|637319501|ref|XP_008112480.1| PREDICTED: urokinase-type plasminogen activator [Anolis carolinensis]  clstr ali  54  41.CNCLNGGTCITYHLFSRMKRCVCPEGYSGDHCEID.... 75
38 4.000e-10gi|402880412|ref|XP_003903795.1| PREDICTED: urokinase-type plasminogen activator isoform 1 [Papio anubis]  clstr ali  90  29DCGCLNGGTCMSNKYFSSIHWCNCPKKFGGQHCEIDKSKT 68
39 5.000e-10gi|507617972|ref|XP_004624442.1| PREDICTED: urokinase-type plasminogen activator [Octodon degus]  clstr ali  80  31NCGCLNGGTCVSYKYFSNMQRCNCPKKFQGEHCEIDTSKT 70
40 5.000e-10gi|532080386|ref|XP_005325952.1| PREDICTED: urokinase-type plasminogen activator [Ictidomys tridecemlineatus]  clstr ali  80  31NCGCLNGGTCVSYKYFSNIRRCICPKKFQGEHCEIDTSKT 70
41 5.000e-10gi|113205804|ref|NP_001038056.1| coagulation factor VII precursor [Sus scrofa]  clstr ali  39  90SNPCLNGGSCEDQLQ---AYICFCPEGFEGRNCETN.... 122
42 5.000e-10gi|529419880|ref|XP_005229802.1| PREDICTED: urokinase-type plasminogen activator [Falco peregrinus]  clstr ali  48  40.CHCLNGGTCITYYLFRGIIRCICPEGYTGTHCELDVD.. 76
43 5.000e-10gi|351714573|gb|EHB17492.1| Urokinase-type plasminogen activator [Heterocephalus glaber]  clstr ali  69  32.CGCLNGGSCVTYKYFSGIRRCNCPKRFQGEHCEIDAWKT 70
44 6.000e-10gi|634847512|ref|XP_007938789.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Orycteropus afer afer]  clstr ali  80  32NCGCLNGGTCVSYKYFSNIQRCKCPKKFQGEHCEIDTSKT 71
45 6.000e-10gi|459175936|ref|XP_004226011.1| PREDICTED: E-selectin-like [Ciona intestinalis]  clstr ali  46  157SSPCLNGGTCS---RGPNAYTCFCPLGYTGRNCEI..... 188
46 7.000e-10gi|260791920|ref|XP_002590975.1| hypothetical protein BRAFLDRAFT_69474 [Branchiostoma floridae]  clstr ali  37  274SNPCQNGGMCSDGL---NSYVCHCTAGFEGDNCETDMD.. 308
47 7.000e-10gi|537228294|gb|ERE83561.1| versican core protein-like isoform 1 [Cricetulus griseus]  clstr ali  38 3109SNPCRNGATCVD---GFNTFRCLCLPSYTGALCEQDT-ET 3144
48 8.000e-10gi|562862928|ref|XP_006159748.1| PREDICTED: coagulation factor VII [Tupaia chinensis]  clstr ali  33  90SNPCQNGGSCQDQLQ---SYICFCRAGFEGRNCETN.... 122
49 8.000e-10gi|118403542|ref|NP_001072819.1| coagulation factor VII precursor [Xenopus (Silurana) tropicalis]  clstr ali  39  114SNPCMNGGTCFDQHQ---SYICTCPMGYEGRHCETN.... 146
50 8.000e-10gi|119608840|gb|EAW88434.1| coagulation factor IX (plasma thromboplastic component, Christmas disease, hemophilia B), isoform CRA_d [Homo sapiens] :_  clstr ali  44  99SNPCLNGGSCKDDI---NSYECWCPFGFEGKNCELDV... 132
51 8.000e-10gi|632961858|ref|XP_007896991.1| PREDICTED: neurocan core protein [Callorhinchus milii]  clstr ali  39 1446.NPCQNGATCVDGI---NSFTCLCLPSYTGSLCEEDT... 1478
52 8.000e-10gi|529432899|ref|XP_005236239.1| PREDICTED: versican core protein [Falco peregrinus]  clstr ali  36 3282SNPCRNGATCIDGL---NTFTCLCLPSYTGALCEQDT-ET 3317
53 8.000e-10gi|541986183|ref|XP_005444584.1| PREDICTED: versican core protein [Falco cherrug]  clstr ali  36 3212SNPCRNGATCIDGL---NTFTCLCLPSYTGALCEQDT-ET 3247
54 8.000e-10gi|637357393|ref|XP_008119511.1| PREDICTED: tissue-type plasminogen activator [Anolis carolinensis]  clstr ali  51  91...CFNGGRCQQPLYSSNLFICLCPPGFSGKHCEIDAKAT 127
55 9.000e-10gi|562885273|ref|XP_006170097.1| PREDICTED: urokinase-type plasminogen activator [Tupaia chinensis]  clstr ali  80  36NCGCLNGGTCVSYKFFSNIRRCNCPKKFQGEHCEIDTSKT 75
56 9.000e-10gi|530564439|ref|XP_005278798.1| PREDICTED: urokinase-type plasminogen activator [Chrysemys picta bellii]  clstr ali  59  40DCNCVNGGTCISYQLFSRINRCLCPKGYSGQHCEIDT... 76
57 1.000e-09gi|586456827|ref|XP_006851610.1| PREDICTED: coagulation factor VII [Chrysochloris asiatica]  clstr ali  37  92SDPCQNGGSCEDQLQ---SYICFCPQGFEGRNCETNKN.. 126
58 1.000e-09gi|514476174|ref|XP_003477550.2| PREDICTED: coagulation factor VII [Cavia porcellus]  clstr ali  36  92SNPCQNGGTCQDDFRL---YICFCLPNFSGRNCETN.... 124
59 1.000e-09gi|405974181|gb|EKC38847.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Crassostrea gigas]  clstr ali  37  60SNPCQNGATCVDEL---NRYSCTCQPGYQGTNCET..... 91
60 1.000e-09gi|524995909|ref|XP_005045753.1| PREDICTED: LOW QUALITY PROTEIN: coagulation factor IX [Ficedula albicollis]  clstr ali  40  93.NPCQNGAVCKDQI---NSYVCWCPAGYEGKNCEID.... 124
61 1.000e-09gi|344240198|gb|EGV96301.1| Slit-like 3 protein [Cricetulus griseus]  clstr ali  37  205.NPCQHGGTCHLSENHKDGFSCSCPLGFEGQRCEINPD.. 241
62 1.000e-09gi|560123202|emb|CDJ92166.1| EGF and EGF calcium-binding and CUB domain containing protein [Haemonchus contortus]  clstr ali  37  24..PCQHGGTCLPR--FGKKYNCLCPPYRTGENCEVDIDE. 58
63 1.000e-09gi|507942138|ref|XP_004681118.1| PREDICTED: urokinase-type plasminogen activator [Condylura cristata]  clstr ali  77  32NCGCQNGGTCVHYKYFSNIHRCNCPKRFEGEHCEIDRSKT 71
64 1.000e-09gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Gallus gallus]  clstr ali  38 1020SSPCQNGGTCIDEV---NAFVCLCLPSYSGSRCEKDT... 1053
65 2.000e-09gi|585665263|ref|XP_006887626.1| PREDICTED: urokinase-type plasminogen activator [Elephantulus edwardii]  clstr ali  74  45.CGCLNGGTCVSYKYFSGIQRCHCPTKFQGEHCEIDTSKT 83
66 2.000e-09gi|22090636|dbj|BAC06838.1| Pf2-cadherin [Ptychodera flava]  clstr ali  46  459SDPCLNGGECIDGV---NGYICVCPPGFSGIHCEL..... 490
67 2.000e-09gi|431839286|gb|ELK01213.1| Protein delta like protein 1 [Pteropus alecto]  clstr ali  40  58SSPCQHGGTCVDEDGRASHASCLCPPGFSGNFCEI..... 92
68 2.000e-09gi|488568418|ref|XP_004473837.1| PREDICTED: urokinase-type plasminogen activator isoform 1 [Dasypus novemcinctus]  clstr ali  76  33.CGCLNGGTCVSYKYFSNIQRCNCPKNFQGEHCEIDASQT 71
69 2.000e-09gi|607365189|gb|EZA59389.1| Cubilin [Cerapachys biroi]  clstr ali  30  202SNPCQNGGTCEDLY---DGYQCHCTSNWEGPNCMTDVNE. 237
70 2.000e-09gi|472385901|ref|XP_004412308.1| PREDICTED: coagulation factor VII isoform 1 [Odobenus rosmarus divergens]  clstr ali  36  92SNPCRNGGTCEDQFQ---SYICFCLDGFQGRNCETN.... 124
71 2.000e-09gi|527269437|ref|XP_005152724.1| PREDICTED: urokinase-type plasminogen activator [Melopsittacus undulatus]  clstr ali  52  41.CHCLNGGTCITYYLFSGINRCICPEGYTGINCEIDT... 76
72 2.000e-09gi|156345300|ref|XP_001621318.1| hypothetical protein NEMVEDRAFT_v1g145311 [Nematostella vectensis]  clstr ali  47  78.CPCQNGGTCYPHPYGSGQYECACPKGFNGSRCEINIDE. 118
73 2.000e-09gi|507985677|ref|XP_004695699.1| PREDICTED: coagulation factor VII [Condylura cristata]  clstr ali  37  26SNPCQNGGSCQDQLQ---SYLCFCPQDFEGRNCETNKD.. 60
74 2.000e-09gi|591313230|ref|XP_007083070.1| PREDICTED: delta and Notch-like epidermal growth factor-related receptor-like [Panthera tigris altaica]  clstr ali  37  60SNPCHHAGTCLDQ---PNGYTCHCPHGWVGANCEI..... 91
75 2.000e-09gi|426236925|ref|XP_004012414.1| PREDICTED: coagulation factor VII [Ovis aries]  clstr ali  40  113.SPCQNGGSCEDQLQ---AYICFCPDGFEGRNCETD.... 144
76 2.000e-09gi|585644498|ref|XP_006881894.1| PREDICTED: coagulation factor IX [Elephantulus edwardii]  clstr ali  38  99SNPCLHGGMCKDGI---NSYECWCQPGFEGKNCELDV... 132
77 2.000e-09gi|390457552|ref|XP_002742598.2| PREDICTED: coagulation factor VII [Callithrix jacchus]  clstr ali  34  76SSPCQNGGSCEDQFQ---SYICFCLLGFEGRNCETNKD.. 110
78 2.000e-09gi|465984463|gb|EMP36560.1| Fibulin-7 [Chelonia mydas]  clstr ali  41  192SNPCQNGGTCVDGI---NQYKCTCPQGWTGENCQ...... 222
79 2.000e-09gi|405973660|gb|EKC38361.1| Versican core protein [Crassostrea gigas]  clstr ali  38  20SNSCQNGGTCHN---GNNQYTCSCLPGWTGTNCEIDIDE. 55
80 2.000e-09gi|530422392|ref|XP_005262454.1| PREDICTED: coagulation factor IX isoform X2 [Homo sapiens]  clstr ali  43  99SNPCLNGGSCKDDI---NSYECWCPFGFEGKNCEL..... 130
81 2.000e-09gi|532111341|ref|XP_005340367.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Ictidomys tridecemlineatus]  clstr ali  51  95ESRCFNGGTCWQAIYFSD-FVCQCPEGFAGKRCEIDTSAT 133
82 2.000e-09gi|543717759|ref|XP_005500129.1| PREDICTED: urokinase-type plasminogen activator [Columba livia]  clstr ali  50  39ECHCLNGGTCITYYLFSRINRCICPDRYFGIHCELDADST 78
83 2.000e-09gi|557007638|ref|XP_006005097.1| PREDICTED: urokinase-type plasminogen activator-like [Latimeria chalumnae]  clstr ali  58  39.CDCLNGGSCVRHEYFPTYSYCLCPKGFSGRHCETDT... 74
84 2.000e-09gi|560133881|emb|CDJ85880.1| Cadherin and Laminin G and EGF domain containing protein, partial [Haemonchus contortus]  clstr ali  40 2194EAPCRNGGTCQ---VIDKTYQCTCPPRYSGANCEIDMD.. 2228
85 3.000e-09gi|348575754|ref|XP_003473653.1| PREDICTED: urokinase-type plasminogen activator [Cavia porcellus]  clstr ali  75  29NCGCLNGGTCVSYKYFSSMQRCSCPKKFQGEHCEIDASKT 68
86 3.000e-09gi|260826540|ref|XP_002608223.1| hypothetical protein BRAFLDRAFT_87876 [Branchiostoma floridae]  clstr ali  40  294SSPCQNGGQCIDDV---NSFRCRCPTGYSGDLCEIDID.. 328
87 3.000e-09gi|514728917|ref|XP_005015757.1| PREDICTED: urokinase-type plasminogen activator isoform X1 [Anas platyrhynchos]  clstr ali  58  36.CHCLNGGTCVTYYLFSRINRCLCPEGYGGLHCEIDDDST 74
88 3.000e-09gi|573903274|ref|XP_006639360.1| PREDICTED: coagulation factor VII-like [Lepisosteus oculatus]  clstr ali  37  99SNPCQNNGTCVNS---QDAYTCFCPEGFNGRNCEEAIEDT 135
89 3.000e-09gi|554586139|ref|XP_005884494.1| PREDICTED: coagulation factor VII isoform X1 [Myotis brandtii]  clstr ali  37  96SNPCQNGGSCEDQLQ---SYICFCPEDFEGRNCETNKN.. 130
90 3.000e-09gi|568281157|gb|ETN73999.1| EGF-like domain protein [Necator americanus]  clstr ali  37  108SKPCQHGGTCLPR--FGNKYNCLCPSYRSGDNCEEDVDE. 144
91 3.000e-09gi|585652120|ref|XP_006884017.1| PREDICTED: coagulation factor VII [Elephantulus edwardii]  clstr ali  42  92SNPCQNGGTCMDQLQ---SYICFCLEEFEGRNCEIDKN.. 126
92 3.000e-09gi|543351134|ref|XP_005520577.1| PREDICTED: urokinase-type plasminogen activator [Pseudopodoces humilis]  clstr ali  48  39.CSCLNGGTCITYYLFSGIGRCICPDGYTGIYCELDTDST 77
93 3.000e-09gi|164419019|gb|ABY54817.1| c-type lectin [Branchiostoma japonicum]  clstr ali  36  147SAPCHNGATCQD---GANSLTCRCAPGYTGIHCETDIDE. 182
94 3.000e-09gi|395820478|ref|XP_003783592.1| PREDICTED: urokinase-type plasminogen activator isoform 1 [Otolemur garnettii]  clstr ali  72  30NCGCLNGGTCVTYKHFSNIRRCICPKKFQGEHCEIDTAKT 69
95 3.000e-09gi|617455395|ref|XP_007570093.1| PREDICTED: neurocan core protein-like isoform X1 [Poecilia formosa]  clstr ali  42 1083SNPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKD.... 1115
96 3.000e-09gi|478492167|ref|XP_004420448.1| PREDICTED: versican core protein isoform 1 [Ceratotherium simum simum]  clstr ali  36 3137SNPCRNGATCID---GFNTFRCLCLPSYVGALCEQD-NET 3172
97 3.000e-09gi|395857515|ref|XP_003801137.1| PREDICTED: tissue-type plasminogen activator [Otolemur garnettii]  clstr ali  52  187...CFNGGTCWQALYFS-HFVCQCPEGFTGTRCEIDARAT 222
98 3.000e-09gi|471397455|ref|XP_004382139.1| PREDICTED: tissue-type plasminogen activator [Trichechus manatus latirostris]  clstr ali  52  91...CFNGGTCRQALYFSD-FVCQCPEGFTGKRCEIDTKAT 126
99 3.000e-09gi|597885280|gb|EYC34639.1| hypothetical protein Y032_0001g68 [Ancylostoma ceylanicum]  clstr ali  40 3937EAPCTNGGTC---HVIGRTYQCTCPARYTGANCEIDSD.. 3971
100 4.000e-09gi|512869075|ref|XP_004891865.1| PREDICTED: coagulation factor IX [Heterocephalus glaber]  clstr ali  46  99SNPCLNGGSCKDDI---NAYECWCPLGFEGQNCEL..... 130
101 4.000e-09gi|47226544|emb|CAG08560.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  45  7.SHCYNGGTCKEAVYTSD-YICQCPPGFSGTHCEINTQE. 43
102 4.000e-09gi|309363588|emb|CAP26454.2| Protein CBG05891 [Caenorhabditis briggsae]  clstr ali  29 1017..PCQNGGECEDIIGPPNSYNCTCTPQWTGTNCTTDVDE. 1053
103 4.000e-09gi|597745136|ref|XP_007234607.1| PREDICTED: versican core protein-like [Astyanax mexicanus]  clstr ali  45 1193.NPCLNGGTCVDGV---NSFSCVCLPSYTGALCEQDT-ET 1227
104 4.000e-09gi|620941277|ref|XP_007654267.1| PREDICTED: versican core protein isoform X1 [Ornithorhynchus anatinus]  clstr ali  38 3271SNPCRNGATCVDGI---NTFTCLCLPSYVGALCEQDT-ET 3306
105 4.000e-09gi|558177120|ref|XP_006126415.1| PREDICTED: urokinase-type plasminogen activator [Pelodiscus sinensis]  clstr ali  63  40DCNCLNGGTCISYQLFSRINRCLCPKEYTGQHCEID.... 75
106 4.000e-09gi|270008137|gb|EFA04585.1| cadherin-N [Tribolium castaneum]  clstr ali  46  842..PCLNGGTCVNLEPRFR-YRCHCPDGFWGENCEL..... 873
107 5.000e-09gi|308453821|ref|XP_003089596.1| hypothetical protein CRE_30572 [Caenorhabditis remanei]  clstr ali  32  857..PCQNGGECEDIIGPPNSYNCTCTPQWTGTNCTIDVDE. 893
108 5.000e-09gi|507687448|ref|XP_004641029.1| PREDICTED: versican core protein [Octodon degus]  clstr ali  38 3229SNPCRNGATCVD---GFNTFRCLCLPSYVGSLCEQDT-ET 3264
109 5.000e-09gi|585649367|ref|XP_006814375.1| PREDICTED: uncharacterized protein LOC102805267 [Saccoglossus kowalevskii]  clstr ali  41  113.NPCQNNGTCLEDY---GYYRCQCPYGFTGYDCETDIS.. 146
110 5.000e-09gi|431902225|gb|ELK08726.1| Tissue-type plasminogen activator [Pteropus alecto]  clstr ali  55  110...CFNGGTCRQALYFSD-FVCQCPEGFSGKLCEIDASAT 145
111 5.000e-09gi|565313756|gb|ETE66008.1| Urokinase-type plasminogen activator, partial [Ophiophagus hannah]  clstr ali  55  1.CGCLNGGTCLTYGLFSQIKFCLCPEGYDGDHCEIDV... 36
112 6.000e-09gi|617625093|ref|XP_007528316.1| PREDICTED: coagulation factor IX [Erinaceus europaeus]  clstr ali  40  92SNPCLNGGLCKDDI---NSYECWCKEGFEGRNCEL--DET 126
113 6.000e-09gi|47226546|emb|CAG08562.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  45  38.SHCYNGGTCKEAVYTSD-YICQCPPGFSGTHCEINTQE. 74
114 6.000e-09gi|617436128|ref|XP_007563499.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Poecilia formosa]  clstr ali  48  114...CYNGGTCKEAVYSSN-YICQCPPGFSGAQCEINTNE. 148
115 6.000e-09gi|528516137|ref|XP_005170575.1| PREDICTED: neurocan core protein [Danio rerio]  clstr ali  41  993SNPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 1026
116 6.000e-09gi|1351379|sp|P98119.1|URT1_DESRO RecName: Full=Salivary plasminogen activator alpha 1; AltName: Full=DSPA alpha-1; Flags: Precursor [Desmodus rotund  clstr ali  47  92...CFNGGTCWQAVYFSD-FVCQCPAGYTGKRCEVDTRAT 127
117 6.000e-09gi|507946875|ref|XP_004682333.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Condylura cristata]  clstr ali  52  90...CFNGGTCWQALYFSD-FVCQCPEGFVGKRCEIDTRAT 125
118 7.000e-09gi|45383468|ref|NP_989674.1| coagulation factor IX precursor [Gallus gallus]  clstr ali  39  92SNPCKNGAVCKDGV---SSYECMCPPGYGGRNCEID.... 124
119 7.000e-09gi|344272704|ref|XP_003408171.1| PREDICTED: versican core protein isoform 1 [Loxodonta africana]  clstr ali  38 3124SNPCRNGATCVD---GFNTFTCLCLPSYVGALCEQDT-ET 3159
120 7.000e-09gi|488596647|ref|XP_004483499.1| PREDICTED: versican core protein [Dasypus novemcinctus]  clstr ali  38 3107SNPCRNGATCVD---GFNTFRCLCLPSYVGALCERDT-ET 3142
121 7.000e-09gi|585673837|ref|XP_006889930.1| PREDICTED: versican core protein precursor isoform X1 [Elephantulus edwardii]  clstr ali  38 3094SNPCRNGATCVD---GFNTFTCLCLPSYVGALCEQDT-ET 3129
122 7.000e-09gi|557276309|ref|XP_006021306.1| PREDICTED: versican core protein [Alligator sinensis]  clstr ali  38 3346SNPCRNGATCVDGI---NTFICLCLPSYVGALCERDT-ET 3381
123 8.000e-09gi|260824241|ref|XP_002607076.1| hypothetical protein BRAFLDRAFT_68133 [Branchiostoma floridae]  clstr ali  34  443SNPCQHGGTCHDRI---NSYVCHCQSGYTGDNCET..... 474
