current user: public

Query: d3d1kb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
3 -67.200d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  31  1VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTTRLFSKLQGLFSA----NDIGVQQHADKVQRALGEAIDDLKKVEINFQNLSGKHQ-EIGVDTQNFKLLGQTFMVELALHYKKTFRPKEHAAAYKFFRLVAEALSSNYH 141
4 -66.800d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}  ali model 3D-neighbors follow..  40  1VHWTQEERDEISKTFQGTDMKTVVTQALDRMFKVYPWTNRYFQKR----------TDFRSSIHAGIVVGALQDAVKHMDDVKTLFKDLSKKHADDLHVDPGSFHLLTDCIIVELAYLRKDCFTPHIQGIWDKFFEVVIDAISKQYH 136
5 -66.300d3d1ka1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors follow..  35  1.SLSDKDKAAVRALWSKISSDAIGNDALSRMIVVYPQTKIYFSHWPDV-----TPGSPNIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYKLRVDPSNFKILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR 142
7 -64.000d1cg5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  32  2..LSSQNKKAIEELGNLINAEAWGADALARLFELHPQTKTYFSKFSGFEA-----CNEQVKKHGKRVMNALADATHHLDNLHLHLEDLARKHGENLLVDPHNFHLFADCIVVTLAVNLQA-FTPVTHCAVDKFLELVAYELSSCYR 141
8 -56.800d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}  ali model 3D-neighbors follow..  22  9PTLTDGDKKAINKIWPKIEYEQYSLNILLRFLKCFPQAQASFPKFSTKK--SNLEQDPEVKHQAVVIFNKVNEIINSMDNIIKSLKDLSQKHKTVFKVDSIWFKELSSIFVSTI----------DGGAEFEKLFSIICILLRSAY. 146
10 -54.100d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]}  ali model 3D-neighbors follow..  18  10GDLTLAQKKIVRKTWHQLNKTSFVTDVFIRIFAYDPSAQNKFPQMAGMS-ASQLRSSRQMQAHAIRVSSIMSEYVEELDSLPELLATLARTHD-LNKVGADHYNLFAKVLMEALQAELGSDFNEKTRDAWAKAFSVVQAVLLVKH. 156
11 -51.900d3sdha_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}  ali model 3D-neighbors follow..  20  7AQLTADVKKDLRDSWKVIDKKGNGVALMTTLFADNQETIGYFKRLGNV---SQGMANDKLRGHSITLMYALQNFIDQLDNLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL..... 145
12 -51.200d1ecda_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]}  ali model 3D-neighbors follow..  14  1..LSADQISTVQASFDKVKGD--PVGILYAVFKADPSIMAKFTQFAGKD-LESIKGTAPFETHANRIVGFFSKIIGELPNIEADVNTFVASHK-PRGVTHDQLNNFRAGFVSYMKAHTD---FAGAEAAWGATLDTFFGMIFSK.. 135
15 -50.000d1x9fb_ a.1.1.2 (B:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  15  2KQCGVLEGLKVKSEWGRADREAFSQAIWRATFAQVPESRSLFKRVHGDD-----TSHPAFIAHADRVLGGLDIAISTLDQLKEELDHLQVQHE-GRKIPDNYFDAFKTAILHVVAAQLGRCYDRE---AWDACIDHIEDGIKGHH. 145
16 -49.500d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  16  3HCCSEEDHRIVQKQWDILWRDGFGRLLLTKLAKDIPEVNDLFKRVD-----IEHAEGPKFSAHALRILNGLDLAINLLDDLDAALDHLAHQHEVREGVQKAHFKKFGEILATGLPQVLDDYDALAWKSCLKGILTKISSRL..... 149
17 -49.500d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]}  ali model 3D-neighbors follow..  12  1.TLTKHEQDILLKELGPHHIVETGLGAYHALFTAHPQYISHFSRLEGHT-IENVMQSEGIKHYARTLTEAIVHMLKEISNVKKIAAQYGKDHT-SRKVTKDEFMSGEPIFTKYFQNLVKDAEGKAAEKFLKHVFPMMAAEI..... 147
19 -47.900d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}  ali model 3D-neighbors follow..  17  1...ANKTRELCMKSLEHAEARQDGIDLYKHMFENYPPLRKYFKSREEYT-AEDVQNDPFFAKQGQKILLACHVLCATYDDFNAYTRELLDRHARDVHMPPEVWTDFWKLFEEYLGKKTT--LDEPTKQAWHEIGREFAKEINK... 147
20 -47.700d1x9fa_ a.1.1.2 (A:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  14  2.CCSYEDRREIRHIWDDVRRVAIVRAVFDDLFKHYPTSKALFERVKI-----DEPESGEFKSHLVRVANGLKLLINLLDDLQSHLGHLADQHIQRKGVTKEYFRGIGEAFARVLPQVLS----CFNVDAWNRCFHRLVARIAKDL. 146
22 -45.200d2qfka1 a.1.1.2 (A:1-137) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}  ali model 3D-neighbors follow..  16  1.........GFKQDIATIDLRTYAQDIFLAFLNKYPDERRYFKNYVGKS-DQELKSMAKFGDHTEKVFNLMMEVADRATDLASDANTLVQMKQ-HSSLTTGNFEKLFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMK... 137
23 -42.100d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}  ali model 3D-neighbors follow..  15  1.GLSAAQRQVVASTWKDINGAGVGKECLSKFISAHPEMAAVFGF--------SGASDPGVAELGAKVLAQIGVAVSHLGDEGKMMKAVGVRHKGNKHIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYGDISGALISG.. 144
24 -36.400d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon-worm (Cerebratulus lacteus) [TaxId: 6221]}  ali model 3D-neighbors follow..  13  2............VNWAAVVDD-----FYQELFKAHPEYQNKFGFKG--VALGSLKGNAAYKTQAGKTVDYINAAIGGSADAA----GLASRHK-GRNVGSAEFHNAKACLAKACSAHGAPDLGHAIDDILSHL............. 110
25 -29.700d1cqxa1 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus [TaxId: 106590]}  ali model 3D-neighbors follow..  14  2..LTQKTKDIVKATAPVLHGYDIIKCFYQRMFEAHPELKNVFN-----------MAHQEQGQQQQALARAVYAYAENIEDPNSVLKNIANKHA-SLGVKPEQYPIVGEHLLAAIKEVLGNAATDDIISAWAQAYGNLADVLMG... 135
26 -29.400d1tu9a_ a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  14  1.....NAADRVMQSYGRCASTGFFDDFYRHFLASSPQIRAKFA-------------TTDMTAQKHLLRAGIMNLVMYARGMSDKLRALGASHSRALDIRPELYDLWLDALLMAVAEHDR-DCDAETRDAWRDVMGRGIAVIKSYY. 129
27 -10.300d1or4a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  32VRLGDAELYVLEQLQPLIQIVNIVDAFYKNLDH-ESSLMDIINDHSSVDRL-----KQTLKRHIQEMFAG--------DEFIEKRNRIASIHL-RIGLLPKWYMGAFQELLLSMIDIYEASITNKAIKATTKILNLEQQLVLE... 169

FFAS is supported by the NIH grant R01-GM087218-01
6 3 9 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;