current user: public




Query: d3d1kb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst VEWTDKERSIISDIFSHMDYDDIGPKALSRCLVVYPWTQRYFSGFGNLYNAEGIMSNANVAAHGIKVLHGLDRGMKNMDNIADAYTDLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAAVVSALGKQYHLast
1 -79.600d3d1kb1 a.1.1.2 (B:1-146) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors  100  1VEWTDKERSIISDIFSHMDYDDIGPKALSRCLVVYPWTQRYFSGFGNLYNAEGIMSNANVAAHGIKVLHGLDRGMKNMDNIADAYTDLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAAVVSALGKQYH 146
2 -68.900d1a6ma_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}  ali model 3D-neighbors follow..  21  2..LSEGEWQLVLHVWAKVDVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYK 147
3 -68.700d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}  ali model 3D-neighbors follow..  40  1VHWTQEERDEISKTFQGTDMKTVVTQALDRMFKVYPWTNRYFQKR----------TDFRSSIHAGIVVGALQDAVKHMDDVKTLFKDLSKKHADDLHVDPGSFHLLTDCIIVELAYLRKDCFTPHIQGIWDKFFEVVIDAISKQYH 136
4 -68.600d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  31  1VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTTRLFSKLQGLFSA----NDIGVQQHADKVQRALGEAIDDLKKVEINFQNLSGKHQ-EIGVDTQNFKLLGQTFMVELALHYKKTFRPKEHAAAYKFFRLVAEALSSNYH 141
5 -68.000d3d1ka1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors follow..  35  1.SLSDKDKAAVRALWSKISSDAIGNDALSRMIVVYPQTKIYFSHWPDV-----TPGSPNIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYKLRVDPSNFKILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR 142
6 -66.600d1cg5a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  32  2..LSSQNKKAIEELGNLINAEAWGADALARLFELHPQTKTYFSKFSGFEA-----CNEQVKKHGKRVMNALADATHHLDNLHLHLEDLARKHGENLLVDPHNFHLFADCIVVTLAVNLQ-AFTPVTHCAVDKFLELVAYELSSCYR 141
7 -66.400d1urva_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  1.ELSEAERKAVQAMWARLNSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHASRVMGALNTVVENLHDVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYK 150
8 -60.700d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}  ali model 3D-neighbors follow..  23  9PTLTDGDKKAINKIWPKIEYEQYSLNILLRFLKCFPQAQASFPKFSTKK--SNLEQDPEVKHQAVVIFNKVNEIINSMDNIIKSLKDLSQKHKTVFKVDSIWFKELSSIFV----------STIDGGAEFEKLFSIICILLRSAY. 146
9 -54.100d1mbaa_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina) [TaxId: 6502]}  ali model 3D-neighbors follow..  13  1.SLSAAEADLAGKSWAPVNKNANGLDFLVALFEKFPDSANFFADFKGKS-VADIKASPKLRDVSSRIFTRLNEFVNNAANMSAMLSQFAKEHV-GFGVGSAQFENVRSMFPGFVASVAA--PPAGADAAWTKLFGLIIDALKAAG. 145
10 -52.800d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]}  ali model 3D-neighbors follow..  18  10GDLTLAQKKIVRKTWHQLNKTSFVTDVFIRIFAYDPSAQNKFPQMAGMS-ASQLRSSRQMQAHAIRVSSIMSEYVEELDSLPELLATLARTHD-LNKVGADHYNLFAKVLMEALQAELGSDFNEKTRDAWAKAFSVVQAVLLVKH. 156
11 -52.600d3sdha_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}  ali model 3D-neighbors follow..  20  7AQLTADVKKDLRDSWKVIDKKGNGVALMTTLFADNQETIGYFKRLGNVSQ---GMANDKLRGHSITLMYALQNFIDQLDNLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL..... 145
12 -50.800d1itha_ a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]}  ali model 3D-neighbors follow..  17  2..LTAAQIKAIQDHWFLNCLQAAADSIFFKYLTAYPGDLAFFHKFSSVPL-YGLRSNPAYKAQTLTVINYLDKVVDALGGNAGLMKAKVPSHD-AMGITPKHFGQLLKLVGGVFQEEFS--ADPTTVAAWGDAAGVLVAAMK.... 141
13 -50.800d1ecda_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]}  ali model 3D-neighbors follow..  14  1..LSADQISTVQASFDKVKGD--PVGILYAVFKADPSIMAKFTQFAGKD-LESIKGTAPFETHANRIVGFFSKIIGELPNIEADVNTFVASHK-PRGVTHDQLNNFRAGFVSYMKAHTD---FAGAEAAWGATLDTFFGMIFSK.. 135