124 8.000e-09gi|532059655|ref|XP_005315718.1| PREDICTED: versican core protein isoform X1 [Ictidomys tridecemlineatus]  clstr ali  38 3135SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3170
125 8.000e-09gi|62088562|dbj|BAD92728.1| chondroitin sulfate proteoglycan 2 (versican) variant [Homo sapiens]  clstr ali  38 3147SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3182
126 8.000e-09gi|634875255|ref|XP_007948735.1| PREDICTED: versican core protein isoform X1 [Orycteropus afer afer]  clstr ali  36 3135SNPCRNGATCID---GFNTFTCLCLPSYVGALCERDT-ET 3170
127 8.000e-09gi|591306270|ref|XP_007079840.1| PREDICTED: versican core protein isoform X1 [Panthera tigris altaica]  clstr ali  38 3136SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3171
128 8.000e-09gi|560904684|ref|XP_006178701.1| PREDICTED: versican core protein isoform X1 [Camelus ferus]  clstr ali  38 3133SNPCRNGATCVD---GFNTFRCLCLPSYIGALCERDT-ET 3168
129 8.000e-09gi|548461902|ref|XP_005678918.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1, partial [Capra hircus]  clstr ali  46  153ENPCQNGGTCVPGE---DAHSCDCSPGFKGRHCEL..... 184
130 8.000e-09gi|584036621|ref|XP_006765598.1| PREDICTED: tissue-type plasminogen activator [Myotis davidii]  clstr ali  58  92...CFNGGTCRQALYFSN-FVCQCPEGFSGQLCEIDARAT 127
131 8.000e-09gi|195579808|ref|XP_002079751.1| GD21853 [Drosophila simulans]  clstr ali  37 1178..PCMNGATCINLEPRLR-YRCICPDGFWGENCEL..... 1209
132 9.000e-09gi|444706127|gb|ELW47487.1| Coagulation factor VII [Tupaia chinensis]  clstr ali  33  66SNPCQNGGSCQDQLQ---SYICFCRAGFEGRNCETN.... 98
133 9.000e-09gi|291394978|ref|XP_002713921.1| PREDICTED: versican [Oryctolagus cuniculus]  clstr ali  38 3109SNPCRNGATCVD---GFNTFRCLCLPSYVGVLCEQDT-ET 3144
134 9.000e-09gi|195344746|ref|XP_002038940.1| GM17110 [Drosophila sechellia]  clstr ali  37 1698..PCLNGATCINLEPRLR-YRCICPEGYWGENCEL..... 1729
135 1.000e-08gi|542207765|ref|XP_005477188.1| PREDICTED: protein delta homolog 1-like isoform X2 [Oreochromis niloticus]  clstr ali  37  152.SPCQNGGTCMDAEGSAAFSSCLCPPGFSGDFCEIGID.. 188
136 1.000e-08gi|326924365|ref|XP_003208399.1| PREDICTED: coagulation factor IX-like [Meleagris gallopavo]  clstr ali  39  92SNPCKNGAMCKDGV---SSYECMCPPGYGGRNCEID.... 124
137 1.000e-08gi|557261616|ref|XP_006016364.1| PREDICTED: urokinase-type plasminogen activator [Alligator sinensis]  clstr ali  60  41.CNCLNGGTCISYLLFSGISRCSCPNGYSGNHCEID-SET 78
138 1.000e-08gi|432906540|ref|XP_004077580.1| PREDICTED: fibulin-7-like [Oryzias latipes]  clstr ali  38  146SNPCQNGGTCVEGV---NHYRCTCPQSWSGSHCQTDVNE. 185
139 1.000e-08gi|612006466|ref|XP_007487407.1| PREDICTED: versican core protein isoform X1 [Monodelphis domestica]  clstr ali  38 3187SNPCRNGATCVD---GFNTFTCLCLPSYVGALCEQDT-ET 3222
140 1.000e-08gi|533135044|ref|XP_005382409.1| PREDICTED: versican core protein [Chinchilla lanigera]  clstr ali  38 3066SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3101
141 1.000e-08gi|586480267|ref|XP_006870659.1| PREDICTED: versican core protein isoform X1 [Chrysochloris asiatica]  clstr ali  38 3118SNPCRNGATCVD---GFNTFTCLCLPSYIGALCEQDT-ET 3153
142 1.000e-08gi|521036766|gb|EPQ18544.1| Versican core protein [Myotis brandtii]  clstr ali  38 3144SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3179
143 1.000e-08gi|558168174|ref|XP_006124431.1| PREDICTED: versican core protein [Pelodiscus sinensis]  clstr ali  35 3349SNPCRNGATCIDGL---NTFTCLCLPSYVGALCEKDT... 3382
144 1.000e-08gi|395825586|ref|XP_003786008.1| PREDICTED: versican core protein [Otolemur garnettii]  clstr ali  36 3090SNPCRNGATCID---GFNTFRCLCLPSYVGALCEQDT-ET 3125
145 1.000e-08gi|586559970|ref|XP_006913259.1| PREDICTED: versican core protein [Pteropus alecto]  clstr ali  38 3081SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3116
146 1.000e-08gi|504147732|ref|XP_004586278.1| PREDICTED: versican core protein isoform X1 [Ochotona princeps]  clstr ali  38 3093SNPCRNGATCVD---GFNTFSCLCLPSYVGVLCEQDT-ET 3128
147 1.000e-08gi|348587520|ref|XP_003479515.1| PREDICTED: LOW QUALITY PROTEIN: versican core protein [Cavia porcellus]  clstr ali  38 3088SNPCRNGATCVD---GFNTFRCLCLPSYIGALCEQDT-ET 3123
148 1.000e-08gi|562827883|ref|XP_006143545.1| PREDICTED: versican core protein isoform X2 [Tupaia chinensis]  clstr ali  38 3113SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3148
149 1.000e-08gi|330340395|ref|NP_001193358.1| versican core protein precursor [Sus scrofa]  clstr ali  38 3119SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3154
150 1.000e-08gi|593721994|ref|XP_007107224.1| PREDICTED: versican core protein isoform X1 [Physeter catodon]  clstr ali  38 3133SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3168
151 1.000e-08gi|640802839|ref|XP_008057762.1| PREDICTED: versican core protein isoform X1 [Tarsius syrichta]  clstr ali  36 3132SNPCRNGATCID---GFNTFRCLCLPSYVGALCEQDT-ET 3167
152 1.000e-08gi|402872034|ref|XP_003899948.1| PREDICTED: LOW QUALITY PROTEIN: versican core protein [Papio anubis]  clstr ali  38 3061SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3096
153 1.000e-08gi|507934504|ref|XP_004678485.1| PREDICTED: versican core protein [Condylura cristata]  clstr ali  38 2981SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3016
154 1.000e-08gi|471414722|ref|XP_004388895.1| PREDICTED: versican core protein isoform 1 [Trichechus manatus latirostris]  clstr ali  36 3143SNPCRNGATCID---GFNTFTCLCLPSYVGALCEQDT-ET 3178
155 1.000e-08gi|148668663|gb|EDL00982.1| mCG116562, isoform CRA_b [Mus musculus]  clstr ali  38 3150SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3185
156 1.000e-08gi|507649785|ref|XP_004703706.1| PREDICTED: versican core protein [Echinops telfairi]  clstr ali  36 3128SNPCRNGATCIDGL---NTFSCLCLPSYVGALCEQDT-ET 3163
157 1.000e-08gi|589935513|ref|XP_006980528.1| PREDICTED: versican core protein isoform X1 [Peromyscus maniculatus bairdii]  clstr ali  38 3109SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3144
158 1.000e-08gi|345798621|ref|XP_003434465.1| PREDICTED: versican core protein isoformX2 [Canis lupus familiaris]  clstr ali  38 3138SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3173
159 1.000e-08gi|532027206|ref|XP_005356579.1| PREDICTED: versican core protein isoform X1 [Microtus ochrogaster]  clstr ali  38 3104SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3139
160 1.000e-08gi|426230094|ref|XP_004009116.1| PREDICTED: versican core protein isoform 1 [Ovis aries]  clstr ali  36 3112SNPCRNGATCID---GFNTFRCLCLPSYVGALCEQDT-ET 3147
161 1.000e-08gi|511878463|ref|XP_004759180.1| PREDICTED: versican core protein isoform X1 [Mustela putorius furo]  clstr ali  38 3137SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 3172
162 1.000e-08gi|46048882|ref|NP_990118.1| versican core protein precursor [Gallus gallus]  clstr ali  36 3298SNPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 3333
163 1.000e-08gi|512902059|ref|XP_004899640.1| PREDICTED: tissue-type plasminogen activator [Heterocephalus glaber]  clstr ali  52  90...CFNGGTCRQALYFSD-FVCQCPEGFMGKRCEIDARAT 125
164 1.000e-08gi|499014620|ref|XP_004537828.1| PREDICTED: neural-cadherin-like [Ceratitis capitata]  clstr ali  37 1500..PCLNGATCINLEPRLR-YRCICPEGYWGENCEL..... 1531
165 1.000e-08gi|505796193|ref|XP_004606976.1| PREDICTED: tissue-type plasminogen activator [Sorex araneus]  clstr ali  50  110...CFNGGTCWQPLYFSDFV-CQCPDGFAGKYCEVDTRTT 145
166 1.000e-08gi|405968866|gb|EKC33895.1| hypothetical protein CGI_10026390 [Crassostrea gigas]  clstr ali  48  52...CKNGGTCVESAPCSNSGSCICPENYSGEHCQ...... 82
167 2.000e-08gi|410923004|ref|XP_003974972.1| PREDICTED: tissue-type plasminogen activator-like [Takifugu rubripes]  clstr ali  48  84...CYNGGTCKEAVYTSD-YICQCPTGFSGTHCEINTNE. 118
168 2.000e-08gi|156350060|ref|XP_001622124.1| predicted protein [Nematostella vectensis]  clstr ali  37  143.NPCKNGGTCH--FKSPGVFSCTCAAGFSGNQCETDID.. 177
169 2.000e-08gi|499001273|ref|XP_004554939.1| PREDICTED: neurocan core protein-like isoform X1 [Maylandia zebra]  clstr ali  41 1092SNPCQNGGTCIDEI---NSFVCLCLPSYGGATCE...... 1122
170 2.000e-08gi|542263841|ref|XP_005466557.1| PREDICTED: mucin-17-like, partial [Oreochromis niloticus]  clstr ali  38 1229SNPCRNGGTCVDGLA---SFTCVCLPSYAGLFCE...... 1259
171 2.000e-08gi|602732749|ref|XP_007451766.1| PREDICTED: versican core protein isoform X2 [Lipotes vexillifer]  clstr ali  38 2138SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 2173
172 2.000e-08gi|316980676|dbj|BAJ51987.1| green fluorescnet protein-PG-M/versican (V1) fusion protein [Cloning vector pInSRT-GFPV1]  clstr ali  38 2408SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 2443
173 2.000e-08gi|617548474|ref|XP_007518883.1| PREDICTED: versican core protein [Erinaceus europaeus]  clstr ali  36 3027SNPCRNGATCID---GFNTFRCLCLPSYVGALCEQDT-ET 3062
174 2.000e-08gi|472372398|ref|XP_004405681.1| PREDICTED: versican core protein isoform 2 [Odobenus rosmarus divergens]  clstr ali  38 2137SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 2172
175 2.000e-08gi|21431624|sp|Q9ERB4.2|CSPG2_RAT RecName: Full=Versican core protein; AltName: Full=Chondroitin sulfate proteoglycan core protein 2; Short=Chondroit  clstr ali  38 2475SNPCRNGATCVDGL---NTFRCLCLPSYVGALCEQDT-ET 2510
176 2.000e-08gi|637260072|ref|XP_008101214.1| PREDICTED: versican core protein [Anolis carolinensis]  clstr ali  36 2899SSPCRNGATCIDGV---NTFTCLCLPSYVGALCEKDT-ET 2934
177 2.000e-08gi|525027791|ref|XP_005061318.1| PREDICTED: versican core protein isoform X2 [Ficedula albicollis]  clstr ali  36 2683SNPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 2718
178 2.000e-08gi|449514773|ref|XP_004174660.1| PREDICTED: versican core protein [Taeniopygia guttata]  clstr ali  36 3189SNPCRNGATCIDSL---NTFTCLCLPSYVGALCEQDT-ET 3224
179 2.000e-08gi|465961939|gb|EMP29546.1| Versican core protein [Chelonia mydas]  clstr ali  36 3418SNPCRNGATCIDGL---NLFTCLCLPSYVGALCEQDT-ET 3453
180 2.000e-08gi|530589042|ref|XP_005288216.1| PREDICTED: versican core protein isoform X1 [Chrysemys picta bellii]  clstr ali  36 3213SNPCRNGATCIDGL---NLFTCLCLPSYAGALCEQDT-ET 3248
181 2.000e-08gi|208879560|gb|ACI31317.1| plasminogen activator [Carollia perspicillata]  clstr ali  50  92...CFNGGTCRQLLYFSD-FVCQCPEGYTGKLCEVDASAT 127
182 2.000e-08gi|642123698|emb|CDQ62744.1| unnamed protein product [Oncorhynchus mykiss]  clstr ali  45  87...CYNGGTCKEAVYSSD-FLCQCPPGFTGAQCEINTNE. 121
183 2.000e-08gi|537273593|gb|ERE92477.1| tissue-type plasminogen activator [Cricetulus griseus]  clstr ali  50  165...CFNGGTCQQALYFSD-FVCQCPDGFVGKRCDIDTRAT 200
184 2.000e-08gi|471415775|ref|XP_004389413.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Trichechus manatus latiro  clstr ali  51 1180SCDCLNGGSCVSDINFSGVYLCVCLPGFQGGLCEVDISE. 1221
185 2.000e-08gi|498969091|ref|XP_004547069.1| PREDICTED: tissue-type plasminogen activator-like isoform X1 [Maylandia zebra]  clstr ali  45  114...CYNGGTCKEAVYTSD-YICQCPRGFTGAQCEINTNE. 148
186 2.000e-08gi|541954079|ref|XP_005433255.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Falco cherrug]  clstr ali  48 1218.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 1257
187 2.000e-08gi|194880373|ref|XP_001974422.1| GG21727 [Drosophila erecta]  clstr ali  37 1618..PCLNGATCINLEPRLR-YRCICPEGYWGENCEL..... 1649
188 2.000e-08gi|391338388|ref|XP_003743540.1| PREDICTED: neural-cadherin-like [Metaseiulus occidentalis]  clstr ali  50 2818..PCLNGGTCVNRRNGEGFY-CICPEGFGGELC....... 2847
189 3.000e-08gi|512942817|ref|XP_004910361.1| PREDICTED: protein delta homolog 1 [Heterocephalus glaber]  clstr ali  41  214.SPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEI..... 247
190 3.000e-08gi|528754594|gb|EPY74253.1| hypothetical protein CB1_002192002 [Camelus ferus]  clstr ali  33  227SQPCLHGATCQDAV---GAYFCDCAPGFLGERCEINTDE. 262
191 3.000e-08gi|533205219|ref|XP_005415083.1| PREDICTED: protein delta homolog 1-like isoform X1 [Chinchilla lanigera]  clstr ali  37  147.SPCQHGGTCVDDEGRASHASCLCPPGFSGSFCEIMTN.. 183
192 3.000e-08gi|149057625|gb|EDM08868.1| coagulation factor VII, isoform CRA_b [Rattus norvegicus]  clstr ali  41  83SNPCQNGGTCQDHLK---SYVCFCPLDFEGRNCE...... 113
193 3.000e-08gi|557760921|ref|XP_005180180.1| PREDICTED: epidermal growth factor-like protein 8-like, partial [Musca domestica]  clstr ali  50  92...CQNGGTCTGHD------SCSCPAGFTGRYCEIDIDE. 121
194 3.000e-08gi|512844354|ref|XP_002934104.2| PREDICTED: mucin-4-like [Xenopus (Silurana) tropicalis]  clstr ali  33 3391SNPCCNGGVCIDRV---NNFSCQCQKGWQGNNCSQDMNE. 3426
195 3.000e-08gi|327290489|ref|XP_003229955.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Anolis carolinensis]  clstr ali  41 1057SSPCQNGGTCIDEI---NAFVCLCLPSYGGNLCERDT... 1090
196 3.000e-08gi|584062310|ref|XP_006775572.1| PREDICTED: versican core protein [Myotis davidii]  clstr ali  38 2135SNPCRNGATCVD---GFNTFSCLCLPSYVGALCEQDT-ET 2170
197 3.000e-08gi|507535312|ref|XP_004651697.1| PREDICTED: versican core protein isoform X1 [Jaculus jaculus]  clstr ali  35 3115SNPCRNGATCID---GFNTFRCLCLPSYVGALCEQDT... 3148
198 3.000e-08gi|525027795|ref|XP_005061320.1| PREDICTED: versican core protein isoform X4 [Ficedula albicollis]  clstr ali  36 2350SNPCRNGATCIDGL---NTFTCLCLPSYIGALCEQDT-ET 2385
199 3.000e-08gi|537273594|gb|ERE92478.1| tissue-type plasminogen activator [Cricetulus griseus]  clstr ali  50  165...CFNGGTCQQALYFSD-FVCQCPDGFVGKRCDIDTRAT 200
200 3.000e-08gi|261869973|gb|ACY02334.1| tissue plasminogen activator [synthetic construct]  clstr ali  52  84...CFNGGTCQQALYFSD-FVCQCPEGFAGKCCEIDTRAT 119
201 3.000e-08gi|529449036|ref|XP_005244206.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Falco peregrinus]  clstr ali  46 1029NNPCLHGGTCRAN---GTVCGCSCTPGFTGENCEI..... 1060
202 3.000e-08gi|543349467|ref|XP_005520008.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Pseudopodoces humilis]  clstr ali  45 1090.CSCLNGGTCVTNIKYPGEYLCLCPNGFDGEFCQEDIR.. 1129
203 4.000e-08gi|470597360|ref|XP_004311324.1| PREDICTED: fibulin-7 [Tursiops truncatus]  clstr ali  35  175SQPCQNGGTCVEGV---NQYKCICPPGRTGSRCQTDVNE. 214
204 4.000e-08gi|156353169|ref|XP_001622947.1| predicted protein [Nematostella vectensis]  clstr ali  40  94.CPCQHGGTCHPHPYHSGQYECAFPAGFNGSRCESDID.. 133
205 4.000e-08gi|532059657|ref|XP_005315719.1| PREDICTED: versican core protein isoform X2 [Ictidomys tridecemlineatus]  clstr ali  38 1388SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 1423
206 4.000e-08gi|114599321|ref|XP_001147534.1| PREDICTED: versican core protein isoform 1 [Pan troglodytes]  clstr ali  38 1379SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 1414
207 4.000e-08gi|505839401|ref|XP_004613227.1| PREDICTED: versican core protein isoform X1 [Sorex araneus]  clstr ali  36 2111SNPCRNGATCID---GFNTFRCLCLPSYVGALCEQDT-ET 2146
208 4.000e-08gi|545185442|ref|XP_005599641.1| PREDICTED: versican core protein isoform X3 [Equus caballus]  clstr ali  36 2140SNPCRNGATCID---GFNTFRCLCLPSYIGALCEQDT-ET 2175
