current user: public



Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

d3d1kb1
Query: d3d1kb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst VEWTDKERSIISDIFSHMDYDDIGPKALSRCLVVYPWTQRYFSGFGNLYNAEGIMSNANVAAHGIKVLHGLDRGMKNMDNIADAYTDLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAAVVSALGKQYHLast
1 -71.000d3d1kb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors  100  1VEWTDKERSIISDIFSHMDYDDIGPKALSRCLVVYPWTQRYFSGFGNLYNAEGIMSNANVAAHGIKVLHGLDRGMKNMDNIADAYTDLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAAVVSALGKQYH 146
2 -64.400d1a6ma_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}  ali model 3D-neighbors follow..  21  2..LSEGEWQLVLHVWAKVDVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 147
3 -64.100d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  31  1VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTTRLFSKLQGLFSAN----DIGVQQHADKVQRALGEAIDDLKKVEINFQNLSGKHQ-EIGVDTQNFKLLGQTFMVELALHYKKTFRPKEHAAAYKFFRLVAEALSSNYH 141
4 -63.200d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}  ali model 3D-neighbors follow..  40  1VHWTQEERDEISKTFQGTDMKTVVTQALDRMFKVYPWTNRYFQKRT----------DFRSSIHAGIVVGALQDAVKHMDDVKTLFKDLSKKHADDLHVDPGSFHLLTDCIIVELAYLRKDCFTPHIQGIWDKFFEVVIDAISKQYH 136
5 -62.400d3d1ka1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors follow..  35  1.SLSDKDKAAVRALWSKISSDAIGNDALSRMIVVYPQTKIYFSHWPDVTP-----GSPNIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYKLRVDPSNFKILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR 142
6 -60.100d1urva_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  1.ELSEAERKAVQAMWARLNSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHASRVMGALNTVVENLHDVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYK 150
7 -59.300d1cg5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  32  2..LSSQNKKAIEELGNLINAEAWGADALARLFELHPQTKTYFSKFSGFEA-----CNEQVKKHGKRVMNALADATHHLDNLHLHLEDLARKHGENLLVDPHNFHLFADCIVVTLAVNLQA-FTPVTHCAVDKFLELVAYELSSCYR 141
8 -55.200d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]}  ali model 3D-neighbors follow..  17  10GDLTLAQKKIVRKTWHQLNKTSFVTDVFIRIFAYDPSAQNKFPQMAGMSA-SQLRSSRQMQAHAIRVSSIMSEYVEELDSLPELLATLARTHD-LNKVGADHYNLFAKVLMEALQAELGSDFNEKTRDAWAKAFSVVQAVLLVKH. 156
9 -54.500d1q1fa_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  19  1....RPESELIRQSWRVVSPLEHGTVLFARLFALEPSLLPLFQYNRQFSSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSEYLTSLGRKHR-AVGVRLSSFSTVGESLLYMLEKSLGPDFTPATRTAWSRLYGAVVQAMSRGWD 147
10 -54.500d2gdma_ a.1.1.2 (A:) Leghemoglobin {Yellow lupin (Lupinus luteus) [TaxId: 3873]}  ali model 3D-neighbors follow..  13  2.ALTESQAALVKSSWEEFNIPKHTHRFFILVLEIAPAAKDLFSFLKGTSE--VPQNNPELQAHAGKVFKLVYEAAIQLEVTDATLKNLGSVHV-SKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELAIVIKKEMD 150
11 -52.800d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}  ali model 3D-neighbors follow..  15  1.GLSAAQRQVVASTWKDINGAGVGKECLSKFISAHPEMAAVFGFSGA--------SDPGVAELGAKVLAQIGVAVSHLGDEGAEMKAVGVRHKGNKHIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYGDISGALISGLQ 146
12 -51.800d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}  ali model 3D-neighbors follow..  22  9PTLTDGDKKAINKIWPKIEYEQYSLNILLRFLKCFPQAQASFPKFSTKK--SNLEQDPEVKHQAVVIFNKVNEIINSMDNIIKSLKDLSQKHKTVFKVDSIWFKELSSIFVSTI----------DGGAEFEKLFSIICILLRSAY. 146
13 -51.300d1mbaa_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina) [TaxId: 6502]}  ali model 3D-neighbors follow..  13  1.SLSAAEADLAGKSWAPVFANANGLDFLVALFEKFPDSANFFADFKGKS-VADIKASPKLRDVSSRIFTRLNEFVNNAANMSAMLSQFAKEHV-GFGVGSAQFENVRSMFPGFVASVAA--PPAGADAAWTKLFGLIIDALKAAG. 145
14 -50.500d1ecda_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]}  ali model 3D-neighbors follow..  14  1..LSADQISTVQASFDKVKGD--PVGILYAVFKADPSIMAKFTQFAGKD-LESIKGTAPFETHANRIVGFFSKIIGELPNIEADVNTFVASHK-PRGVTHDQLNNFRAGFVSYMKAHTD---FAGAEAAWGATLDTFFGMIFSK.. 135