14 -49.500d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  16  5..CSEEDHRIVQKQWDILWRDGFGRLLLTKLAKDIPEVNDLFKRVDI-----EHAEGPKFSAHALRILNGLDLAINLLDDLDAALDHLAHQHEVREGVQKAHFKKFGEILATGLPQVLDDYDALAWKSCLKGILTKISSRL..... 149
15 -49.000d1x9fb_ a.1.1.2 (B:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  15  2KQCGVLEGLKVKSEWGRADREAFSQAIWRATFAQVPESRSLFKRVHGDD-----TSHPAFIAHADRVLGGLDIAISTLDQLKEELDHLQVQHE-GRKIPDNYFDAFKTAILHVVAAQLGRCYDRE---AWDACIDHIEDGIKGHH. 145
16 -47.900d1b0ba_ a.1.1.2 (A:) Hemoglobin I {Clam (Lucina pectinata) [TaxId: 29163]}  ali model 3D-neighbors follow..  10  1.SLSAAQKDNVKSSWAKAAWGTAGPEFFMALFDAHDDVFAKFSGLFSGAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNLEGQCKTFAANHK-ARGISAGQLEAAFKVLAGFMKSYGGD------EGAWTAVAGALMGMIRPD.. 141
17 -47.800d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]}  ali model 3D-neighbors follow..  16  1.TLTKHEQDILLKELGPHHIVETGLGAYHALFTAHPQYISHFSRLEGHT-IENVMQSEGIKHYARTLTEAIVHMLKEISNVKKIAAQYGKDHT-SRKVTKDEFMSGEPIFTKYFQNLVKDAEGKA---AVEKFLKHVFPMMAAE.. 146
18 -47.700d1q1fa_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  19  1....RPESELIRQSWRVVSPLEHGTVLFARLFALEPSLLPLFQYGRQFSSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLLTSLGRKHR-AVGVRLSSFSTVGESLLYMLEKSLGPDFTPATRTAWSRLYGAVVQAMSRGWD 147
19 -47.400d1x9fa_ a.1.1.2 (A:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit IV (globin A) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  14  2.CCSYEDRREIRHIWDDVRRVAIVRAVFDDLFKHYPTSKALFERVKI-----DEPESGEFKSHLVRVANGLKLLINLLDDLQSHLGHLADQHIQRKGVTKEYFRGIGEAFARVLPQV----LSCFNVDAWNRCFHRLVARIAKDL. 146
20 -45.000d2qfka1 a.1.1.2 (A:1-137) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}  ali model 3D-neighbors follow..  16  1.........GFKQDIATIDLRTYAQDIFLAFLNKYPDERRYFKNYVGKS-DQELKSMAKFGDHTEKVFNLMMEVADRATDLASDANTLVQMKQ-HSSLTTGNFEKLFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMK... 137
21 -44.100d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}  ali model 3D-neighbors follow..  17  1...ANKTRELCMKSLEHAEARQDGIDLYKHMFENYPPLRKYFKSREEYT-AEDVQNDPFFAKQGQKILLACHVLCATYDDFNAYTRELLDRHARDVHMPPEVWTDFWKLFEEYLGKKTT--LDEPTKQAWHEIGREFAKEINK... 147
22 -42.300d2gdma_ a.1.1.2 (A:) Leghemoglobin {Yellow lupin (Lupinus luteus) [TaxId: 3873]}  ali model 3D-neighbors follow..  13  2.ALTESQAALVKSSWEEFNIPKHTHRFFILVLEIAPAAKDLFSFLKG--TSEVPQNNPELQAHAGKVFKLVYEAAIQLEVTDATLKNLGSVHV-SKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELAIVIKKEMD 150
23 -37.700d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}  ali model 3D-neighbors follow..  16  1.GLSAAQRQVVASTWKDIAGADNGAGVLSKFISAHPEMAAVFGF--------SGASDPGVAELGAKVLAQIGVAVSHLGDEGKEMKAVGVRHKGNKHIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYGDISGALISG.. 144
24 -35.300d1kr7a_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon-worm (Cerebratulus lacteus) [TaxId: 6221]}  ali model 3D-neighbors follow..  13  2............VNWAAVVDD-----FYQELFKAHPEYQNKFGFKG--VALGSLKGNAAYKTQAGKTVDYINAAIGGSADAAG----LASRHK-GRNVGSAEFHNAKACLAKACSAHGAPDLGHAIDDILSHL............. 110
25 -25.600d1tu9a_ a.1.1.2 (A:) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  14  1.....NAADRVMQSYGRCASTGFFDDFYRHFLASSPQIRAKF-------------ATTDMTAQKHLLRAGIMNLVMYARGMSDKLRALGASHSRALDIRPELYDLWLDALLMAVAEHDR-DCDAETRDAWRDVMGRGIAVIKSYY. 129
26 -23.500d1cqxa1 a.1.1.2 (A:1-150) Flavohemoglobin, N-terminal domain {Alcaligenes eutrophus [TaxId: 106590]}  ali model 3D-neighbors follow..  14  2..LTQKTKDIVKATAPVLAEYDIIKCFYQRMFEAHPELKNVFNMAHQEQGQQQQALARAVYAYAENI--------EDPNSLMAVLKNIANKHA-SLGVKPEQYPIVGEHLLAAIKEVLGNAATDDIISAWAQAYGNLADVL..... 133

FFAS is supported by the NIH grant R01-GM087218-01
6 4 5 1 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.