209 4.000e-08gi|359720333|gb|AEV54351.1| chondroitin sulfate proteoglycan 2 isoform 2 [Xenopus laevis]  clstr ali  32 3592SNPCRNGAACVDGI---DSFKCICLPSYTGSLCEQDT... 3625
210 4.000e-08gi|395507536|ref|XP_003758079.1| PREDICTED: tissue-type plasminogen activator [Sarcophilus harrisii]  clstr ali  56  83...CFNGGTCQQALYFSD-FICQCPRGFSGKQCEID.... 114
211 4.000e-08gi|568953902|ref|XP_006509090.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Mus musculus]  clstr ali  50  186...CFNGGTCQQALYFSD-FVCQCPDGFVGKRCDIDTRAT 221
212 4.000e-08gi|545878910|ref|XP_005657704.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Sus scrofa]  clstr ali  52  107...CFNGGTCLQAVYFSD-FVCQCPVGFIGRQCEIDARAT 142
213 4.000e-08gi|632957377|ref|XP_007894443.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Callorhinchus milii]  clstr ali  47 1193.CGCLNGGTCVTNINFSGEYLCVCPVGFEGEVCQENIDE. 1233
214 4.000e-08gi|542158519|ref|XP_005488009.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Zonotrichia albicollis]  clstr ali  45 1070.CSCLNGGTCVTNIKYPGEYLCLCPNGFDGEFCQEDTR.. 1109
215 5.000e-08gi|533205223|ref|XP_005415085.1| PREDICTED: protein delta homolog 1-like isoform X3 [Chinchilla lanigera]  clstr ali  37  147.SPCQHGGTCVDDEGRASHASCLCPPGFSGSFCEIMTN.. 183
216 5.000e-08gi|612006470|ref|XP_007487409.1| PREDICTED: versican core protein isoform X3 [Monodelphis domestica]  clstr ali  38 1418SNPCRNGATCVD---GFNTFTCLCLPSYVGALCEQDT-ET 1453
217 5.000e-08gi|554584444|ref|XP_005883676.1| PREDICTED: versican core protein isoform X2 [Myotis brandtii]  clstr ali  38 1271SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 1306
218 5.000e-08gi|585673845|ref|XP_006889932.1| PREDICTED: versican core protein precursor isoform X3 [Elephantulus edwardii]  clstr ali  38 1360SNPCRNGATCVD---GFNTFTCLCLPSYVGALCEQDT-ET 1395
219 5.000e-08gi|634875261|ref|XP_007948737.1| PREDICTED: versican core protein isoform X3 [Orycteropus afer afer]  clstr ali  36 1392SNPCRNGATCID---GFNTFTCLCLPSYVGALCERDT-ET 1427
220 5.000e-08gi|560904688|ref|XP_006178703.1| PREDICTED: versican core protein isoform X3 [Camelus ferus]  clstr ali  38 1390SNPCRNGATCVD---GFNTFRCLCLPSYIGALCERDT-ET 1425
221 5.000e-08gi|511878469|ref|XP_004759183.1| PREDICTED: versican core protein isoform X4 [Mustela putorius furo]  clstr ali  38 1398SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 1433
222 5.000e-08gi|159024138|gb|ABW87311.1| chondroitin sulfate proteoglycan 2 variant V1a [Xenopus laevis]  clstr ali  32 2684SNPCRNGAACVDGI---DSFKCICLPSYTGSLCEQDT... 2717
223 5.000e-08gi|545878907|ref|XP_005657703.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Sus scrofa]  clstr ali  52  107...CFNGGTCLQAVYFSD-FVCQCPVGFIGRQCEIDARAT 142
224 5.000e-08gi|617601074|ref|XP_007522819.1| PREDICTED: tissue-type plasminogen activator [Erinaceus europaeus]  clstr ali  47  88...CFNGGTCQQALYFPD-FVCQCPEGFTGKLCEVDATAT 123
225 5.000e-08gi|642120549|emb|CDQ64806.1| unnamed protein product [Oncorhynchus mykiss]  clstr ali  48 1115.CDCLNGASCVTNPPGSGEYLCVCPAGFTGDRCEEDID.. 1154
226 5.000e-08gi|602677601|ref|XP_007444246.1| PREDICTED: tissue-type plasminogen activator-like, partial [Python bivittatus]  clstr ali  46  90...CFNGGRCQQALYSPNFFICFCPPGFTGKYCEI..... 121
227 5.000e-08gi|507652469|ref|XP_004633126.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Octodon degus]  clstr ali  56  42...CFNGGTCRQALYFSD-FVCQCPEGFMGKRCEID.... 73
228 5.000e-08gi|194374979|dbj|BAG62604.1| unnamed protein product [Homo sapiens]  clstr ali  52  91...CFNGGTCQQALYFSD-FVCQCPEGFAGKCCEIDTRAT 126
229 6.000e-08gi|642075252|emb|CDQ87512.1| unnamed protein product [Oncorhynchus mykiss]  clstr ali  42 1081SQPCQNGGTCIDLI---NTYKCSCPRGTQGVHCEINID.. 1115
230 6.000e-08gi|410898553|ref|XP_003962762.1| PREDICTED: protein delta homolog 1-like [Takifugu rubripes]  clstr ali  36  130SSPCQNGGTCIDGDGPSAYSSCLCPPGFSGDFCEMLVD.. 167
231 6.000e-08gi|597778159|ref|XP_007252721.1| PREDICTED: neurocan core protein [Astyanax mexicanus]  clstr ali  41 1103SGPCQNGGTCIDEI---NSYVCLCLPSYGGATCEKDT... 1136
232 6.000e-08gi|586480271|ref|XP_006870661.1| PREDICTED: versican core protein isoform X3 [Chrysochloris asiatica]  clstr ali  38 1385SNPCRNGATCVD---GFNTFTCLCLPSYIGALCEQDT-ET 1420
233 6.000e-08gi|504147736|ref|XP_004586280.1| PREDICTED: versican core protein isoform X3 [Ochotona princeps]  clstr ali  38 1349SNPCRNGATCVD---GFNTFSCLCLPSYVGVLCEQDT-ET 1384
234 6.000e-08gi|562827881|ref|XP_006143544.1| PREDICTED: versican core protein isoform X1 [Tupaia chinensis]  clstr ali  38 1376SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 1411
235 6.000e-08gi|281604094|ref|NP_001164031.1| versican core protein isoform 3 precursor [Rattus norvegicus]  clstr ali  38 1358SNPCRNGATCVDGL---NTFRCLCLPSYVGALCEQDT-ET 1393
236 6.000e-08gi|640802843|ref|XP_008057764.1| PREDICTED: versican core protein isoform X3 [Tarsius syrichta]  clstr ali  36 1380SNPCRNGATCID---GFNTFRCLCLPSYVGALCEQDT-ET 1415
237 6.000e-08gi|530589046|ref|XP_005288218.1| PREDICTED: versican core protein isoform X3 [Chrysemys picta bellii]  clstr ali  36 1368SNPCRNGATCIDGL---NLFTCLCLPSYAGALCEQDT-ET 1403
238 6.000e-08gi|545850058|ref|XP_005667711.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Sus scrofa]  clstr ali  48 1185SCDCLNGGSCVSDIQFSGAYLCVCLPGFQGDLCEEDVTE. 1226
239 6.000e-08gi|513195365|ref|XP_004943060.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like isoform X5 [Gallus gallus]  clstr ali  47 1142.CSCLNGGTCVTNIKFPGEYLCLCPNGFDGGFCQEDINE. 1182
240 6.000e-08gi|542233937|ref|XP_005455174.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Oreochromis niloticus]  clstr ali  42 1141SCECLNGASCVNLPAGSGEYVCVCPDGFTGKRCEVDID.. 1181
241 6.000e-08gi|543377105|ref|XP_005531758.1| PREDICTED: neurocan core protein [Pseudopodoces humilis]  clstr ali  41 1147SSPCQNGGTCIDEV---NSFVCLCLPSYGGSRCEKDT... 1180
242 6.000e-08gi|61162128|dbj|BAD91053.1| Fc2-cadherin [Folsomia candida]  clstr ali  41 1434DNPCLNNGVC-SNREVPYRYYCECPPGYWGQNCEL..... 1467
243 7.000e-08gi|410924479|ref|XP_003975709.1| PREDICTED: neurocan core protein-like [Takifugu rubripes]  clstr ali  35  592SEPCENGGTCIDKI---DSFLCLCLPSYEGDRCEKDI... 625
244 7.000e-08gi|512813782|ref|XP_002935750.2| PREDICTED: versican core protein isoform X1 [Xenopus (Silurana) tropicalis]  clstr ali  35 3463SNPCRNGAACVDGI---NSFSCICLPSYAGSLCEQDT... 3496
245 7.000e-08gi|612025833|ref|XP_007491955.1| PREDICTED: delta-like protein 3 [Monodelphis domestica]  clstr ali  38  176..PCFNGGTCVD-GGAPAGYTCRCPPGFHGSNCEKKMDR. 211
246 7.000e-08gi|1351381|sp|P98121.1|URTB_DESRO RecName: Full=Salivary plasminogen activator beta; AltName: Full=DSPA beta; Flags: Precursor [Desmodus rotundus] :_  clstr ali  47  46...CFNGGTCWQAASFSD-FVCQCPKGYTGKQCEVDTHAT 81
247 7.000e-08gi|512850564|ref|XP_002939057.2| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Xenopus (Silurana) tropicalis]  clstr ali  39 1186.CGCINGGSCVTNINFPGEYLCLCPNGFEGDNCQVNIDE. 1226
248 8.000e-08gi|556970857|ref|XP_005993936.1| PREDICTED: uncharacterized protein LOC102367572 [Latimeria chalumnae]  clstr ali  36  184SSPCLHGSTCNEFI---NGYTCICNQGWAGVHCEEDINE. 219
249 8.000e-08gi|594058009|ref|XP_006053172.1| PREDICTED: versican core protein isoform X4 [Bubalus bubalis]  clstr ali  36 1382SNPCRNGATCID---GFNTFRCLCLPSYVGALCEQDT-ET 1417
250 8.000e-08gi|528760277|gb|EPY79936.1| neurocan [Camelus ferus]  clstr ali  38 1097SSPCENGGTCIDEV---NAFVCLCLPSYAGSLCEKDT... 1130
251 8.000e-08gi|602647296|ref|XP_007430075.1| PREDICTED: versican core protein [Python bivittatus]  clstr ali  33 2822SSPCRNGATCIDGV---STFTCLCLPSYVGALCEKDT-ET 2857
252 8.000e-08gi|632963651|ref|XP_007898000.1| PREDICTED: versican core protein [Callorhinchus milii]  clstr ali  38 2963SNPCRNGATCIDGI---NCFNCVCLPSYGGALCERDT... 2996
253 8.000e-08gi|573880924|ref|XP_006628662.1| PREDICTED: LOW QUALITY PROTEIN: cadherin EGF LAG seven-pass G-type receptor 2-like [Lepisosteus oculatus]  clstr ali  53 1675.NPCLNGGTCVNRW---GSFSCDCPLGFGGRNCE...... 1704
254 9.000e-08gi|465956696|gb|EMP27063.1| Delta-like protein C [Chelonia mydas]  clstr ali  34  133..PCFNGGTC--AEKPTGGYTCHCPLGYHGSNCEKKIDR. 167
255 9.000e-08gi|528761278|gb|EPY80937.1| hypothetical protein CB1_000775021 [Camelus ferus]  clstr ali  50  502EASCINGGTCTASKADS--YICLCPLGFRGRHCE...... 533
256 9.000e-08gi|465999177|gb|EMP40847.1| Vasorin [Chelonia mydas]  clstr ali  45  438...CLNGGTCQLDAH--NHLECQCPDGFSGLYCEAEIQRT 472
257 9.000e-08gi|557327337|ref|XP_006036630.1| PREDICTED: vasorin [Alligator sinensis]  clstr ali  51  419...CLNGGTCQLNDH--NHLECVCPAGFSGLYCESEVRKT 453
258 1.000e-07gi|585643771|ref|XP_006811418.1| PREDICTED: mucin-2-like, partial [Saccoglossus kowalevskii]  clstr ali  41  52SNPCQNGGTCENMI---NQYVCGCTSGFSGNSCEIDARE. 87
259 1.000e-07gi|390369821|ref|XP_001191674.2| PREDICTED: deleted in malignant brain tumors 1 protein-like, partial [Strongylocentrotus purpuratus]  clstr ali  45  459SNPCMNGGNCKDLV---NGYTCSCPEGFIGTHCE...... 489
260 1.000e-07gi|555972697|ref|XP_005898350.1| PREDICTED: neurocan core protein [Bos mutus]  clstr ali  41 1078SSPCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 1111
261 1.000e-07gi|426230254|ref|XP_004009192.1| PREDICTED: neurocan core protein [Ovis aries]  clstr ali  41 1085SSPCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 1118
262 1.000e-07gi|528954372|ref|XP_005208516.1| PREDICTED: neurocan core protein isoform X1 [Bos taurus]  clstr ali  41 1116SSPCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 1149
263 1.000e-07gi|554559119|ref|XP_005873956.1| PREDICTED: neurocan core protein [Myotis brandtii]  clstr ali  41 1007SSPCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 1040
264 1.000e-07gi|548471536|ref|XP_005682143.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Capra hircus]  clstr ali  41  958SSPCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 991
265 1.000e-07gi|521030642|gb|EPQ12428.1| Neurocan core protein [Myotis brandtii]  clstr ali  41  990SSPCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 1023
266 1.000e-07gi|390335713|ref|XP_797176.3| PREDICTED: tenascin-N-like [Strongylocentrotus purpuratus]  clstr ali  37 1772SGPCLNGATCLNAV---TIFICQCAPGFQGTRCETRTD.. 1806
267 1.000e-07gi|573904725|ref|XP_006640084.1| PREDICTED: neurocan core protein-like [Lepisosteus oculatus]  clstr ali  41  875STPCQNGGTCIDEI---NSFVCLCLPSYGGATCEKDT... 908
268 1.000e-07gi|586520201|ref|XP_006904472.1| PREDICTED: neurocan core protein [Pteropus alecto]  clstr ali  41 1065SSPCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 1098
269 1.000e-07gi|465951085|gb|EMP24104.1| Neurocan core protein [Chelonia mydas]  clstr ali  38 1306SSPCQNGGTCIDEI---NSFVCLCLPSYGDSLCEKDT... 1339
270 1.000e-07gi|641771429|ref|XP_008169767.1| PREDICTED: neurocan core protein [Chrysemys picta bellii]  clstr ali  38 1407SSPCQNGGTCIDEI---NSFVCLCLPSYGDSLCEKDT... 1440
271 1.000e-07gi|533205229|ref|XP_005415088.1| PREDICTED: protein delta homolog 1-like isoform X6 [Chinchilla lanigera]  clstr ali  36  147.SPCQHGGTCVDDEGRASHASCLCPPGFSGSFCEIMTNS. 184
272 1.000e-07gi|557020440|ref|XP_006010543.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Latimeria chalumnae]  clstr ali  42 1195.CGCMNSGTCVTNINFSGEYLCVCPVGFQGEYCQENIDE. 1235
273 1.000e-07gi|556995575|ref|XP_006001559.1| PREDICTED: protein delta homolog 1 isoform X1 [Latimeria chalumnae]  clstr ali  47  170.SPCQNGGTCVDGNGFAHYTSCMCPPGFTGDFCEI..... 203
274 1.000e-07gi|504143837|ref|XP_004584349.1| PREDICTED: protein delta homolog 1 isoform X1 [Ochotona princeps]  clstr ali  41  135.SPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEI..... 168
275 1.000e-07gi|472351818|ref|XP_004395590.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Odobenus rosmarus diverge  clstr ali  43 1380SCDCLNGGSCVSDPPGSGMYLCVCLPGFQGVLCEVNVTE. 1421
276 1.000e-07gi|573874639|ref|XP_006625694.1| PREDICTED: tissue-type plasminogen activator-like [Lepisosteus oculatus]  clstr ali  45  86...CYNGGTCKEAVYSSD-FICQCPPGFTGPQCEINTTE. 120
277 1.000e-07gi|338716565|ref|XP_001916629.2| PREDICTED: LOW QUALITY PROTEIN: hyaluronan-binding protein 2 [Equus caballus]  clstr ali  41  155.NPCQNGGTCSRHRRRS-KFICTCPDGFQGRLCEIGSD.. 190
278 1.000e-07gi|565307972|gb|ETE62036.1| EGF-like repeat and discoidin I-like domain-containing protein 3, partial [Ophiophagus hannah]  clstr ali  34  15.NPCHNGGTCEISEAYRGGYICKCPAGFNGIHCQHNVNE. 56
279 1.000e-07gi|391330169|ref|XP_003739536.1| PREDICTED: crumbs homolog 1-like [Metaseiulus occidentalis]  clstr ali  48  14NNPCKNGGTCSPLDDFS-EYQCICPPGFRGGQCE...... 46
280 1.000e-07gi|2499868|sp|Q28198.1|TPA_BOVIN RecName: Full=Tissue-type plasminogen activator; Short=t-PA; Short=t-plasminogen activator; Short=tPA; Contains: Rec  clstr ali  50  92...CFNGGTCRQALYSSD-FVCQCPEGFMGKLCEIDATAT 127
281 1.000e-07gi|512816914|ref|XP_002939269.2| PREDICTED: hepatocyte growth factor activator [Xenopus (Silurana) tropicalis]  clstr ali  37  152ENPCEHGGTCH-NIAERGTYHCICPEGYTGKDCEIE.... 186
282 1.000e-07gi|532039651|ref|XP_005362683.1| PREDICTED: tissue-type plasminogen activator [Microtus ochrogaster]  clstr ali  50  88...CFNGGTCQQAMYFSD-FVCQCPDGFVGKRCDIDTRAT 123
283 1.000e-07gi|459179505|ref|XP_004226505.1| PREDICTED: serine/threonine-protein kinase mTOR-like [Ciona intestinalis]  clstr ali  35  171ENYCKNSGTCIRDGF--NKYQCSCNAGYSGRHCESDIDE. 207
284 1.000e-07gi|637333400|ref|XP_008115094.1| PREDICTED: uncharacterized protein LOC103279860 [Anolis carolinensis]  clstr ali  36  119ENLCQNGGTCHQMYLRGGVFRCDCPLHFTGRFCEKDTT.. 158
285 1.000e-07gi|488596122|ref|XP_004483245.1| PREDICTED: tissue-type plasminogen activator [Dasypus novemcinctus]  clstr ali  52  92...CFNGGTCLQALYFSDFV-CQCPEGFVGKSCEIEASAT 127
286 2.000e-07gi|564264497|ref|XP_006271095.1| PREDICTED: neurocan core protein [Alligator mississippiensis]  clstr ali  41  403SSPCQNGGTCIDEI---NSFVCLCLPSYGGSLCEKDT... 436
287 2.000e-07gi|397493977|ref|XP_003817872.1| PREDICTED: neurocan core protein [Pan paniscus]  clstr ali  42 1092.SPCENGGTCIDEV---NGFVCLCLPSYGGSFCEKDT... 1124
288 2.000e-07gi|511882082|ref|XP_004760927.1| PREDICTED: neurocan core protein isoform X4 [Mustela putorius furo]  clstr ali  41 1103SSPCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1136
289 2.000e-07gi|30580855|sp|Q28858.1|CSPG2_MACNE RecName: Full=Versican core protein; AltName: Full=Chondroitin sulfate proteoglycan core protein 2; Short=Chondro  clstr ali  36  762SNPCRNGATCAD---GFNTFRCLCLPSYVGALCEQDI-ET 797
290 2.000e-07gi|586977710|ref|XP_006928799.1| PREDICTED: neurocan core protein [Felis catus]  clstr ali  41 1025SSPCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1058
291 2.000e-07gi|591325426|ref|XP_007088728.1| PREDICTED: neurocan core protein [Panthera tigris altaica]  clstr ali  41  998SSPCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1031