15 -50.100d1x9fb_ a.1.1.2 (B:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  15  2KQCGVLEGLKVKSEWGRADREAFSQAIWRATFAQVPESRSLFKRVH-----GDDTSHPAFIAHADRVLGGLDIAISTLDQLKEELDHLQVQHE-GRKIPDNYFDAFKTAILHVVAAQLGRCYDRE---AWDACIDHIEDGIKGHH. 145
16 -49.700d3sdha_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}  ali model 3D-neighbors follow..  20  7AQLTADVKKDLRDSWKVIDKKGNGVALMTTLFADNQETIGYFKRLGNV---SQGMANDKLRGHSITLMYALQNFIDQLDNLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLAS---KNFGDKYANAWAKLVAVVQAAL..... 145
17 -48.900d1itha_ a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]}  ali model 3D-neighbors follow..  17  1.GLTAAQIKAIQDHWFLNCLQAAADSIFFKYLTAYPGDLAFFHKFSSVP-LYGLRSNPAYKAQTLTVINYLDKVVDALGGNAGLMKAKVPSHD-AMGITPKHFGQLLKLVGGVFQEEFSA--DPTTVAAWGDAAGVLVAAMK.... 141
18 -48.500d1b0ba_ a.1.1.2 (A:) Hemoglobin I {Clam (Lucina pectinata) [TaxId: 29163]}  ali model 3D-neighbors follow..  10  1.SLSAAQKDNVKSSWAKAAWGTAGPEFFMALFDAHDDVFAKFSGLFSGAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNLEGQCKTFAANHK-ARGISAGQLEAAFKVLAGFMKSYGGDE------GAWTAVAGALMGMIRPD.. 141
19 -47.900d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]}  ali model 3D-neighbors follow..  16  1.TLTKHEQDILLKELGPHHIVETGLGAYHALFTAHPQYISHFSRLEGHT-IENVMQSEGIKHYARTLTEAIVHMLKEISNVKKIAAQYGKDHT-SRKVTKDEFMSGEPIFTKYFQNLVKDAEGKA---AVEKFLKHVFPMMAAE.. 146
20 -47.400d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  15  5..CSEEDHRIVQKQWDILWRDGFGRLLLTKLAKDIPEVNDLFKRVD-----IEHAEGPKFSAHALRILNGLDLAINLLDDLDAALDHLAHQHEVREGVQKAHFKKFGEILATGLPQVLDDYDAL----AWKSCLKGILTKISSR.. 148
21 -47.300d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}  ali model 3D-neighbors follow..  16  1...ANKTRELCMKSLEHAEARQDGIDLYKHMFENYPPLRKYFKSREEYTA-EDVQNDPFFAKQGQKILLACHVLCATYDDFNAYTRELLDRHARDVHMPPEVWTDFWKLFEEYLGKKTT--LDEPTKQAWHEIGREFAKEINK... 147
22 -47.000d1cqxa1 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus [TaxId: 106590]}  ali model 3D-neighbors follow..  13  2..LTQKTKDIVKATAPVLHGYDIIKCFYQRMFEAHPELKNVFNMAHQEQGQQQQALARAVYAYAEN--------IEDPNSLMAVLKNIANKHA-SLGVKPEQYPIVGEHLLAAIKEVLGNAATDDIISAWAQAYGNLADVLMGMES 138
23 -45.800d2qfka1 a.1.1.2 (A:1-137) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}  ali model 3D-neighbors follow..  16  1.........GFKQDIATIRGDTYAQDIFLAFLNKYPDERRYFKNYVGKS-DQELKSMAKFGDHTEKVFNLMMEVADRATDLASDANTLVQMKQ-HSSLTTGNFEKLFVALVEYMRAS----GQSFDSQSWDRFGKNLVSALSSAGM 136
24 -45.600d1x9fa_ a.1.1.2 (A:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  14  3..CSYEDRREIRHIWDDVRRVAIVRAVFDDLFKHYPTSKALFERVK-----IDEPESGEFKSHLVRVANGLKLLINLLDDLQSHLGHLADQHIQRKGVTKEYFRGIGEAFARVLPQVLS----CFNVDAWNRCFHRLVARIAKDL. 146
25 -36.900d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon-worm (Cerebratulus lacteus) [TaxId: 6221]}  ali model 3D-neighbors follow..  11  2............VNWAAV-----VDDFYQELFKAHPEYQNKFGFKG--VALGSLKGNAAYKTQAGKTVDYINAAIGGSAD----AAGLASRHK-GRNVGSAEFHNAKACLAKACSAHGAPDLGHAIDDILSHL............. 110
26 -35.700d1tu9a_ a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  14  1.....NAADRVMQSYGRCASTGFFDDFYRHFLASSPQIRAKFA-------------TTDMTAQKHLLRAGIMNLVMYARGMSDKLRALGASHSRALDIRPELYDLWLDALLMAVAEHDRD-CDAETRDAWRDVMGRGIAVIKSYY. 129
27 -14.200d1or4a_ a.1.1.2 (A:) Heme-based aerotactic transducer HemAT, sensor domain {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  32VRLGDAELYVLEQLQPLIQEVNIVDAFYKNLDH-ESSLMDIINDHSSVDRLK-----QTLKRHIQEMFAG--------DEFIEKRNRIASIHL-RIGLLPKWYMGAFQELLLSMIDIYEASITNKAIKATTKILNLEQQLVLE... 169
28 -9.820d1ngka_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]}  ali model 3D-neighbors follow..  1...........KSFYDAVGGAKTFDAIVSRFYAEDEVLRRVYP-------------EDDLAGAEERLRMFLEQYWGGPRTYSEQ-PRLRMRHAP-FRISLIERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNS.. 124

FFAS is supported by the NIH grant R01-GM087218-01
6 0 9 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jambon M, Godzik A. New avenues in protein function prediction. Protein Sci. 2006 Jun;15(6):1527-9.