292 2.000e-07gi|511882076|ref|XP_004760924.1| PREDICTED: neurocan core protein isoform X1 [Mustela putorius furo]  clstr ali  41 1127SSPCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1160
293 2.000e-07gi|551530093|ref|XP_005816505.1| PREDICTED: aggrecan core protein-like, partial [Xiphophorus maculatus]  clstr ali  41  531SEPCENGGTCVDKI---DSFLCLCLPSYGGDTCEKDV... 564
294 2.000e-07gi|507965338|ref|XP_004688644.1| PREDICTED: neurocan core protein [Condylura cristata]  clstr ali  41 1054SSPCENGGTCIDEI---NAFICLCLPSYGGSLCEKDT... 1087
295 2.000e-07gi|558177379|ref|XP_006100464.1| PREDICTED: neurocan core protein [Myotis lucifugus]  clstr ali  41 1077SSPCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 1110
296 2.000e-07gi|338718707|ref|XP_003363880.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Equus caballus]  clstr ali  41  869SSPCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 902
297 2.000e-07gi|478497275|ref|XP_004422976.1| PREDICTED: neurocan core protein [Ceratotherium simum simum]  clstr ali  41 1075SSPCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1108
298 2.000e-07gi|602673017|ref|XP_007442008.1| PREDICTED: neurocan core protein-like, partial [Python bivittatus]  clstr ali  40 1174SNPCQNGGTCIDDI---NAFVCLCLPSYGGSLC....... 1203
299 2.000e-07gi|545534045|ref|XP_005632716.1| PREDICTED: neurocan core protein isoform X1 [Canis lupus familiaris]  clstr ali  41  980SSPCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1013
300 2.000e-07gi|345787551|ref|XP_541924.3| PREDICTED: neurocan core protein isoform X2 [Canis lupus familiaris]  clstr ali  41 1050SSPCENGGTCIDEV---NTFVCLCLPSYGGSLCEKDT... 1083
301 2.000e-07gi|507535316|ref|XP_004651699.1| PREDICTED: versican core protein isoform X3 [Jaculus jaculus]  clstr ali  35 1377SNPCRNGATCID---GFNTFRCLCLPSYVGALCEQDT... 1410
302 2.000e-07gi|556949778|ref|XP_005987458.1| PREDICTED: epidermal growth factor-like protein 7-like isoform X1 [Latimeria chalumnae]  clstr ali  45  111..PCQNGGTC------SKPNRCDCPPGWNGKHCQTDVDE. 141
303 2.000e-07gi|533205225|ref|XP_005415086.1| PREDICTED: protein delta homolog 1-like isoform X4 [Chinchilla lanigera]  clstr ali  36  147.SPCQHGGTCVDDEGRASHASCLCPPGFSGSFCEIMTNS. 184
304 2.000e-07gi|504143839|ref|XP_004584350.1| PREDICTED: protein delta homolog 1 isoform X2 [Ochotona princeps]  clstr ali  41  135.SPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEI..... 168
305 2.000e-07gi|301765976|ref|XP_002918410.1| PREDICTED: tissue-type plasminogen activator-like isoform 3 [Ailuropoda melanoleuca]  clstr ali  52  91...CFNGGMCRQALYFSD-FVCQCPEGFLGKRCEIDASAT 126
306 2.000e-07gi|119583635|gb|EAW63231.1| plasminogen activator, tissue, isoform CRA_a [Homo sapiens]  clstr ali  52  91...CFNGGTCQQALYFSD-FVCQCPEGFAGKCCEIDTRAT 126
307 2.000e-07gi|426228311|ref|XP_004008256.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Ovis aries]  clstr ali  43  853SCDCLNGGSCVSDPPGSGAYLCVCLPGFHGDLCEKNVTE. 894
308 2.000e-07gi|449275177|gb|EMC84120.1| von Willebrand factor D and EGF domain-containing protein, partial [Columba livia]  clstr ali  48 1131.CGCLNGGTCVTNIKFPGEYLCLCPNGFDGEFCQEDIN.. 1170
309 2.000e-07gi|560973627|ref|XP_006209139.1| PREDICTED: protein delta homolog 1 [Vicugna pacos]  clstr ali  38  241.SPCQHGGSCVDDEGQASHASCLCPPGFSGNFCEI..... 274
310 2.000e-07gi|432911068|ref|XP_004078578.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Oryzias latipes]  clstr ali  43 1152.CDCLNGARCVPDASIPAGFRCACPEGFTGRRCEADAD.. 1188
311 2.000e-07gi|432938955|ref|XP_004082562.1| PREDICTED: protein delta homolog 1-like [Oryzias latipes]  clstr ali  39  133.SPCQNGGTCVDASGSAASPFCSCPSGFSGDFCEIGVDS. 170
312 2.000e-07gi|130492452|ref|NP_001076238.1| tissue-type plasminogen activator precursor [Oryctolagus cuniculus]  clstr ali  54  92...CLNGGTCSQALYFSD-FVCQCPEGFVGKRCEVDT... 124
313 2.000e-07gi|632963508|ref|XP_007897921.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Callorhinchus milii]  clstr ali  48 1196.CNCLNGGSCVINIHFSGEYLCVCPLGFEGKYCEVNID.. 1235
314 2.000e-07gi|390356372|ref|XP_783020.2| PREDICTED: uncharacterized protein LOC577714 [Strongylocentrotus purpuratus]  clstr ali  44  466SSPCVNGGTCVDGH---DSYTCNCAKGYDGADCEIDITQ. 501
315 2.000e-07gi|562823864|ref|XP_006141725.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Tupaia chinensis]  clstr ali  47  88...CFNGGACRQALYFSDFV-CQCPEGFVGKRCEVDTRAT 123
316 2.000e-07gi|301787475|ref|XP_002929153.1| PREDICTED: pikachurin-like [Ailuropoda melanoleuca]  clstr ali  50  543EASCVNGGTCTAVKADS--YICLCPLGFKGRHCE...... 574
317 2.000e-07gi|640793626|ref|XP_008052797.1| PREDICTED: tissue-type plasminogen activator [Tarsius syrichta]  clstr ali  47  88...CFNGGTCWQALYFSDFV-CQCPEGYLGKRCEVDARVT 123
318 3.000e-07gi|585652617|ref|XP_006814952.1| PREDICTED: uncharacterized protein LOC102801595 [Saccoglossus kowalevskii]  clstr ali  43  653..PCQNGGTCTDLIA---AYKCNCTDGYNGTNCEI..... 682
319 3.000e-07gi|573876699|ref|XP_006626617.1| PREDICTED: versican core protein-like [Lepisosteus oculatus]  clstr ali  38  389SNPCRNGGTCIDSL---NSFTCVCLPSYAGALCEQDT-ET 424
320 3.000e-07gi|441628676|ref|XP_003275977.2| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Nomascus leucogenys]  clstr ali  42 1127.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1159
321 3.000e-07gi|431922043|gb|ELK19216.1| Neurocan core protein [Pteropus alecto]  clstr ali  41  776SSPCENGGTCIDEV---NAFICLCLPSYGGSLCEKDT... 809
322 3.000e-07gi|395818947|ref|XP_003782869.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Otolemur garnettii]  clstr ali  50 1181SCDCLNGGSCVSDIKFPGMYLCVCLPGFQGSLCEVD.... 1219
323 3.000e-07gi|514751416|ref|XP_005020856.1| PREDICTED: neurogenic locus notch homolog protein 3-like [Anas platyrhynchos]  clstr ali  47  38..PCLNGGLCQ---YNQSGYICDCPAGFLGHSCEIDINE. 71
324 3.000e-07gi|504143843|ref|XP_004584352.1| PREDICTED: protein delta homolog 1 isoform X4 [Ochotona princeps]  clstr ali  41  135.SPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEI..... 168
325 3.000e-07gi|507631291|ref|XP_004699170.1| PREDICTED: protein delta homolog 1 [Echinops telfairi]  clstr ali  41  138.SPCQHGGTCVDDEGRASHASCLCPPGFSGIFCEI..... 171
326 3.000e-07gi|530620610|ref|XP_005299967.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Chrysemys picta bellii]  clstr ali  44 1197SCDCLNGGSCVTNIHFSGKYLCVCLPGFEGDLCQVNFD.. 1237
327 3.000e-07gi|564389722|ref|XP_006253406.1| PREDICTED: tissue-type plasminogen activator-like isoform X2 [Rattus norvegicus]  clstr ali  50  125...CFNGGTCQQALYFSD-FVCQCPDGFVGKRCDIDTRAT 160
328 3.000e-07gi|395827812|ref|XP_003787089.1| PREDICTED: protein delta homolog 1 isoform 1 [Otolemur garnettii]  clstr ali  41  136.SPCQNGGSCVDDEGWASHVSCLCPPGFSGNFCEI..... 169
329 3.000e-07gi|260833750|ref|XP_002611875.1| hypothetical protein BRAFLDRAFT_83101 [Branchiostoma floridae]  clstr ali  45  504.NPCLNGGTCND---FVGFYNCTCPDSFTGSNCEEDVDE. 538
330 3.000e-07gi|597786699|ref|XP_007256807.1| PREDICTED: LOW QUALITY PROTEIN: cadherin EGF LAG seven-pass G-type receptor 2-like [Astyanax mexicanus]  clstr ali  51 1391NNPCLNGGTCASLW---GSFRCDCALGFGGRNCE...... 1421
331 3.000e-07gi|562823862|ref|XP_006141724.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Tupaia chinensis]  clstr ali  47  88...CFNGGACRQALYFSDFV-CQCPEGFVGKRCEVDTRAT 123
332 4.000e-07gi|1709255|sp|P55066.1|NCAN_MOUSE RecName: Full=Neurocan core protein; AltName: Full=Chondroitin sulfate proteoglycan 3; Flags: Precursor  clstr ali  42 1005.SPCENGGTCIDEV---NGFICLCLPSYGGSLCEKDT... 1037
333 4.000e-07gi|634861215|ref|XP_007943679.1| PREDICTED: neurocan core protein [Orycteropus afer afer]  clstr ali  42 1076.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1108
334 4.000e-07gi|584054853|ref|XP_006772021.1| PREDICTED: delta-like protein 3 [Myotis davidii]  clstr ali  35  218..PCFNGGLCVGGTDPDSAYICHCPPGFQGSNCEKRVDR. 254
335 4.000e-07gi|512949108|ref|XP_004837006.1| PREDICTED: protein delta homolog 1 isoform X2 [Heterocephalus glaber]  clstr ali  41  135.SPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEI..... 168
336 4.000e-07gi|635114531|ref|XP_007980216.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein isoform X1 [Chlorocebus sabaeus]  clstr ali  50 1270SCDCLNGGSCVSDRNFSGVYLCVCLPGFHGSLCEVNIS.. 1310
337 4.000e-07gi|525025556|ref|XP_005060236.1| PREDICTED: neurocan core protein [Ficedula albicollis]  clstr ali  41  599SSPCQNGGTCIDEV---NSFVCLCLPSYGGSRCEKDT... 632
338 4.000e-07gi|123704351|ref|NP_001074046.1| cadherin EGF LAG seven-pass G-type receptor 2 precursor [Danio rerio]  clstr ali  51 1648NNPCLNGGSCVSLW---GSFRCDCALGFGGRNCE...... 1678
339 4.000e-07gi|528945700|ref|XP_005205132.1| PREDICTED: neurocan core protein-like isoform X2 [Bos taurus]  clstr ali  46  272ENPCQNGGTCVPGE---DAHSCDCSPGFKGRHCEL..... 303
340 4.000e-07gi|504165749|ref|XP_004592804.1| PREDICTED: tissue-type plasminogen activator [Ochotona princeps]  clstr ali  47  79...CLNGGTCWQAQHFSDFV-CQCPEGFVGKRCDVDTR.. 112
341 4.000e-07gi|59860161|gb|AAX09643.1| mini-agrin [Mus musculus]  clstr ali  38  739DNPCLNGGSCIPREA---TYECLCPGGFSGLHCEKGIVE. 774
342 5.000e-07gi|532094688|ref|XP_005333018.1| PREDICTED: neurocan core protein [Ictidomys tridecemlineatus]  clstr ali  42 1048.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1080
343 5.000e-07gi|612011870|ref|XP_007489259.1| PREDICTED: neurocan core protein isoform X2 [Monodelphis domestica]  clstr ali  41 1104SSPCLNGGTCIDEV---NSFICLCLPSYGGSLCDKDT... 1137
344 5.000e-07gi|403303604|ref|XP_003942416.1| PREDICTED: neurocan core protein [Saimiri boliviensis boliviensis]  clstr ali  42 1135.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1167
345 5.000e-07gi|585659430|ref|XP_006886026.1| PREDICTED: neurocan core protein [Elephantulus edwardii]  clstr ali  42 1121.SPCENGGTCIDEV---NGFVCLCLPSYGGNLCEKDT... 1153
346 5.000e-07gi|544509854|ref|XP_005588587.1| PREDICTED: neurocan core protein isoform X1 [Macaca fascicularis]  clstr ali  42 1033.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1065
347 5.000e-07gi|344283059|ref|XP_003413290.1| PREDICTED: neurocan core protein [Loxodonta africana]  clstr ali  42 1043.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1075
348 5.000e-07gi|471404796|ref|XP_004384417.1| PREDICTED: neurocan core protein [Trichechus manatus latirostris]  clstr ali  42 1017.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1049
349 5.000e-07gi|512814844|ref|XP_002936378.2| PREDICTED: neurocan core protein [Xenopus (Silurana) tropicalis]  clstr ali  38 1325SNPCQNGGTCIDEI---NSFLCLCLSSYGGSTCGKDT... 1358
350 5.000e-07gi|395513129|ref|XP_003760782.1| PREDICTED: neurocan core protein [Sarcophilus harrisii]  clstr ali  41 1094SSPCLNGGTCIDEV---NSFICLCLPSYGGSLCDKDT... 1127
351 5.000e-07gi|565313393|gb|ETE65746.1| von Willebrand factor D and EGF domain-containing protein, partial [Ophiophagus hannah]  clstr ali  51 1019.CGCLNGGTCITNINFPGEYLCICPSEFEGDHCQ...... 1054
352 6.000e-07gi|498957442|ref|XP_004544774.1| PREDICTED: versican core protein-like [Maylandia zebra]  clstr ali  38  395SNPCRNGGTCVDGL---SSFTCVCLPSYAGLFCEEDT-ET 430
353 6.000e-07gi|316980673|dbj|BAJ51985.1| green fluorescnet protein-PG-M/versican (V3) fusion protein [Cloning vector pInSRT-GFPV3]  clstr ali  38  654SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 689
354 6.000e-07gi|532055745|ref|XP_005370585.1| PREDICTED: neurocan core protein [Microtus ochrogaster]  clstr ali  43  995..PCENGGTCIDGV---NGFTCLCLPSYGGSLCEKDT... 1026
355 6.000e-07gi|586482595|ref|XP_006871809.1| PREDICTED: neurocan core protein, partial [Chrysochloris asiatica]  clstr ali  42 1025.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1057
356 6.000e-07gi|637329097|ref|XP_008114301.1| PREDICTED: pikachurin isoform X1 [Anolis carolinensis]  clstr ali  55  753..PCVNGGTCVPKK---DGYECDCPLGFDGQHCQ...... 781
357 7.000e-07gi|524972710|ref|XP_005086204.1| PREDICTED: neurocan core protein [Mesocricetus auratus]  clstr ali  42 1005.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1037
358 7.000e-07gi|507657471|ref|XP_004705572.1| PREDICTED: neurocan core protein [Echinops telfairi]  clstr ali  42 1021.SPCANGGTCIDEV---NGFGCLCLPSYGGSFCEKDT... 1053
359 7.000e-07gi|537257597|gb|ERE89283.1| von Willebrand factor D and EGF domain-containing protein [Cricetulus griseus]  clstr ali  52 1210SCDCLNGGSCVSDRKFSGAYLCVCLPGFHGNLCEVDAS.. 1250
360 7.000e-07gi|208879564|gb|ACI31319.1| plasminogen activator [Diaemus youngi]  clstr ali  44  92...CFNGGTCWEALHFSEFV-CQCPERYTGKWCEVDTHAT 127
361 7.000e-07gi|632936980|ref|XP_007896862.1| PREDICTED: urokinase-type plasminogen activator [Callorhinchus milii]  clstr ali  41  83.NKCFHGGRCASQLH-SEHYLCLCPAGYRGKHCEIDVD.. 118
362 8.000e-07gi|344241310|gb|EGV97413.1| Neurocan core protein [Cricetulus griseus]  clstr ali  42  971.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1003
363 8.000e-07gi|348558724|ref|XP_003465166.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Cavia porcellus]  clstr ali  42 1042.SPCENGGTCIDEV---NSFVCLCLPSYGGNLCEKDT... 1074
364 8.000e-07gi|260785516|ref|XP_002587807.1| hypothetical protein BRAFLDRAFT_92256 [Branchiostoma floridae]  clstr ali  40 3908SQPCLNNGTCTD---GQTSYSCQC--GFKGDNCEI..... 3939
365 8.000e-07gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  41 1147SNPCQNGGTCIDEI---NSFVCLCLPSYGGATCE...... 1177
366 8.000e-07gi|528480304|ref|XP_002662132.3| PREDICTED: versican core protein [Danio rerio]  clstr ali  38  519DAVCLNGGTCI---KTGGAQICICQPGYSGEQCEIDIDE. 554
367 8.000e-07gi|585700002|ref|XP_006897052.1| PREDICTED: tissue-type plasminogen activator [Elephantulus edwardii]  clstr ali  50  88...CFNGGICWQAVYFSDFV-CQCPEGFFGKSCEIDAKAT 123
368 9.000e-07gi|617468448|ref|XP_007574541.1| PREDICTED: neurocan core protein-like isoform X1 [Poecilia formosa]  clstr ali  41  956SEPCENGGTCVDKI---DSFLCLCLPSYGGDTCEKDV... 989
369 1.000e-06gi|432916725|ref|XP_004079363.1| PREDICTED: neurocan core protein-like [Oryzias latipes]  clstr ali  41  705SEPCENGGTCVDKI---DSFLCLCLPSYGGDTCEKDV... 738
370 1.000e-06gi|617468454|ref|XP_007574543.1| PREDICTED: neurocan core protein-like isoform X2 [Poecilia formosa]  clstr ali  41  910SEPCENGGTCVDKI---DSFLCLCLPSYGGDTCEKDV... 943
371 1.000e-06gi|533193837|ref|XP_005409679.1| PREDICTED: neurocan core protein [Chinchilla lanigera]  clstr ali  42 1045.SPCENGGTCIDEV---NSFVCLCLPSYGGSLCEKDT... 1077
372 1.000e-06gi|512813786|ref|XP_004910942.1| PREDICTED: versican core protein isoform X2 [Xenopus (Silurana) tropicalis]  clstr ali  35  840SNPCRNGAACVDGI---NSFSCICLPSYAGSLCEQDT... 873
373 1.000e-06gi|584039724|ref|XP_006778460.1| PREDICTED: neurocan core protein [Myotis davidii]  clstr ali  41 1023SSPCENGGTCIDEV---NTFICLCLPSYGGSLCEKDT... 1056
374 1.000e-06gi|558117097|ref|XP_006113300.1| PREDICTED: LOW QUALITY PROTEIN: tissue-type plasminogen activator [Pelodiscus sinensis]  clstr ali  43  86...CYNGGRCKQALYSPLHFICQCHAGFSGKHCEIDMEAT 122
375 1.000e-06gi|586458538|ref|XP_006859988.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Chrysochloris asiatica]  clstr ali  42  91...CFNGGICRQALYFPDFV-CQCPEGYMGKRCEIDAKA. 125
376 1.000e-06gi|344238919|gb|EGV95022.1| Salivary plasminogen activator alpha 2 [Cricetulus griseus]  clstr ali  47  291...CFNGGACQQALYFSDFV-CQCPDGFVGKRCDIDTRAT 326
377 1.000e-06gi|405958946|gb|EKC25025.1| Neurogenic locus notch-like protein 1 [Crassostrea gigas]  clstr ali  48  245...CLNGGSCVQENLKEEWYFCDCPVNFTGKHCE...... 275
378 1.000e-06gi|611981376|ref|XP_007476457.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Monodelphis domestica]  clstr ali  48  81NCSCFNGGTCKQALYFPDF-ICHCPRGFAGKQCEIDSNS. 121
379 1.000e-06gi|466083807|ref|XP_004285111.1| PREDICTED: tissue-type plasminogen activator isoform 2 [Orcinus orca]  clstr ali  50  45...CFNRGTCWQALYSSEFV-CQCPEGFIGKRCEIDASAT 80
380 1.000e-06gi|525004194|ref|XP_005049792.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Ficedula albicollis]  clstr ali  43 1586.CSCLSGGTCVTNPPGRGEYLCLCPNGFDGEFCQEDIR.. 1625
381 2.000e-06gi|260817936|ref|XP_002603841.1| hypothetical protein BRAFLDRAFT_101343 [Branchiostoma floridae]  clstr ali  43  622SGPCQNGGQCQD---GDNSYTCDCPDGFLGERCEI..... 653
382 2.000e-06gi|564242614|ref|XP_006278103.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Alligator missis  clstr ali  27 1330SNPCRNKAICEDRI---GSFHCKCPSGFTGALCEKNIDE. 1365
383 2.000e-06gi|478498911|ref|XP_004423786.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Ceratotherium simum s  clstr ali  36 1313SNPCRNQATCVDEL---NSYSCKCLPGFSGSRCETE.... 1345
384 2.000e-06gi|530414516|ref|XP_005259804.1| PREDICTED: neurocan core protein isoform X3 [Homo sapiens]  clstr ali  42  600.SPCENGGTCIDEV---NGFVCLCLPSYGGSFCEKDT... 632
385 2.000e-06gi|640783341|ref|XP_008047343.1| PREDICTED: coagulation factor X [Tarsius syrichta]  clstr ali  31  822SSPCQNQGECRDGL---GEYTCTCLEGFEGRNCEL..... 853
386 2.000e-06gi|543277596|ref|XP_005427040.1| PREDICTED: versican core protein [Geospiza fortis]  clstr ali  36  388SNPCRNGATCIDSL---NTFTCLCLPSYVGALCEQDT-ET 423
387 2.000e-06gi|443712251|gb|ELU05672.1| hypothetical protein CAPTEDRAFT_229022 [Capitella teleta]  clstr ali  35 1417SSPCQNGGKCFDSYGF---YQCDCFDNYAGLNCE...... 1447
388 2.000e-06gi|405958595|gb|EKC24707.1| Deleted in malignant brain tumors 1 protein [Crassostrea gigas]  clstr ali  37  321HNPCNNGGTCYHNYGYPGYY-CTCPSGYSGRNC....... 352
389 2.000e-06gi|640834304|ref|XP_008072858.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein-like [Tarsius syrichta]  clstr ali  42  856.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 888
390 2.000e-06gi|405969700|gb|EKC34654.1| Deleted in malignant brain tumors 1 protein [Crassostrea gigas]  clstr ali  36  285.NPCQNAATCSRDYYYSTNYYCSCPRGYSGRNCE...... 317
391 2.000e-06gi|187607167|ref|NP_001120289.1| uncharacterized protein LOC100145345 precursor [Xenopus (Silurana) tropicalis]  clstr ali  38  87ENPCQNGGICQQYHY---SYTCLCPPSYSGRYCE...... 117
392 2.000e-06gi|551511837|ref|XP_005807436.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Xiphophorus maculatus]  clstr ali  44 1185.CGCLNGGTCVTDVSFSGKYLCVCPEGKQGELCGKDMDQ. 1225
393 2.000e-06gi|465989184|gb|EMP37951.1| von Willebrand factor D and EGF domain-containing protein, partial [Chelonia mydas]  clstr ali  40 1166.CSCMNGGSCVTNINFPGEYLCICPSGFDGNFCQENIN.. 1205
394 3.000e-06gi|585653738|ref|XP_006815169.1| PREDICTED: fibropellin-1-like, partial [Saccoglossus kowalevskii]  clstr ali  40  248SNPCLNNGTCVDGV---NSYVCNCVDGYSGDNCQT..... 279
395 3.000e-06gi|528766202|gb|EPY85861.1| sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 precursor [Camelus ferus]  clstr ali  36 1086SNPCRNQATCVDEL---NAYSCKCQPGFSGSRCETE.... 1118
396 3.000e-06gi|390347626|ref|XP_780954.3| PREDICTED: uncharacterized protein LOC575460 [Strongylocentrotus purpuratus]  clstr ali  41  270SDPCQNGGTCEDGV---NGYVCICVDGWGGGDCE...... 300
397 3.000e-06gi|260819852|ref|XP_002605250.1| hypothetical protein BRAFLDRAFT_92276 [Branchiostoma floridae]  clstr ali  36  358.NVCQNGGFCKS--CFNGSPMCACSPGYTGVFCETDINE. 393
398 3.000e-06gi|156368057|ref|XP_001627513.1| predicted protein [Nematostella vectensis]  clstr ali  23 1453.NPCKHASAC---DNTPGGYTCTCKPGYTGQNCDVDIN.. 1486
399 3.000e-06gi|148668664|gb|EDL00983.1| mCG116562, isoform CRA_c [Mus musculus]  clstr ali  38  451SNPCRNGATCVD---GFNTFRCLCLPSYVGALCEQDT-ET 486
400 3.000e-06gi|444730184|gb|ELW70574.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Tupaia chinensis]  clstr ali  36 1447SNPCKNQATCVDEL---NSYSCKCRPGFSGSQCETE.... 1479
401 3.000e-06gi|556988805|ref|XP_005999483.1| PREDICTED: neurocan core protein [Latimeria chalumnae]  clstr ali  43  400..PCQNGGTCIDEI---NSFVCLCLPSYGGGRCEKDT... 431
402 3.000e-06gi|348500902|ref|XP_003438010.1| PREDICTED: neurocan core protein-like isoform X1 [Oreochromis niloticus]  clstr ali  38 1042SEPCANGGTCIDKI---DSFLCLCLPSYGGDMCEKDV... 1075
403 3.000e-06gi|548348506|ref|XP_005726618.1| PREDICTED: protocadherin Fat 4-like isoform X3 [Pundamilia nyererei]  clstr ali  42 4114...CRHGGTCVDHWSWQ---QCQCVDGFTGKFCE...... 4141
404 3.000e-06gi|395541765|ref|XP_003772809.1| PREDICTED: protocadherin Fat 4 [Sarcophilus harrisii]  clstr ali  33 4076..PCKNGAICQN---FPGSFNCVCKAGFTGKTCESSVN.. 4108
405 3.000e-06gi|505846821|ref|XP_004616883.1| PREDICTED: neurocan core protein [Sorex araneus]  clstr ali  41  894SSPCENGGTCIDEV---NGFVCLCLPSYGGSSCEKDT... 927
406 3.000e-06gi|645026521|ref|XP_008214058.1| PREDICTED: uncharacterized protein LOC100119261 [Nasonia vitripennis]  clstr ali  48  252..PCQNGGVC------SSPGRCTCPKGFTGNYCQIDVDE. 282
407 3.000e-06gi|541040163|gb|ERG79711.1| egf-like domain containing protein [Ascaris suum]  clstr ali  56  203...CLNGGTEMK-------QRCLCPPNFLGYHCEIDTNRT 232
408 3.000e-06gi|348605110|ref|NP_001025574.2| tissue-type plasminogen activator precursor [Xenopus (Silurana) tropicalis]  clstr ali  50  96...CYNGGRCQQAVY-STHHLCRCPSGFKGEHCETDTKET 131
409 3.000e-06gi|573897012|ref|XP_006636244.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Lepisosteus oculatus]  clstr ali  42 1175.CECLNGGSCVTDINFSGEYLCVCPPGLEGERCAVDTDE. 1215
410 3.000e-06gi|564230676|ref|XP_006259760.1| PREDICTED: pikachurin [Alligator mississippiensis]  clstr ali  46  532EASCINSGTCTASKADS--YMCLCPLGFKGRHCE...... 563
411 4.000e-06gi|537217432|gb|ERE82041.1| sushi, nidogen and EGF-like domain-containing protein 1 [Cricetulus griseus]  clstr ali  38 2147..PCLNGGSCIDLV---GNYSCICVEPFEGPRCETE.... 2177
412 4.000e-06gi|583983562|ref|XP_006787067.1| PREDICTED: neurocan core protein-like [Neolamprologus brichardi]  clstr ali  38  953SEPCANGGTCIDKI---DSFLCLCLPSYGGDMCEKDV... 986
413 4.000e-06gi|617658294|ref|XP_007536418.1| PREDICTED: protocadherin Fat 4 [Erinaceus europaeus]  clstr ali  38 3715..PCQNGGTCTDRWSWQ---ECRCTEGLTGQYCEQPISE. 3748
414 4.000e-06gi|405958597|gb|EKC24709.1| Oncoprotein-induced transcript 3 protein [Crassostrea gigas]  clstr ali  45  27...CYNGGTCIAYNNGYPGYYCNCPSGFTGLHCQ...... 57
415 4.000e-06gi|513024541|ref|XP_004873483.1| PREDICTED: neurocan core protein [Heterocephalus glaber]  clstr ali  42 1041.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1073
416 4.000e-06gi|512930262|ref|XP_004906629.1| PREDICTED: neurocan core protein, partial [Heterocephalus glaber]  clstr ali  42  973.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1005
417 4.000e-06gi|332241010|ref|XP_003269681.1| PREDICTED: tissue-type plasminogen activator isoform 3 [Nomascus leucogenys]  clstr ali  54  91...CFNGGTCQQALYFSDFV-CQCPEGFAGKCCEI..... 121
418 4.000e-06gi|260822961|ref|XP_002602286.1| hypothetical protein BRAFLDRAFT_76974 [Branchiostoma floridae]  clstr ali  34  600SNPCQNGGTCINME---NAYRCQCPEQYKGKNCDTERN.. 634
419 4.000e-06gi|632988479|ref|XP_007883136.1| PREDICTED: pikachurin-like, partial [Callorhinchus milii]  clstr ali  53  357..SCSNGGVCVANRADS--YLCLCPLGFRGKHCE...... 386
420 4.000e-06gi|511873633|ref|XP_004756997.1| PREDICTED: epidermal growth factor-like protein 7 isoform X1 [Mustela putorius furo]  clstr ali  45  135..PCQNGGTCVQPG------RCHCPAGWRGDTCQIDVDE. 165
421 4.000e-06gi|405951958|gb|EKC19822.1| Kinesin-related motor protein Eg5 2 [Crassostrea gigas]  clstr ali  39  213DSPCQNNGTCLQRK---DSYNCSCPHGFVGENCDIE.... 245
422 4.000e-06gi|156366074|ref|XP_001626966.1| predicted protein [Nematostella vectensis]  clstr ali  45 1059.CPCINGGVCHPHPYGSGRYTCTCPEGFTGNLCE...... 1094
423 4.000e-06gi|637249575|ref|XP_008111251.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Anolis carolinensis]  clstr ali  51  171.CGCLNGGTCITNVNFPSGYLCICPNEFEGEHCQ...... 206
424 5.000e-06gi|405970071|gb|EKC35006.1| Fibropellin-1 [Crassostrea gigas]  clstr ali  33  554..PCQNNGTCIDQV---NHFQCECVPGYNGTTCENMVN.. 586
425 5.000e-06gi|390339295|ref|XP_003724971.1| PREDICTED: uncharacterized protein LOC100892917 [Strongylocentrotus purpuratus]  clstr ali  50  232..PCLNGGTCVDFQTFG---FCLCPPGYSGVICQI..... 261
426 5.000e-06gi|507564614|ref|XP_004665976.1| PREDICTED: neurocan core protein [Jaculus jaculus]  clstr ali  42 1035.SPCENGGTCIDEV---NGFVCLCLPSYGGSLCEKDT... 1067
427 5.000e-06gi|360043467|emb|CCD78880.1| axon guidance protein [Schistosoma mansoni]  clstr ali  48 1222NNSCLNGGICENNEMNQTIYQCKCPTGFKGERCEI..... 1257
428 5.000e-06gi|345306462|ref|XP_003428469.1| PREDICTED: tissue-type plasminogen activator isoform X1 [Ornithorhynchus anatinus]  clstr ali  48  84...CYNGGTCYQALYFSDF-ICSCPSGFDGKQCEINVNA. 118
429 5.000e-06gi|354468247|ref|XP_003496578.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Cricetulus griseus]  clstr ali  52 1236SCDCLNGGSCVSDRKFSGAYLCVCLPGFHGNLCEVDAS.. 1276
430 5.000e-06gi|537257598|gb|ERE89284.1| von Willebrand factor D and EGF domain-containing protein [Cricetulus griseus]  clstr ali  52 1272SCDCLNGGSCVSDRKFSGAYLCVCLPGFHGNLCEVDAS.. 1312
431 5.000e-06gi|568257236|gb|ETN65566.1| hypothetical protein AND_002660 [Anopheles darlingi]  clstr ali  39  90..PCQNGGRCRDYNP-PRRYECICPLGFTGAHCELE.... 122
432 6.000e-06gi|511900340|ref|XP_004769707.1| PREDICTED: delta-like protein 1 [Mustela putorius furo]  clstr ali  38  631..PCFNGGRCSDNPE--GGYTCRCPGGFSGFNCEKKVD.. 664
433 6.000e-06gi|667063|emb|CAA35572.1| epidermal growth factor [Strongylocentrotus purpuratus]  clstr ali  36  6SMPCLNGGACIEMV---NGYTCQCVAGYTGVICETDIDE. 41
434 6.000e-06gi|537228073|gb|ERE83520.1| sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Cricetulus griseus]  clstr ali  36 1463SNPCRNQATCVDEL---NSYSCKCRPGFSGHRCETE.... 1495
435 6.000e-06gi|410914515|ref|XP_003970733.1| PREDICTED: protocadherin Fat 4-like [Takifugu rubripes]  clstr ali  28 4374SNPCKNGALCQN---FPGGFNCLCKSGFAGKTCDSIIN.. 4408
436 6.000e-06gi|597797694|ref|XP_007260404.1| PREDICTED: protocadherin Fat 4 [Astyanax mexicanus]  clstr ali  28 3948SNPCKNGALCQN---FPGGFNCLCKSGFAGKTCDSIIN.. 3982
437 6.000e-06gi|504172493|ref|XP_004595823.1| PREDICTED: neurocan core protein [Ochotona princeps]  clstr ali  42  983.SPCENGGTCIDEV---NGFVCLCLPSYGGSQCEKDT... 1015
438 6.000e-06gi|507710503|ref|XP_004646932.1| PREDICTED: neurocan core protein [Octodon degus]  clstr ali  42 1050.SPCENGGTCIDEV---NSFVCLCLPSYGGSLCEKDT... 1082
439 6.000e-06gi|260811932|ref|XP_002600675.1| hypothetical protein BRAFLDRAFT_67738 [Branchiostoma floridae]  clstr ali  50 3647.CDCHNGGTCDYNNTIERVNGCQCLPGFGGEHCEIDIDA. 3689
440 6.000e-06gi|488534921|ref|XP_004485076.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domains [Dasypus novemcinctus]  clstr ali  51 1007SCDCLNGGSCVSDIKFSGAYLCVCLPGFWGGLCEV..... 1044
441 6.000e-06gi|260819590|ref|XP_002605119.1| hypothetical protein BRAFLDRAFT_84207 [Branchiostoma floridae]  clstr ali  35 1261.CECENGGSCVTYPAGSGMYMCVCPPGYQGERCQDNVD.. 1300
442 6.000e-06gi|297288789|ref|XP_002803427.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Macaca mulatta]  clstr ali  50 1315SCDCLNGGSCVSDRNFSGVYLCVCLPGFHGSLCEVNTS.. 1355
443 7.000e-06gi|591384083|ref|XP_007066499.1| PREDICTED: versican core protein [Chelonia mydas]  clstr ali  36  393SNPCRNGATCIDGL---NLFTCLCLPSYVGALCEQDT-ET 428
444 7.000e-06gi|507566845|ref|XP_004667063.1| PREDICTED: protocadherin Fat 4-like [Jaculus jaculus]  clstr ali  31 3909.SPCKNGAICHN---FPGGFNCVCKTGYTGKHCELN.... 3943
445 7.000e-06gi|584086441|ref|XP_006762943.1| PREDICTED: LOW QUALITY PROTEIN: protocadherin Fat 4 [Myotis davidii]  clstr ali  29 4001.SPCKNGAVCQN---FPGSFHCVCKTGYTGKMCESSVN.. 4034
446 7.000e-06gi|395502468|ref|XP_003755602.1| PREDICTED: lactadherin [Sarcophilus harrisii]  clstr ali  50  33...CLNGGTCLNGSESSTFY-CLCPDGFTGQNCQ...... 62
447 7.000e-06gi|198462950|ref|XP_001352633.2| GA20359 [Drosophila pseudoobscura pseudoobscura]  clstr ali  43  355...CQNGGNCTAP------QTCSCPSGYTGRHCEVDVNE. 384
448 7.000e-06gi|524962186|ref|XP_005081022.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Mesocricetus auratus]  clstr ali  50 1180SCDCLNGGSCVPDRKFSGAYLCVCLPGFHGDLCEVDAS.. 1220
449 7.000e-06gi|543375353|ref|XP_005530889.1| PREDICTED: tissue-type plasminogen activator [Pseudopodoces humilis]  clstr ali  37  218.NKCYNGGQCSQAYYSPQLFICQCHQGFSGKQCEIDTE.. 254
450 8.000e-06gi|260826500|ref|XP_002608203.1| hypothetical protein BRAFLDRAFT_90357 [Branchiostoma floridae]  clstr ali  42  141...CENGGTCRDGI---NEYSCDCADGFNGDTCQIDTNE. 173
451 8.000e-06gi|351712034|gb|EHB14953.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Heterocephalus glaber]  clstr ali  35 1148..PCLNSGICEDRV---GEFICECPSGYTGQLCEENINE. 1181
452 8.000e-06gi|432885067|ref|XP_004074641.1| PREDICTED: versican core protein-like [Oryzias latipes]  clstr ali  35  70SNPCLNGATCLDGI---DSFTCACLPSYTGKLCEQDT... 103
453 8.000e-06gi|617647336|ref|XP_007533249.1| PREDICTED: neurocan core protein [Erinaceus europaeus]  clstr ali  41  836SSPCENGGTCVDEVA---GFACLCLPSYGGPLCEKDT... 869
454 8.000e-06gi|557319459|ref|XP_006032895.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Alligator sinensis]  clstr ali  40  819.CSCMHGGTCVTNINFPGEYLCICPNGFDGVLCQENIN.. 858
455 8.000e-06gi|564263491|ref|XP_006270607.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Alligator mississippiensis]  clstr ali  41  904.CSCMHGGTCVTNINFPGEYLCICPNGFDGELCQENI... 942
456 8.000e-06gi|405972121|gb|EKC36908.1| WD repeat-containing protein 68 [Crassostrea gigas]  clstr ali  38  117.NRCQNGGIC-SYLNGSLNYICECPTGYTGDWCEIKQD.. 152
457 8.000e-06gi|321459270|gb|EFX70325.1| hypothetical protein DAPPUDRAFT_300527 [Daphnia pulex]  clstr ali  41 2186NNPCHNGGRCVEGRY---GVTCQCPSGYDGPRCQ...... 2216
458 8.000e-06gi|61162130|dbj|BAD91054.1| Af1-cadherin [Artemia franciscana]  clstr ali  53 1148...CFNGGTCILNGLFP---RCECPDNFEGPRCE...... 1175
459 9.000e-06gi|585662966|ref|XP_006886991.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Elephantulus edwardii  clstr ali  36 1388SDPCRNQATCVDEL---NSYSCKCQPGFTGSRCETE.... 1420
460 9.000e-06gi|597743600|ref|XP_007233872.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Astyanax mexican  clstr ali  30 1239STPCQNGGLCRD---GMGGFQCQCQPGFVGSLCEAEVNE. 1274
461 9.000e-06gi|126334857|ref|XP_001374633.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 isoform X1 [Monodelphi  clstr ali  27 1348SDPCLNNAVCEDQI---GGFLCKCLPGFRGTRCEKNVDE. 1383
462 9.000e-06gi|47551053|ref|NP_999703.1| fibropellin-3 precursor [Strongylocentrotus purpuratus]  clstr ali  37  334SSPCLNGGSCLDGV---DGYVCQCLPNYTGTHCEISLD.. 368
463 9.000e-06gi|537245548|gb|ERE87808.1| protocadherin Fat 4 [Cricetulus griseus]  clstr ali  29 3779.SPCKNGAVCQN---FPGGFNCVCKTGYTGKMCESSVN.. 3812
464 9.000e-06gi|625270788|ref|XP_007626942.1| PREDICTED: protocadherin Fat 4 isoform X2 [Cricetulus griseus]  clstr ali  29 4262.SPCKNGAVCQN---FPGGFNCVCKTGYTGKMCESSVN.. 4295
465 1.000e-05gi|465965700|gb|EMP30778.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Chelonia mydas]  clstr ali  40  818.NPCLNQADCVDAL---NSYVCKCPPGFTGSRCETE.... 849
466 1.000e-05gi|585689647|ref|XP_006820912.1| PREDICTED: SCO-spondin-like [Saccoglossus kowalevskii]  clstr ali  28  548SNPCQHAATCKDNI---GGYECFCADGYSGVHCE-EVDE. 582
467 1.000e-05gi|260823778|ref|XP_002606845.1| hypothetical protein BRAFLDRAFT_103547 [Branchiostoma floridae]  clstr ali  27  168SGPCMNGGICLDLI---GQFSCSCSPGYHGDRCQLDINE. 203
468 1.000e-05gi|620948150|ref|XP_007653845.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Ornithorhynchus anati  clstr ali  27 1275SSPCLNNGVCKDGIK---AFTCHCQAGFTGLLCQENINE. 1310
469 1.000e-05gi|488580572|ref|XP_004475730.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Dasypus novemcinctus]  clstr ali  38  995SSPCLNKGICVDGLA---GYHCTCVKGFIGLHCETEVNE. 1030
470 1.000e-05gi|548339759|ref|XP_005722472.1| PREDICTED: versican core protein-like [Pundamilia nyererei]  clstr ali  38  413SNPCRNGGTCVDGLA---SFTCVCLPSYAGLFCE...... 443
471 1.000e-05gi|556979133|ref|XP_005996507.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Latimeria chalum  clstr ali  22 1243SGPCQNNALCIDGI---GKFACQCHPGYTGSLCEVNINE. 1278
472 1.000e-05gi|470618392|ref|XP_004317818.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like, partial [Tursiop  clstr ali  32 1218..PCYNNGICKDQV---GEFICECPSGYTGQLCEENINE. 1251
473 1.000e-05gi|268054227|gb|ACY92600.1| notch receptor [Saccoglossus kowalevskii]  clstr ali  27  187.NPCQNGGSCEPTV---SGYICHCLLGVTGEQCQVDTDE. 222
474 1.000e-05gi|537228072|gb|ERE83519.1| sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Cricetulus griseus]  clstr ali  36 1194SNPCRNQATCVDEL---NSYSCKCRPGFSGHRCETE.... 1226
475 1.000e-05gi|528499025|ref|XP_005173110.1| PREDICTED: protocadherin Fat 4-like [Danio rerio]  clstr ali  25 1592SNPCQNGALCQNY---PGGFNCLCKSGFAGKACDSVIN.. 1626
476 1.000e-05gi|459186884|ref|XP_004227557.1| PREDICTED: protocadherin Fat 4-like, partial [Ciona intestinalis]  clstr ali  35 1516..PCFNGGSCIDGIL---THTCVCQFGTTGRNCEVN.... 1546
477 1.000e-05gi|297674308|ref|XP_002815174.1| PREDICTED: LOW QUALITY PROTEIN: protocadherin Fat 4 [Pongo abelii]  clstr ali  29 3949.SPCKNGAICQN---FPGSFNCVCKTGYTGKMCESSVN.. 3982
478 1.000e-05gi|402870407|ref|XP_003899216.1| PREDICTED: LOW QUALITY PROTEIN: protocadherin Fat 4 [Papio anubis]  clstr ali  29 3907.SPCKNGAVCQN---FPGSFNCVCKTGYTGKMCESSVN.. 3940
479 1.000e-05gi|119625608|gb|EAX05203.1| FAT tumor suppressor homolog 4 (Drosophila) [Homo sapiens]  clstr ali  29 3856.SPCKNGAICQN---FPGSFNCVCKTGYTGKMCESSVN.. 3889
480 1.000e-05gi|556979808|ref|XP_005996716.1| PREDICTED: versican core protein [Latimeria chalumnae]  clstr ali  36  398SNPCRNGATCIDGI---NTFTCLCLPSYAGALCETDT-ET 433
481 1.000e-05gi|562835694|ref|XP_006147156.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Tupaia chinensis]  clstr ali  42 1078.SPCDNGGTCIDQV---NGFVCLCLPSYGGSLCEKDT... 1110
482 1.000e-05gi|602646126|ref|XP_007429497.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like, partial [Python bivittatus]  clstr ali  45  779.CGCLNGGICITNINFPGEYLCMCPSEFEGERCQ...... 814
483 1.000e-05gi|542179787|ref|XP_005495992.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Zonotrichia albicollis]  clstr ali  38  45.NKCYNGGRCSQAYYSPQLFVCQCHPGFSGKQCEIDT... 80
484 1.000e-05gi|307173920|gb|EFN64668.1| Protein eyes shut [Camponotus floridanus]  clstr ali  50  73NHPCLNNGTCVDY----DGIICQCPEGYSGDYCEIDAS.. 106
485 1.000e-05gi|589943282|ref|XP_006984345.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Peromyscus maniculatus bairdii]  clstr ali  52 1180SCDCLNGGSCVSDRKFSGAYLCVCLPGFHGGLCEVDAS.. 1220
486 1.000e-05gi|611967905|ref|XP_007479422.1| PREDICTED: lactadherin isoform X1 [Monodelphis domestica]  clstr ali  51  33...CLNGGTCLNGSESSTFY-CLCPDGFTGQNC....... 61
487 1.000e-05gi|565317683|gb|ETE69094.1| Pikachurin, partial [Ophiophagus hannah]  clstr ali  45  800SAPCDNGGSCVPKK---DGYECDCPLGFEGQNCQ...... 830
488 2.000e-05gi|641763366|ref|XP_008166973.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Chrysemys picta belli  clstr ali  33  976..PCHNNGTCKQL---GSGYICMCPPGYTGK-CEKEIDE. 1008
489 2.000e-05gi|260782454|ref|XP_002586302.1| hypothetical protein BRAFLDRAFT_82908 [Branchiostoma floridae]  clstr ali  45  257...CQNGGICTSCFNDSAAF-CDCPAGFDGKTCEIDIDE. 291
490 2.000e-05gi|556761780|ref|XP_005976194.1| PREDICTED: LOW QUALITY PROTEIN: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [  clstr ali  32 1303..PCHNNGICKDRV---GEFICECPSGYTGQLCEENVNE. 1336
491 2.000e-05gi|432091556|gb|ELK24581.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Myotis davidii]  clstr ali  30 1106SSPCLNNAVCEDQV---GRFLCKCPAGFWGTRCEKNMDE. 1141
492 2.000e-05gi|47227548|emb|CAG04696.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  30 1725SNPCQNQGSCVPDPH--SGFTCACSEFYTGKSCET..... 1757
493 2.000e-05gi|488538962|ref|XP_004461111.1| PREDICTED: LOW QUALITY PROTEIN: neurocan core protein [Dasypus novemcinctus]  clstr ali  42  826.SPCANGGTCVDEVA---GFACLCLPSYGGSLCEKDT... 858
494 2.000e-05gi|573882072|ref|XP_006629223.1| PREDICTED: protocadherin Fat 4-like [Lepisosteus oculatus]  clstr ali  43 4148.NVCKHGGTCVDNWSWQ---QCKCMEGFTGKYCE...... 4177
495 2.000e-05gi|307211937|gb|EFN87851.1| Protein eyes shut [Harpegnathos saltator]  clstr ali  41  56SNPCLNGGTCNDGIA---SYNCTCTDGFVGVNCE...... 86
496 2.000e-05gi|444726601|gb|ELW67125.1| Neurocan core protein [Tupaia chinensis]  clstr ali  42  962.SPCDNGGTCIDQV---NGFVCLCLPSYGGSLCEKDT... 994
497 2.000e-05gi|157278399|ref|NP_001098301.1| tissue-type plasminogen activator precursor [Oryzias latipes]  clstr ali  45  87...CYNGGTCKESVYTSD-YICQCPQGFKGAQCEINSNE. 121
498 2.000e-05gi|634831950|ref|XP_007933214.1| PREDICTED: tissue-type plasminogen activator isoform X2 [Orycteropus afer afer]  clstr ali  42  45...CFNGGICWQALYFSDFV-CQCHEGFVGKRCETDAKA. 79
499 2.000e-05gi|532042020|ref|XP_005363848.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Microtus ochrogaster]  clstr ali  50 1172.CDCLNGGSCESDRKFSGAYLCVCLPGFHGRLCEVDA... 1210
500 2.000e-05gi|571565148|ref|XP_006565329.1| PREDICTED: protein eyes shut-like isoform X1 [Apis mellifera]  clstr ali  47  124NQPCLNNGTCLDY----DGITCQCPDGYSGDYCEIDAS.. 157
501 2.000e-05gi|383850315|ref|XP_003700741.1| PREDICTED: protein eyes shut-like [Megachile rotundata]  clstr ali  47  113NHPCLNNGTCLDY----DGITCQCPDGYSGDYCEIDAS.. 146
502 2.000e-05gi|543347278|ref|XP_005519186.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Pseudopodoces humilis]  clstr ali  44 1471SCDCLNNGTCVTNINFSGRYLCVCVAGFEGDLCQVNTD.. 1511
503 2.000e-05gi|47214446|emb|CAF95781.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  45  90..PCQNNGVCVSM---GNAYQCLCPEGFNGRHCETKVE.. 122
504 2.000e-05gi|641766290|ref|XP_008167998.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Chrysemys picta bellii]  clstr ali  40  788.CSCMNGGSCVTNINFPGEYLCICPNGFDGNFCQENIN.. 827
505 2.000e-05gi|551495922|ref|XP_005799521.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Xiphophorus maculatus]  clstr ali  39 1191SCDCFNAASCITNPAGSGEYVCVCPDGFTGRRCEVDVD.. 1231
506 2.000e-05gi|591365353|ref|XP_007057545.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Chelonia mydas]  clstr ali  40  876.CSCMNGGSCVTNINFPGEYLCICPSGFDGNFCQENIN.. 915
507 2.000e-05gi|597787433|ref|XP_007257154.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Astyanax mexicanus]  clstr ali  43 1116.CGCMNGGTCVTNVERPGEYLCVCPSGFGGDLCQEETD.. 1155
508 2.000e-05gi|195168024|ref|XP_002024832.1| GL17893 [Drosophila persimilis]  clstr ali  43  194...CQNGGNCTAP------QTCSCPSGYTGRHCEVDVNE. 223
509 2.000e-05gi|585672658|ref|XP_006889604.1| PREDICTED: pikachurin [Elephantulus edwardii]  clstr ali  35  766..PCAHGGSCRPRK---DGYECDCPLGFEGRHCQKAITE. 799
510 2.000e-05gi|612006750|ref|XP_007487497.1| PREDICTED: pikachurin isoform X1 [Monodelphis domestica]  clstr ali  48  807..PCANGGSCRPRK---DGYECDCPLGFDGQHCQ...... 835
511 3.000e-05gi|405966781|gb|EKC32021.1| Fibropellin-3, partial [Crassostrea gigas]  clstr ali  36  120SGPCQNYGTCTDLL---NDYNCSCVPGFNGTNCENN.... 152
512 3.000e-05gi|528484888|ref|XP_695742.6| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Danio rerio]  clstr ali  43 1391.NLCLNGATCVDGVA---TFTCRCPPGFNGTRCETE.... 1422
513 3.000e-05gi|405973160|gb|EKC37890.1| Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Crassostrea gigas]  clstr ali  38  394.SPCLNNGVCQQRL---GGYNCTCPTGFRGTNCEINHD.. 427
514 3.000e-05gi|542228655|ref|XP_005453169.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Oreochromis nilo  clstr ali  30 1255SAPCQNGGLCKD---GMGDFQCQCKPGFLGSLCEAEVNE. 1290
515 3.000e-05gi|557026516|ref|XP_006013378.1| PREDICTED: neurogenic locus notch homolog protein 2-like [Latimeria chalumnae]  clstr ali  27  378.QPCQNGGVCKVAFNTPRGYTCRCQPNYSGLNCEKSI... 413
516 3.000e-05gi|390341181|ref|XP_790463.3| PREDICTED: uncharacterized protein LOC585547 [Strongylocentrotus purpuratus]  clstr ali  32  125SNPCEDGGECNDD---GGSYTCTCTSGFMGENCE...... 155
517 3.000e-05gi|321466601|gb|EFX77596.1| hypothetical protein DAPPUDRAFT_30003 [Daphnia pulex]  clstr ali  27 1147SGPCHQGATCLDKIL---GYVCVCPPGMAGSRCELEVDE. 1182
518 3.000e-05gi|260814370|ref|XP_002601888.1| hypothetical protein BRAFLDRAFT_124580 [Branchiostoma floridae]  clstr ali  36 2114SNPCRNGGNCVDRV---DGYTCTCVGHYMGTHC....... 2143
519 3.000e-05gi|350424245|ref|XP_003493733.1| PREDICTED: protein eyes shut-like [Bombus impatiens]  clstr ali  47  113NQPCLNNGTCLDY----DGITCQCPDGYSGDYCEIDAS.. 146
520 3.000e-05gi|198427732|ref|XP_002123603.1| PREDICTED: fibropellin-1-like [Ciona intestinalis]  clstr ali  48  179..PCQNNGTCVAME---TIYRCDCPPGYIGGNCEID.... 209
521 3.000e-05gi|507667021|ref|XP_004707730.1| PREDICTED: tissue-type plasminogen activator [Echinops telfairi]  clstr ali  45  92...CFSGGLCRQAVYFSDFV-CQCPEGFLGKRCEIDQDS. 126
522 3.000e-05gi|537231807|gb|ERE84239.1| agrin-like isoform 1 [Cricetulus griseus]  clstr ali  50 1716.NPCLNGGSCVPREA---TYECLCPGGFSGLHCE...... 1745
523 3.000e-05gi|292616627|ref|XP_002663097.1| PREDICTED: tissue-type plasminogen activator [Danio rerio]  clstr ali  45  87...CYNGGTCKEALYSSDF-ICQCPPGFTGTQCEINTLE. 121
524 3.000e-05gi|542153502|ref|XP_005485622.1| PREDICTED: LOW QUALITY PROTEIN: cadherin EGF LAG seven-pass G-type receptor 3 [Zonotrichia albicollis]  clstr ali  43 1352SNPCKNGGTCSVSW---GTYSCLCPVGFGGKDC....... 1381
525 4.000e-05gi|505768687|ref|XP_004600512.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Sorex araneus]  clstr ali  28 1314.NPCFHNAICEDQV---GGFLCKCPPGFLGTLCEKDLDE. 1348
526 4.000e-05gi|47215753|emb|CAG05764.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  30  523SAPCQNGGLCKD---GMGEFQCQCKPGFLGSLCEAEVNE. 558
527 4.000e-05gi|358413651|ref|XP_002705103.2| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [Bos taurus]  clstr ali  32 1104..PCHNNGICKDRV---GEFICECPSGYTGQLCEDNVNE. 1137
528 4.000e-05gi|528754676|gb|EPY74335.1| FAT tumor suppressor 4 isoform 1-like protein [Camelus ferus]  clstr ali  31 2109.SPCKNGAVCQN---FPGSFNCVCKTGYTGKHCELN.... 2143
529 4.000e-05gi|545843488|ref|XP_005666519.1| PREDICTED: protein delta homolog 1-like [Sus scrofa]  clstr ali  34  248SNPCANNGTC--ANLDNGQYECSCPPGFSGRDCQ...... 279
530 4.000e-05gi|585640453|ref|XP_006880440.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Elephantulus edwardii]  clstr ali  50 1183SCDCLNGGSCVSDPSGSGGNLCVCLPGFQGDLCEVDIS.. 1223
531 4.000e-05gi|156362527|ref|XP_001625828.1| predicted protein [Nematostella vectensis]  clstr ali  53  123..SCLNGGTCQ--KTDEDAFRCTCPPEFIGKHCE...... 152
532 4.000e-05gi|507937604|ref|XP_004679614.1| PREDICTED: coagulation factor XII [Condylura cristata]  clstr ali  51  101NSPCQNGGTCVNMPGGPH---CICPESFTGKHCE...... 131
533 4.000e-05gi|617451471|ref|XP_007568747.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Poecilia formosa]  clstr ali  44 1212.CGCLNGGTCVSFPAGSGKYLCVCPGGKQGELCGEDVDQ. 1252
534 5.000e-05gi|625241367|ref|XP_007611919.1| PREDICTED: protein delta homolog 1 isoform X2 [Cricetulus griseus]  clstr ali  34  329STPCANNGTCVDLEK--GQYECSCAPGFSGKDCQ...... 360
535 5.000e-05gi|617436798|ref|XP_007563718.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 isoform X1 [Poecilia f  clstr ali  30 1246SAPCQNGGLCRD---GMGDFQCQCKPGFLGALCEGEVNE. 1281
536 5.000e-05gi|585650438|ref|XP_006814579.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Saccoglossus kow  clstr ali  31  816.NSCYNNATCMDKV---NGFSCHCMQGYSGILCDIDINE. 850
537 5.000e-05gi|584015744|ref|XP_006802632.1| PREDICTED: protein crumbs homolog 2-like [Neolamprologus brichardi]  clstr ali  36  458...CLNGGVCIGGDSGGN---CTCKPGYAGDRCETEIDE. 490
538 5.000e-05gi|198412866|ref|XP_002119207.1| PREDICTED: uncharacterized protein LOC100181677 [Ciona intestinalis]  clstr ali  37  436STPCLNGGTCTDGVA---SFTCACVNGYIGDICET..... 467
539 5.000e-05gi|556769916|ref|XP_005980158.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Pantholops hodgsonii]  clstr ali  48  797SCDCLNGGSCVSDTKFSGAHLCVCLPGFHGDLCEKNVTE. 838
540 5.000e-05gi|507646501|ref|XP_004702884.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Echinops telfairi]  clstr ali  48  947SCACLNGGSCVSDSPGSGAHLCVCLPGFQGDHCGVDI... 986
541 5.000e-05gi|557280183|ref|XP_006023096.1| PREDICTED: tissue-type plasminogen activator [Alligator sinensis]  clstr ali  42  85...CYNGGRCRQALYSPQHFICLCRRGFSGQQCEIDTE.. 119
542 5.000e-05gi|583995728|ref|XP_006792987.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Neolamprologus brichardi]  clstr ali  39 1178.CGCQNGGSCVTDINFSGKYLCVCPEGTQGELCADDIDE. 1218
543 5.000e-05gi|530620088|ref|XP_005299728.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein-like [Chrysemys picta bellii]  clstr ali  40  664.CSCMNGGSCVTNINFPGEYLCICPNGFDGNFCQENIN.. 703
544 5.000e-05gi|564354440|ref|XP_006239599.1| PREDICTED: agrin isoform X1 [Rattus norvegicus]  clstr ali  50 1826.NPCLNGGSCVPREA---TYECLCPGGFSGLHCE...... 1855
545 5.000e-05gi|465975585|gb|EMP34160.1| Tyrosine-protein kinase receptor Tie-1 [Chelonia mydas]  clstr ali  46  198DCPCLNGGICHD-----GVGECICPPGFMGTRCE...... 227
546 6.000e-05gi|557331264|ref|XP_006038481.1| PREDICTED: protein delta homolog 1-like [Alligator sinensis]  clstr ali  36  182SNPCKNGGTCTD---IGAGYSCHCPHGYTGKSC....... 211
547 6.000e-05gi|260782456|ref|XP_002586303.1| hypothetical protein BRAFLDRAFT_82909 [Branchiostoma floridae]  clstr ali  45  182...CQNGGICTSCFNDSAAF-CDCPAGFDGKTCEIDIDE. 216
548 6.000e-05gi|511873659|ref|XP_004757006.1| PREDICTED: epidermal growth factor-like protein 7 isoform X10 [Mustela putorius furo]  clstr ali  45  135..PCQNGGTCVQPG------RCHCPAGWRGDTCQIDVDE. 165
549 6.000e-05gi|513220739|ref|XP_004947670.1| PREDICTED: tissue-type plasminogen activator isoform X3 [Gallus gallus]  clstr ali  37  98.NKCYNGGQCSQAYYSPQLFICRCHHGFSGKQCEIDTE.. 134
550 6.000e-05gi|564303636|ref|XP_006224956.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Rattus norvegicus]  clstr ali  44 1189SCDCLNGGSCVTDRKFPGAYLCDCLPGFSGDLCEVEAS.. 1229
551 6.000e-05gi|351695636|gb|EHA98554.1| Pikachurin [Heterocephalus glaber]  clstr ali  41  810..PCAHGGSCQPRK---EGYECDCPLGFEGLHCQ...... 838
552 6.000e-05gi|525011115|ref|XP_005053175.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 3, partial [Ficedula albicollis]  clstr ali  43 1405SSPCKNGGTCSVSW---GTYSCLCPVGFGGKDC....... 1434
553 6.000e-05gi|512810563|ref|XP_004910507.1| PREDICTED: pikachurin isoform X2 [Xenopus (Silurana) tropicalis]  clstr ali  38  816NIPCANGGSCRPQH---DSYECDCPLGFDGKNCQ...... 846
554 7.000e-05gi|260821750|ref|XP_002606266.1| hypothetical protein BRAFLDRAFT_83982 [Branchiostoma floridae]  clstr ali  35  444..PCQNGGVCTSS---GDSYTCECVDGWGGPDCQTDDDE. 477
555 7.000e-05gi|348578597|ref|XP_003475069.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Cavia porcellus]  clstr ali  43 1181SCDCLNGGSCVPDRKFSGAYLCICLPGFHGGLCEVAVDA. 1222
556 7.000e-05gi|591350649|ref|XP_007053316.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Chelonia mydas]  clstr ali  42 1158SCDCLNGGSCVTNIHYSGKYLCVCLPGFEGDLCQVNFD.. 1198
557 7.000e-05gi|74095907|ref|NP_001027780.1| coagulation factor VIIb precursor [Takifugu rubripes]  clstr ali  48  92..PCQNNGVCVSM---GNTYQCHCPEGFGGQRCETKAE.. 124
558 7.000e-05gi|562868091|ref|XP_006162128.1| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Tupaia chinensis]  clstr ali  46 1183SCDCLNGGSCVSDPPGSGMYTCFCMPGFKGSLCEVSASE. 1224
559 7.000e-05gi|380022847|ref|XP_003695247.1| PREDICTED: protein eyes shut-like [Apis florea]  clstr ali  47  108NQPCLNNGTCLDY----DGITCQCPDGYSGDYCEIDAS.. 141
560 7.000e-05gi|533143429|ref|XP_005386281.1| PREDICTED: pikachurin isoform X1 [Chinchilla lanigera]  clstr ali  35  800..PCAHGGSCRPRK---EGYECDCPLGFEGLHCQKAITE. 833
561 8.000e-05gi|344243172|gb|EGV99275.1| Slit-like 1 protein [Cricetulus griseus]  clstr ali  44 1043...CQNGAQCVDEV---NSYSCLCAEGYSGQFCEI..... 1071
562 8.000e-05gi|328702918|ref|XP_003242041.1| PREDICTED: cubilin-like [Acyrthosiphon pisum]  clstr ali  30  474SNPCQNNGLCLPELEPGD-YTCTCTSGYYGQYCE...... 506
563 8.000e-05gi|459177111|ref|XP_004226190.1| PREDICTED: uncharacterized protein LOC101242992 [Ciona intestinalis]  clstr ali  37  405.NPCNNGGTCLDGI---NDYTCYCMDGYIGDTCRTD.... 436
564 8.000e-05gi|584043665|ref|XP_006766696.1| PREDICTED: protein delta homolog 1 [Myotis davidii]  clstr ali  31  264SNPCANNGTCTTMQK--GHYQCTCAPGFSGENCQ...... 295
565 8.000e-05gi|242005391|ref|XP_002423552.1| predicted protein [Pediculus humanus corporis]  clstr ali  38 4119HNPCINGGMC---YPEGDSYSCSCPEGYTGRHCE...... 4149
566 8.000e-05gi|645002338|ref|XP_008209926.1| PREDICTED: LOW QUALITY PROTEIN: neural-cadherin [Nasonia vitripennis]  clstr ali  38 2331NNPCHNGGRCVEGRF---GLTCQCPAGYNGPRCQ...... 2361
567 8.000e-05gi|498968042|ref|XP_004526212.1| PREDICTED: protein vein-like isoform X1 [Ceratitis capitata]  clstr ali  53  895...CLNGGTC---NFFSEIYSCICPEGFMGERCD...... 924
568 9.000e-05gi|524941651|ref|XP_005072510.1| PREDICTED: protein delta homolog 2 [Mesocricetus auratus]  clstr ali  38  135.SPCQNGGQCV--YDGGGEYHCVCLPGFHGRGCE...... 165
569 9.000e-05gi|405960948|gb|EKC26815.1| Sushi, nidogen and EGF-like domain-containing protein 1 [Crassostrea gigas]  clstr ali  31  353SSPCVHG-NCTDQV---NGYVCECIPGYTGVICETD.... 384
570 9.000e-05gi|582014472|dbj|BAO49753.1| C-type lectin [Ruditapes philippinarum]  clstr ali  43  192.SPCKNGGECVD---GDNSYTCTCPPNTAGDNCE...... 221
571 9.000e-05gi|646722981|gb|KDR23766.1| Basement membrane-specific heparan sulfate proteoglycan core protein [Zootermopsis nevadensis]  clstr ali  35 2930.NPCLNQGVCQEATELQG-YSCICPPGFSGLNC....... 2960
572 9.000e-05gi|449493006|ref|XP_002189116.2| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Taeniopygia guttata]  clstr ali  42 1254SCDCLNNGSCVTNINFSGRYLCVCVAGFEGDLCQVNTD.. 1294
573 1.000e-04gi|584021877|ref|XP_006805601.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Neolamprologus b  clstr ali  31  248.NPCVNGASCLDGL---GSYTCRCLPGFNGTRCETE.... 279
574 1.000e-04gi|586549867|ref|XP_006910002.1| PREDICTED: LOW QUALITY PROTEIN: sushi, nidogen and EGF-like domain-containing protein 1 [Pteropus alecto]  clstr ali  29  792.SPCANGGTC---EGLGTGFSCRCRAGYTGRRCQAEVD.. 825
575 1.000e-04gi|556981563|ref|XP_005997245.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1-like [Latimeria chalumnae]  clstr ali  41  394SSPCLNGGECIDLV---DNYTCVCPQSHTGKHCE...... 424
576 1.000e-04gi|597791710|ref|XP_007258966.1| PREDICTED: protein delta homolog 1 [Astyanax mexicanus]  clstr ali  43  214.NPCLNGGTCRDNGL---GYTCVCLSGFSGPTCNIN.... 245
577 1.000e-04gi|594661527|ref|XP_007178990.1| PREDICTED: uncharacterized protein LOC103010286 [Balaenoptera acutorostrata scammoni]  clstr ali  34  505STPCANNGTCVNL--DNGQYECSCAPGFSGKDCQ...... 536
578 1.000e-04gi|260792245|ref|XP_002591126.1| hypothetical protein BRAFLDRAFT_105530 [Branchiostoma floridae]  clstr ali  40  399...CVNGATCK-GCFNSLITTCDCQAGFTGERCEININE. 433
579 1.000e-04gi|410930456|ref|XP_003978614.1| PREDICTED: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1-like [Takifugu rubripe  clstr ali  30 1240SAPCQNGGLCND---GMGEFQCDCKPGFIGAVCEAEVNE. 1275
580 1.000e-04gi|586984042|ref|XP_006930937.1| PREDICTED: LOW QUALITY PROTEIN: protocadherin Fat 4 [Felis catus]  clstr ali  29 3867..PCKNGAVCQN---VPGSFNCVCKTGYTGKHCELN.... 3900
581 1.000e-04gi|431921903|gb|ELK19106.1| Crumbs like protein 1 [Pteropus alecto]  clstr ali  27  279SKPCHNNATCEDS---AGNYTCHCRPGYTGAQCETDVDE. 314
582 1.000e-04gi|403259486|ref|XP_003922243.1| PREDICTED: hyaluronan-binding protein 2 isoform 2 [Saimiri boliviensis boliviensis]  clstr ali  44  168.NPCQNGGTCSRHKRKSKF-TCVCPDQFKGRFCEIGSD.. 203
583 1.000e-04gi|611988306|ref|XP_007481075.1| PREDICTED: protein crumbs homolog 1 [Monodelphis domestica]  clstr ali  44  232..PCLNGGTCQDSV---GRYFCDCASGFRGEHCEINTNE. 265
584 1.000e-04gi|537242010|gb|ERE87358.1| putative neurogenic locus notch-like protein [Cricetulus griseus]  clstr ali  41  242..SCLNGGTCQRVPGDTAFHLCLCPPGFTGLNCEMNPD.. 277
585 1.000e-04gi|543742882|ref|XP_005512288.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Columba livia]  clstr ali  39 1176SCDCLNNGSCVTNINFPGRYLCVCVAGFEGDLCQVNTD.. 1216
586 1.000e-04gi|527270309|ref|XP_005153111.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Melopsittacus undulatus]  clstr ali  43 1219.CDCLNNGSCVTNINFSGRYLCVCVAGFEGDLCQVNTD.. 1258
587 1.000e-04gi|296209590|ref|XP_002751576.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Callithrix jacchus]  clstr ali  47 1183SCDCLNGGSCVSDPPGSGVYLCVCLPGFYGSLCDVDIS.. 1223
588 1.000e-04gi|459177776|ref|XP_002121384.2| PREDICTED: fibropellin-1-like [Ciona intestinalis]  clstr ali  41  168..PCKNGGTC-EMKDNRIEYECICPDGYEGYHCETDIDE. 203
589 1.000e-04gi|513168561|ref|XP_418688.4| PREDICTED: LOW QUALITY PROTEIN: von Willebrand factor D and EGF domain-containing protein [Gallus gallus]  clstr ali  42 1190SCDCLNNGSCVTNINFSGRYLCVCVAGFEGDLCQVNTD.. 1230
590 1.000e-04gi|576693235|gb|EUB56854.1| hypothetical protein EGR_08260 [Echinococcus granulosus]  clstr ali  38  281...CQNGGKCRDLAGNVGAYICVCPPGWWGKHCE...... 311
591 1.000e-04gi|617397465|ref|XP_007551297.1| PREDICTED: hepatocyte growth factor activator [Poecilia formosa]  clstr ali  43  92.NPCQNGGVCTAIPQTGSFH-CSCPENFTGRHCE...... 123
592 1.000e-04gi|524986522|ref|XP_005041206.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Ficedula albicollis]  clstr ali  42 1241SCDCLNNGSCVTNINFSGRYLCVCVAGFEGDLCQVNTD.. 1281
593 1.000e-04gi|195155733|ref|XP_002018755.1| GL25782 [Drosophila persimilis]  clstr ali  48 2328...CQNGATCVDN---GAGYSCQCPAGFTGRNCEQDI... 2358
594 1.000e-04gi|514726613|ref|XP_005015205.1| PREDICTED: von Willebrand factor D and EGF domain-containing protein [Anas platyrhynchos]  clstr ali  42 1215SCDCLNNGSCVTNINFSGRYLCVCVAGFEGDLCQVNTD.. 1255
595 1.000e-04gi|156362038|ref|XP_001625589.1| predicted protein [Nematostella vectensis]  clstr ali  43  177.NPCLNGGKC-KHGTMNETFRCICPKGFEGLNCE...... 208
596 1.000e-04gi|597859952|gb|EYC09371.1| hypothetical protein Y032_0060g3076 [Ancylostoma ceylanicum]  clstr ali  40  122.NPCLHNGTCRTTAGFSS-YFCDCKDGYGGKNCDIAISK. 158
597 1.000e-04gi|466002965|gb|EMP41920.1| von Willebrand factor D and EGF domain-containing protein [Chelonia mydas]  clstr ali  42  317SCDCLNGGSCVTNIHYSGKYLCVCLPGFEGDLCQVNFD.. 357
598 1.000e-04gi|551512972|ref|XP_005808000.1| PREDICTED: zonadhesin-like, partial [Xiphophorus maculatus]  clstr ali  50 1493..PCLNGGTCVTANN--NAYTCACPEGFYGQNCEMEVT.. 1526
599 1.000e-04gi|532027361|ref|XP_005356655.1| PREDICTED: pikachurin isoform X2 [Microtus ochrogaster]  clstr ali  40  788.NPCANGGSCRPRK---EGYECDCPLGFEGMNCQ...... 817
600 1.000e-04gi|545496332|ref|XP_005619433.1| PREDICTED: pikachurin isoform X3 [Canis lupus familiaris]  clstr ali  35  801..PCAHGGSCRPRK---EGYECDCPLGFEGLHCQKAITE. 834
601 1.000e-04gi|594078724|ref|XP_006063051.1| PREDICTED: pikachurin isoform X1 [Bubalus bubalis]  clstr ali  35  801..PCAHGGSCRPRK---EGYECDCPLGFEGLHCQKAITE. 834
602 1.000e-04gi|444712552|gb|ELW53473.1| Pikachurin [Tupaia chinensis]  clstr ali  35  844..PCAHGGSCRPRK---EGYECDCPLGFEGPHCQKAITE. 877
603 1.000e-04gi|431896774|gb|ELK06078.1| Pikachurin [Pteropus alecto]  clstr ali  35  791..PCTHGGSCRPRK---EGYECDCPLGFEGLHCQKAITE. 824
604 1.000e-04gi|529420557|ref|XP_005230137.1| PREDICTED: LOW QUALITY PROTEIN: cadherin EGF LAG seven-pass G-type receptor 3 [Falco peregrinus]  clstr ali  43 1354SSPCKNGGTCSVSW---GTYSCLCPVGFGGKDC....... 1383
605 1.000e-04gi|198475483|ref|XP_002132931.1| GA26093 [Drosophila pseudoobscura pseudoobscura]  clstr ali  33 2368.NPCHNGGRCIDTRFGPH---CSCPVGYTGPRCQ...... 2397
606 1.000e-04gi|585683736|ref|XP_006812462.1| PREDICTED: protocadherin Fat 4-like [Saccoglossus kowalevskii]  clstr ali  41 2995..PCLNNGTCIPQDA---GYLCICPKNYTGPQCD...... 3023
607 1.000e-04gi|390353700|ref|XP_786113.2| PREDICTED: uncharacterized protein LOC580994 [Strongylocentrotus purpuratus]  clstr ali  45  809...CLNGGTCVPPGNGETIATCSCASDYEGRRCEVEKS.. 843
608 2.000e-04gi|507946079|ref|XP_004682068.1| PREDICTED: protein delta homolog 1 [Condylura cristata]  clstr ali  33  131SAPCANNGTCLNL--GDGSYECSCPPGFSGKDCQL..... 163
609 2.000e-04gi|390364043|ref|XP_795071.3| PREDICTED: uncharacterized protein LOC590372 [Strongylocentrotus purpuratus]  clstr ali  34 1813..PCQNGGRCIN---GQGRYTCTCRLGYSGLNCE...... 1841
610 2.000e-04gi|161466|gb|AAA62163.1| fibropellin Ib [Strongylocentrotus purpuratus]  clstr ali  42  524SDPCLNGGICVDGV---NGFVCQCPPNYSGTYCEISLD.. 558
611 2.000e-04gi|555708756|gb|ESO11989.1| hypothetical protein HELRODRAFT_158374 [Helobdella robusta]  clstr ali  38  356SNPCLNNATCIDHEA---HYKCNCQPSYGGTNCE...... 386
612 2.000e-04gi|443731506|gb|ELU16611.1| hypothetical protein CAPTEDRAFT_220964 [Capitella teleta]  clstr ali  25  267SDPCQNGAECI----HGAAYECTCVYGYTGVNCETLFDE. 301
613 2.000e-04gi|560982164|ref|XP_006213313.1| PREDICTED: protein crumbs homolog 1-like [Vicugna pacos]  clstr ali  36 1139SNPCLHGGLCRDLL---DRFQCVCDVAFTGPRCEMD.... 1171
614 2.000e-04gi|260790079|ref|XP_002590071.1| hypothetical protein BRAFLDRAFT_123438 [Branchiostoma floridae]  clstr ali  46  547..PCMNGGTCLDRV---NGYVCRCPEGYGGHNC....... 574
615 2.000e-04gi|260791944|ref|XP_002590987.1| hypothetical protein BRAFLDRAFT_69462 [Branchiostoma floridae]  clstr ali  42  487SSPCLGGGTCVDQI---GSYKCNCPKGTAGDRCEAVVD.. 521
616 2.000e-04gi|640786996|ref|XP_008049261.1| PREDICTED: protein crumbs homolog 2, partial [Tarsius syrichta]  clstr ali  30  280SRPCLNRGRCQDL---PSGFQCHCPDGYAGLTCQEDVDE. 315
617 2.000e-04gi|260794967|ref|XP_002592478.1| hypothetical protein BRAFLDRAFT_68964 [Branchiostoma floridae]  clstr ali  41  295.NECLNGGNCI--ACFSDFSMCRCHPGYTGAFCEIDIDE. 330
618 2.000e-04gi|556733080|ref|XP_005962192.1| PREDICTED: protein crumbs homolog 2 [Pantholops hodgsonii]  clstr ali  25  210SAPCANNASCLEGL---GSFRCLCWPGYSGERCEVDEDE. 245
619 2.000e-04gi|380015973|ref|XP_003691968.1| PREDICTED: neurogenic locus protein delta-like [Apis florea]  clstr ali  25  307.SPCHHGASCEDDSLH--GYVCRCPPGYTGNDCESQLD.. 341
620 2.000e-04gi|195148816|ref|XP_002015359.1| GL19662 [Drosophila persimilis]  clstr ali  36 1093.NPCTHGGTCWSS---GESFYCACRPGYTGTMCE...... 1122
621 2.000e-04gi|260789858|ref|XP_002589961.1| hypothetical protein BRAFLDRAFT_81597 [Branchiostoma floridae]  clstr ali  40  261...CVNGATCK-GCFNSLITTCDCQAGFTGERCEININE. 295
622 2.000e-04gi|607361271|gb|EZA55563.1| Protein eyes shut [Cerapachys biroi]  clstr ali  50  231...CDNGGTCIDGI---NSFTCSCPSGYGGPMCE...... 258
623 2.000e-04gi|260791908|ref|XP_002590969.1| hypothetical protein BRAFLDRAFT_69480 [Branchiostoma floridae]  clstr ali  31  157SAPCQNGAICQDGV---NSFTCQCASGYYGTLCE-DIDE. 191
624 2.000e-04gi|410914413|ref|XP_003970682.1| PREDICTED: slit homolog 3 protein-like [Takifugu rubripes]  clstr ali  36 1080.NKCQHGAECVDAV---NGYTCVCKEGFSGLFCE...... 1109
625 2.000e-04gi|260818872|ref|XP_002604606.1| hypothetical protein BRAFLDRAFT_92840 [Branchiostoma floridae]  clstr ali  29 1226.SPCQYG-TCQDLVAD---YSCTCSAGYAGKDCEINIDE. 1259
626 2.000e-04gi|148703183|gb|EDL35130.1| mCG142341 [Mus musculus]  clstr ali  28 1812.SPCKHGAICQN---FPGGFNCVCKTGYTGKHCELN.... 1846
627 2.000e-04gi|512815753|ref|XP_004911174.1| PREDICTED: protocadherin Fat 4 isoform X2 [Xenopus (Silurana) tropicalis]  clstr ali  28 3894STPCKNGAVCQN---FPGGFNCVCKAGSTGKLCESAVN.. 3928
628 2.000e-04gi|405953973|gb|EKC21529.1| Protocadherin Fat 4 [Crassostrea gigas]  clstr ali  44 4032...CKNGGRCVEEWE---GFSCRCTLGFSGTTCEI..... 4060
629 2.000e-04gi|585187308|ref|XP_006745117.1| PREDICTED: protocadherin Fat 4-like [Leptonychotes weddellii]  clstr ali  27 3923.SPCQHGGMCMDYWSWQ---LCHCKEGLTGKYCEKSI... 3955
630 2.000e-04gi|545218880|ref|XP_005610861.1| PREDICTED: LOW QUALITY PROTEIN: sushi, nidogen and EGF-like domains 1 [Equus caballus]  clstr ali  43  261SDPCRNGGTCT---HGVNSFSCQCPAGFEGPTCET..... 292
631 2.000e-04gi|625201815|ref|XP_007642611.1| PREDICTED: delta-like protein 3 isoform X1 [Cricetulus griseus]  clstr ali  41  281.NPCANGGSCSE---VSGSFECTCPRGFYGLRCEV..... 311
632 2.000e-04gi|625253872|ref|XP_007618273.1| PREDICTED: LOW QUALITY PROTEIN: delta-like protein 3 isoform X2 [Cricetulus griseus]  clstr ali  41  259.NPCANGGSCSE---ISGSFECTCPRGFYGLRCEV..... 289
633 2.000e-04gi|355755827|gb|EHH59574.1| hypothetical protein EGM_09716 [Macaca fascicularis]  clstr ali  38  280.NPCANGGSCSET---PGSFECTCPRGFYGLRCEV..... 310
634 2.000e-04gi|338710096|ref|XP_001916441.2| PREDICTED: delta-like protein 3 [Equus caballus]  clstr ali  38  256.NPCANGGSCSET---PGSFECACPRGFYGLRCEV..... 286
635 2.000e-04gi|512880703|ref|XP_002942647.2| PREDICTED: neurogenic locus notch homolog protein 1-like [Xenopus (Silurana) tropicalis]  clstr ali  51  786...CQNGGTCV-----SETFSCLCPAGYTGEHCEEDIDE. 816
636 2.000e-04gi|449269433|gb|EMC80201.1| von Willebrand factor D and EGF domain-containing protein, partial [Columba livia]  clstr ali  39 1170SCDCLNNGSCVTNINFPGRYLCVCVAGFEGDLCQVNTD.. 1210
637 2.000e-04gi|260828675|ref|XP_002609288.1| hypothetical protein BRAFLDRAFT_86801 [Branchiostoma floridae]  clstr ali  48  213..SCLNGGTC---KDGINSFSCHCPAGYTGRICEINSD.. 245
638 2.000e-04gi|532057329|ref|XP_005371367.1| PREDICTED: delta-like protein 3 [Microtus ochrogaster]  clstr ali  35  318..PCFNGGLCVGGEEPDSAYVCHCPPGFQGSNCEKRVDR. 354
639 2.000e-04gi|160420133|ref|NP_001104187.1| uncharacterized protein LOC100126603 precursor [Xenopus laevis]  clstr ali  45  114..PCQNGGTCV------GSNKCECPAGWRGIHCQTDVDE. 144
640 2.000e-04gi|557295348|ref|XP_006030080.1| PREDICTED: hepatocyte growth factor activator [Alligator sinensis]  clstr ali  45  104.NPCKNGGTCFTA-YDRSYYHCTCPEEFTGRDCEI..... 136
641 2.000e-04gi|47228965|emb|CAG09480.1| unnamed protein product [Tetraodon nigroviridis]  clstr ali  45  121SNPCQNGGTCVA---GLNQYRCTCPQRWSGSHCQ...... 151
642 2.000e-04gi|532070055|ref|XP_005320860.1| PREDICTED: hyaluronan-binding protein 2 [Ictidomys tridecemlineatus]  clstr ali  44  139.NPCQNGGTCSRHKRRSRF-SCACPEQFSGRFCEIGPD.. 174
643 2.000e-04gi|504182401|ref|XP_004599601.1| PREDICTED: agrin [Ochotona princeps]  clstr ali  48 1797..PCLHGATCVPQEA---AYDCLCPPGFSGRHCE...... 1825
644 2.000e-04gi|557011313|ref|XP_006006255.1| PREDICTED: protein jagged-1-like [Latimeria chalumnae]  clstr ali  42  304..PCLNGGTCANTE--PDKYQCICEEGFHGQNCQIDIDE. 338
645 2.000e-04gi|556949791|ref|XP_005987462.1| PREDICTED: epidermal growth factor-like protein 7-like isoform X5 [Latimeria chalumnae]  clstr ali  45  111..PCQNGGTC------SKPNRCDCPPGWNGKHCQTDVDE. 141
646 2.000e-04gi|556104372|gb|ESO93024.1| hypothetical protein LOTGIDRAFT_232797 [Lottia gigantea]  clstr ali  55  975...CQNGATCVD---GLNTYACMCPSGYSGQHCEI..... 1003
647 2.000e-04gi|597768794|ref|XP_007248222.1| PREDICTED: zonadhesin-like [Astyanax mexicanus]  clstr ali  41 2272SSPCENGGTC--AESSDTSYTCTCPEGFTGTNCEIE.... 2305
648 2.000e-04gi|167534724|ref|XP_001749037.1| hypothetical protein [Monosiga brevicollis MX1]  clstr ali  46 4872SNPCLNGGVCVSLEA---TFECVCPQGFTGDTCEL..... 4903
649 2.000e-04gi|443708392|gb|ELU03513.1| hypothetical protein CAPTEDRAFT_228840 [Capitella teleta]  clstr ali  41  61DSPCENGGTCSSEDPYKWGYFCICPPNYGGRTCEVD.... 97
650 2.000e-04gi|585640024|ref|XP_006880229.1| PREDICTED: hyaluronan-binding protein 2 [Elephantulus edwardii]  clstr ali  41  127.NPCQNGGTC-SRQSRRSKFTCTCPEEFKGKFCEIGSD.. 162
651 2.000e-04gi|576697692|gb|EUB61232.1| Delta-like protein [Echinococcus granulosus]  clstr ali  38  474..PCLHGGKCVELAQDSDGYQCVCLSGYRGRHCELNDS.. 509
652 2.000e-04gi|504135605|ref|XP_004580278.1| PREDICTED: hyaluronan-binding protein 2 [Ochotona princeps]  clstr ali  38  216.NPCQNGGTCSQHKRRSRF-RCACPDQYWGRFCEVGPD.. 251
653 2.000e-04gi|405978776|gb|EKC43139.1| Deleted in malignant brain tumors 1 protein [Crassostrea gigas]  clstr ali  38  261SNPCRNGATCSEDYYYSRNYHCSCPRGYSGQNCD...... 294
654 2.000e-04gi|511826819|ref|XP_004738176.1| PREDICTED: pikachurin [Mustela putorius furo]  clstr ali  41  736..PCAHGGSCRPRK---ESYECDCPLGFEGLHCQ...... 764
655 2.000e-04gi|545877006|ref|XP_005672488.1| PREDICTED: pikachurin [Sus scrofa]  clstr ali  41  828..PCAHGGSCRPRK---EGYECDCPLGFEGLHCQ...... 856
656 2.000e-04gi|242004578|ref|XP_002423159.1| class D atypical G-protein coupled receptor GPRstn1, putative [Pediculus humanus corporis]  clstr ali  32 1980..PCENRGRCVHDSSFSKGYLCSCDDEYSGEYCETKVDQ. 2017
657 2.000e-04gi|61162132|dbj|BAD91055.1| Af2-cadherin [Artemia franciscana]  clstr ali  36 2225.NPCFNGGRCTE---TRNGAMCQCPSGYDGPRCQ...... 2254
658 2.000e-04gi|340722540|ref|XP_003399662.1| PREDICTED: neural-cadherin-like [Bombus terrestris]  clstr ali  38 2265NSPCYNGGRCVEGRFGLS---CQCPAGYNGPRCQ...... 2295
659 2.000e-04gi|528472382|ref|XP_002661027.3| PREDICTED: neurocan core protein [Danio rerio]  clstr ali  34  872SNPCENGGTCIDKE---DSFVCLCLPSYSGDRCERDTE.. 906
660 2.000e-04gi|528504705|ref|XP_001921123.3| PREDICTED: neural-cadherin [Danio rerio]  clstr ali  48 2516...CRNGGTCLAHSTKS--YQCRCPEGFRGQWCEIGQLKS 2550
661 2.000e-04gi|405973235|gb|EKC37959.1| Protocadherin Fat 1 [Crassostrea gigas]  clstr ali  40 2912...CSNGGVCKPYSQYMGYYTCECPDRFEGNQCEIDLD.. 2948
662 3.000e-04gi|260795571|ref|XP_002592778.1| hypothetical protein BRAFLDRAFT_65357 [Branchiostoma floridae]  clstr ali  37  369.NLCQNGGNCTSCFGGSTTF-CDCLEGYGGTLCEINIDE. 405
663 3.000e-04gi|545504201|ref|XP_005622350.1| PREDICTED: protein crumbs homolog 1 [Canis lupus familiaris]  clstr ali  27  192SDPCKNEATCLNEI---GRYTCICPRDYSGVNCEVEVDE. 227
664 3.000e-04gi|390352184|ref|XP_782020.3| PREDICTED: fibropellin-1-like [Strongylocentrotus purpuratus]  clstr ali  32  557..PCQNGATCIDAF---NAFSCACVYGWSGTTCNINIDE. 590
665 3.000e-04gi|546680978|gb|ERL91152.1| hypothetical protein D910_08492 [Dendroctonus ponderosae]  clstr ali  32 2179.NPCLLGSNCTDLV---NDFSCSCPAGFTGKRCQEKID.. 2212
666 3.000e-04gi|512839952|ref|XP_002932223.2| PREDICTED: protein crumbs homolog 1 [Xenopus (Silurana) tropicalis]  clstr ali  35  299..PCHNNATCLE---GSAKFTCLCLPGYTGSLCEMDISE. 332
667 3.000e-04gi|585692488|ref|XP_006821460.1| PREDICTED: uncharacterized protein LOC100366622, partial [Saccoglossus kowalevskii]  clstr ali  31  925.NQCLNGATCND---FLGGYNCTCADGYIGTTCQTEINE. 959
668 3.000e-04gi|241576133|ref|XP_002403554.1| LIN-12 protein, putative [Ixodes scapularis]  clstr ali  41  413.NPCLNGGICNDLI---NGFKCLCPVGFSGKKCEANED.. 446
669 3.000e-04gi|542248055|ref|XP_005460510.1| PREDICTED: cubilin-like [Oreochromis niloticus]  clstr ali  29  402NNPCVNG-QCVDITSNP-GYICNCNSGWEGVNCDQNINE. 438
670 3.000e-04gi|260835699|ref|XP_002612845.1| hypothetical protein BRAFLDRAFT_118409 [Branchiostoma floridae]  clstr ali  34 1893...CQNDATC---EPDGESFKCICPKGYAGTMCETNVD.. 1924
671 3.000e-04gi|565306491|gb|ETE61174.1| Crumbs-like 1, partial [Ophiophagus hannah]  clstr ali  50 1212...CQNGGTCVDDIY---SYSCKCPPEYSGPLCE...... 1239
672 3.000e-04gi|296190554|ref|XP_002806559.1| PREDICTED: LOW QUALITY PROTEIN: sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 [  clstr ali  37 1275.SPCLNKGICVDGVA---GYHCRCVKGYVGLHCEAEVNE. 1309
673 3.000e-04gi|410903360|ref|XP_003965161.1| PREDICTED: protein crumbs-like [Takifugu rubripes]  clstr ali  33 1362SNPCHNGGSCLDRF---NMFVCECPPDYTGSTCDVN.... 1394
674 3.000e-04gi|405953712|gb|EKC21321.1| Versican core protein [Crassostrea gigas]  clstr ali  29  69SNPCENQATCNNYV---NFFNCTCLPGFTGYRCQKGI... 102
675 3.000e-04gi|260791938|ref|XP_002590984.1| hypothetical protein BRAFLDRAFT_69465 [Branchiostoma floridae]  clstr ali  46  191SNPCWFGGTCVDGIRD---FICVCPKGFEGEKCEI..... 222
676 3.000e-04gi|332020477|gb|EGI60892.1| Cubilin [Acromyrmex echinatior]  clstr ali  34  442SNPCVHG-TCVPN--GANGFTCRCNSGYSGLTCSIPID.. 476
677 3.000e-04gi|195052917|ref|XP_001993395.1| GH13093 [Drosophila grimshawi]  clstr ali  36 1006.NPCQYGGTCVQFP--GSGYLCLCPLGKHGHYCEHN.... 1038
678 3.000e-04gi|410040006|ref|XP_003311018.2| PREDICTED: slit homolog 3 protein [Pan troglodytes]  clstr ali  35 1069.NDCENNATCVDGI---NNYVCICPPNYTGELCDEVID.. 1102
679 3.000e-04gi|195433705|ref|XP_002064848.1| GK15151 [Drosophila willistoni]  clstr ali  36 1266.NPCQYGGTCVQFP--GSGYLCLCPLGKHGHYCEHN.... 1298
680 3.000e-04gi|449681844|ref|XP_004209935.1| PREDICTED: delta-like protein C-like [Hydra vulgaris]  clstr ali  45  262SNPCLNNGSCIDLHAN---FECVCPGKYGGKQCEID.... 294
681 3.000e-04gi|637333404|ref|XP_008115096.1| PREDICTED: protein eyes shut homolog [Anolis carolinensis]  clstr ali  33  106SSPCKNQGRCVDRV---NSYRCLCREGFSGTLCEVEINE. 141
682 3.000e-04gi|301784025|ref|XP_002927441.1| PREDICTED: delta-like protein 3-like [Ailuropoda melanoleuca]  clstr ali  38  269.NPCANGGSCSET---PGSFECACPRGFYGLRCEV..... 299
683 3.000e-04gi|585183797|ref|XP_006743479.1| PREDICTED: LOW QUALITY PROTEIN: delta-like protein 3 [Leptonychotes weddellii]  clstr ali  38  240.NPCANGGSC---NETPGSFECACPRGFYGLRCEV..... 270
684 3.000e-04gi|390360995|ref|XP_787781.3| PREDICTED: uncharacterized protein LOC582746 [Strongylocentrotus purpuratus]  clstr ali  35  854..PCRNGGTCMDLI---DGYQCSCLDGYKGKDCEISI... 887
685 3.000e-04gi|148671398|gb|EDL03345.1| expressed sequence AU040377, isoform CRA_a [Mus musculus]  clstr ali  37  881..PCAHGGSCRPRK---EGYECDCPLGFEGLNCQ...... 909
686 3.000e-04gi|390460048|ref|XP_002806674.2| PREDICTED: LOW QUALITY PROTEIN: pikachurin [Callithrix jacchus]  clstr ali  41  847..PCAHGGSCRPRK---EGYDCDCPLGFEGLHCQ...... 875
687 3.000e-04gi|357612923|gb|EHJ68236.1| hypothetical protein KGM_05707 [Danaus plexippus]  clstr ali  34 1545NNPCLHGGKCVDRDPARR-YDCICTFGYAGHDCELE.... 1579
688 3.000e-04gi|328714938|ref|XP_001945353.2| PREDICTED: neural-cadherin [Acyrthosiphon pisum]  clstr ali  38 1542SSPCLNGGRCSDTRNGPT---CECPNGFNGPRCQ...... 1572
689 3.000e-04gi|328721195|ref|XP_001944272.2| PREDICTED: cadherin-related tumor suppressor [Acyrthosiphon pisum]  clstr ali  57 3946...CLNGGSCVSLKPG---YKCNCPNGLHGRHCD...... 3973
690 3.000e-04gi|512905311|ref|XP_004925912.1| PREDICTED: protein vein-like [Bombyx mori]  clstr ali  47  257...CLNGGTCIFFEMLRE-QACTCKDGFGGQRCEIKDVKS 292
691 4.000e-04gi|632935107|ref|XP_007887824.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 [Callorhinchus milii]  clstr ali  42  478.NPCQNGGTCNE---TDDGYVCNCPNEFAGSDCENEV... 510
692 4.000e-04gi|642088207|emb|CDQ83151.1| unnamed protein product [Oncorhynchus mykiss]  clstr ali  34  219SRPCENNGTCANEV---DHYECNCLLGFKGVNCEVEID.. 253
693 4.000e-04gi|620971004|ref|XP_007660963.1| PREDICTED: neurocan core protein-like, partial [Ornithorhynchus anatinus]  clstr ali  41  65SGPCQNGGTCIDEI---NSFVCLCLPSYGGSVCEKDT... 98
694 4.000e-04gi|625277882|ref|XP_007630570.1| PREDICTED: protein crumbs homolog 2 isoform X2 [Cricetulus griseus]  clstr ali  51 1045.NPCLNGGTCR---ATSGIFECTCNAGFSGQFCEV..... 1075
695 4.000e-04gi|270002799|gb|EEZ99246.1| hypothetical protein TcasGA2_TC000871 [Tribolium castaneum]  clstr ali  30 2238..PCLLGANCTDLVAD---FSCSCPPGFTGKRCQEKID.. 2270
696 4.000e-04gi|307214185|gb|EFN89302.1| Cubilin [Harpegnathos saltator]  clstr ali  37  174...CQNGATCRNL---PGSYRCDCLPGWFGLHC....... 200
697 4.000e-04gi|260790440|ref|XP_002590250.1| hypothetical protein BRAFLDRAFT_132333 [Branchiostoma floridae]  clstr ali  29  539SSPCQNGANCTQ--PYPGVYECLCLDGFAGINCEHN.... 572
698 4.000e-04gi|635125279|ref|XP_008013449.1| PREDICTED: slit homolog 3 protein [Chlorocebus sabaeus]  clstr ali  35 1174.NDCENNATCVDGI---NNYVCVCPPNYTGELCDEVID.. 1207
699 4.000e-04gi|528467981|ref|XP_005170983.1| PREDICTED: slit homolog 2 protein isoform X1 [Danio rerio]  clstr ali  36 1077.NKCKNGAQCIDAV---NGYTCVCPEGYSGLFCE...... 1106
700 4.000e-04gi|642125870|emb|CDQ61207.1| unnamed protein product [Oncorhynchus mykiss]  clstr ali  32 2422..PCQNRGSCVPGPR--SSYTCVCSEFYTGKTCET..... 2452
701 4.000e-04gi|395542983|ref|XP_003773402.1| PREDICTED: slit homolog 2 protein, partial [Sarcophilus harrisii]  clstr ali  26 1110.NPCQHDSKC---ILTPKGYKCDCTPGYVGEHCDIDYD.. 1143
702 4.000e-04gi|121949534|sp|A0A1F4.1|EYS_DROME RecName: Full=Protein eyes shut; AltName: Full=Protein spacemaker [Drosophila melanogaster]  clstr ali  36 1316.NPCQYGGTCVQFP--GSGYLCLCPLGKHGHYCEHN.... 1348
703 4.000e-04gi|556735970|ref|XP_005985714.1| PREDICTED: LOW QUALITY PROTEIN: delta-like 3 (Drosophila) [Pantholops hodgsonii]  clstr ali  38  281.NPCANGGSCSETL---GSFECTCPRGFYGLRCEV..... 311
704 4.000e-04gi|542185374|ref|XP_005469643.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 2 [Oreochromis niloticus]  clstr ali  24 1928.NPCEHESACTRKPSSSRGYTCDCPNNYFGNYCEKKTD.. 1964
705 4.000e-04gi|242021153|ref|XP_002431010.1| predicted protein [Pediculus humanus corporis]  clstr ali  40  941.SPCYNGGRCVEGRYGL---SCVCPSGYNGPRCQ...... 970
706 4.000e-04gi|555932228|emb|CDJ09347.1| slit 2 protein [Hymenolepis microstoma]  clstr ali  40 1073.NKCQNGGICQDNV---GGYTCECPRGYTGEFCE...... 1102
707 4.000e-04gi|344250535|gb|EGW06639.1| Pikachurin [Cricetulus griseus]  clstr ali  32  673..PCAHGGSCRPRK---ESYECDCPLGFEGLNCQKAITE. 706
708 4.000e-04gi|644995340|ref|XP_008214207.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog isoform X1 [Nasonia vitripennis]  clstr ali  40 3965........VCIPDSSVQG-YSCQCPEGFAGQTCDIDISK. 3994
709 4.000e-04gi|644995354|ref|XP_008214212.1| PREDICTED: fat-like cadherin-related tumor suppressor homolog isoform X5 [Nasonia vitripennis]  clstr ali  40 3927........VCIPDSSVQG-YSCQCPEGFAGQTCDIDISK. 3956
710 4.000e-04gi|389615571|dbj|BAM20745.1| unknown protein, partial [Papilio polytes]  clstr ali  50  79...CLNGGTCLYFELVQE-QACKCPEGFNGQRCE...... 108
711 4.000e-04gi|242014336|ref|XP_002427847.1| protocadherin-16 precursor, putative [Pediculus humanus corporis]  clstr ali  57 3998...CFNGGICVSLKPG---YRCSCPKARHGRHCE...... 4025
712 5.000e-04gi|344239219|gb|EGV95322.1| Sushi, nidogen and EGF-like domain-containing protein 1 [Cricetulus griseus]  clstr ali  55  941...CQNGGTCVP---GANAHSCDCRPGFKGRHCEL..... 969
713 5.000e-04gi|505854530|ref|XP_004620687.1| PREDICTED: sushi, nidogen and EGF-like domain-containing protein 1 [Sorex araneus]  clstr ali  37  703.QPCRNGGSCRDVL---GTFLCECPAGFSGTRCDIE.... 734
714 5.000e-04gi|512845124|ref|XP_002943134.2| PREDICTED: protein delta homolog 2 [Xenopus (Silurana) tropicalis]  clstr ali  36  152.QPCQNNGRCYDRV---GDYECYCPEGFMGKSCEIPI... 184
715 5.000e-04gi|602641551|ref|XP_007427577.1| PREDICTED: LOW QUALITY PROTEIN: sushi, nidogen and EGF-like domain-containing protein 1 [Python bivittatus]  clstr ali  33  427SNPCQNEGTCLES---SQGYMCECAEGYTGTDC....... 456
716 5.000e-04gi|560916021|ref|XP_006184263.1| PREDICTED: protein delta homolog 1 [Camelus ferus]  clstr ali  34  201STPCANNGTCVNLE--DGQYECSCAPGFSGKDCQ...... 232
717 5.000e-04gi|345806108|ref|XP_548462.3| PREDICTED: LOW QUALITY PROTEIN: protein crumbs homolog 2 [Canis lupus familiaris]  clstr ali  28  268SSPCQHGGQCLQRFRSAAGFLCRCPPGFEGDECGVDVDE. 324
718 5.000e-04gi|591383033|ref|XP_007065980.1| PREDICTED: LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 3 [Chelonia mydas]  clstr ali  28  430.NPCEHFGRCVN---TQGSFQCQCGRGYTGPRCETDINE. 464
719 5.000e-04gi|554580809|ref|XP_005881936.1| PREDICTED: neurogenic locus notch homolog protein 3-like, partial [Myotis brandtii]  clstr ali  28  258SQPCRHGGTCRPNCEINDGYECACEPGYTGSMCNINIDE. 314