current user: public




d2fz4a1
Query: d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst IAEIYYERGTIVVKGDAHVPHAKFDSRSGTYRALAFRYRDIIEYFESNGIEFVDNAADPIPTPYFDAEISLRDYQEKALERWLVDKRGCIVLPTGSGKTHVAMAAINELSTPTLIVVPTLALAEQWKERLGIFGEEYVGEFSGRIKELKPLTVSTYDSAYVNAEKLGNRFMLLIFDEVHHLPAESYVQIAQMSIAPFRLGLTATFELast
1 -89.700d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors  100  1IAEIYYERGTIVVKGDAHVPHAKFDSRSGTYRALAFRYRDIIEYFESNGIEFVDNAADPIPTPYFDAEISLRDYQEKALERWLVDKRGCIVLPTGSGKTHVAMAAINELSTPTLIVVPTLALAEQWKERLGIFGEEYVGEFSGRIKELKPLTVSTYDSAYVNAEKLGNRFMLLIFDEVHHLPAESYVQIAQMSIAPFRLGLTATFE 206
2 -54.400d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  20  66......................................GQIKKFCDNFGYKAWDEWLSKLEIYSGNKRIEPHWYQKDAVFEGLVNRRRILNLPTSAGRSLIQALLLENYEGKILIIVPTTALTTQMADDFVDYRHAMIKKIGGGASKDAPVVVGTWQTVVKQPKEWFSQFGMMMNDECHLATGKSISSIISGLNCMFKFGLSGSLR 263
3 -33.300d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  28  8....................................................................IQPRIYQEVIYAKCKETNC-LIVLPTGLGKTLIAMMIAEYRGGKVLMLAPTKPLVLQHAESFRRLFNEKIVALTGEKSARAKVIVATPQTIENAGRISLEDVSLIVFDEAHRAVGNAYVFIAREYKRQLVIGLTASP. 166
4 -28.200d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  28  25.....................................................................ELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAEMAMVREGGKSLYVVPLRALAGEKYESFKKWIGLRIGISTGDYEGDCDIIVTTADSLIRNRASWIKAVSCLVVDEIHLLDSEKRGATLEILVTKMRIGLSAT.. 181
5 -26.500d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}  ali model 3D-neighbors follow..  17  2...............................................................................HMLKKGMTTVLDFHPGAGKTRRFLPQILA-RLRTLVLAPTRVVLSEMKEAFHGLVKFHTQAFSAHGSGREVIDAMCHATLTYREPTRVVNWEVIIMDEAHFLDPASWAAHRARANESATILMTATP. 139
6 -24.800d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  20  8.................................................................NIKANLRPYQIKGFSWMRFMNKICLADDMGLGKTLQTIAVFSDAKKESLVICPL-SVLKNWEEELSKFAHLRFAVFHEDRSKIKDIILTTYAVLLRDTRLKEVEWKYIVIDEAQNIPQTKIFKAVKELKSKYRIALTGTP. 162
7 -24.800d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors follow..  23  7...................................................................................SFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSVLDQAETAGARLVVLATATP. 136
8 -24.300d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}  ali model 3D-neighbors follow..  18  31.............................................AHDLIKADKEKLPVHVVVDPVLSKVLRPHQREGVKFLWNSYGCIMADEMGLGKTLQCITLIWTL-DKVIVVSPSS-LVRNWYNEVGKWLGGRVQPVQQGMRIPTPILIISYETFRLHAEVLHKKVGLVICDEGHRLSDNQTYLALNSMNAQRRVLISGTP. 230
9 -22.600d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  22  43.....................................................................EPRAIQKMWAKRILRKESFAATAPTGVGKTSFGLAMSLFLGKRCYVIFPTSLLVIQAAETIRKYAEKAIGYYHGRIPKREKIVITTTQFLSKHYREL-GHFDFIFVDDVDAIASKNVDKLLHLLARGCLMVSTAT.. 213
10 -19.500d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  23  79.................................................................SLPFKLTNAQKRAHQEIRNDMISLLQGDVGSGKTVVAQLAIYEAGFQTAFMVPTSILAIQHYRRTVESFNIHVALLIGATTPSEDVVIGTHALIQEDVHF--KNLGLVIIDEQHRFGVKQREALMNKGKMVDTLVMSATP. 241
11 -18.200d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  24  25.....................................................................QFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPALLLNGLTVVVSPLISLMKDQVDQLQANGVAAACLNSTQTREMTGCRTGQIRLLYIAPERLMLDPVLLAVDEAHCISQ-ALGQLRQRFPTLPFMALTATAD 185
12 -16.700d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]}  ali model 3D-neighbors follow..  20  4...............................................................................DIFRKKRLTIMDLHPGAGKTKRYLPAIVRRGLRTLILAPTRVVAAEMEEALRGLPIRYQTPIRAEHTGREIVDLMCHATFTMRSPIRVPNYNLIIMDEAHFTDPASYISTRVEMGEAAGIFMTATPP 142
13 -16.100d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  23  51.................................................................SFPFETTPDQAQAINAVLSDMCQLVCGDVGFGKTEVAMRAAFLAHKQVAVLVPTTLLAQQHYDNFRD-AKEQTQILAEVAEGKIDILIGTHKLLQSDVKF--KDLGLLIVDEEHRFGVRHKERIKAMRANVDILTLTATP. 213
14 -15.600d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  25.....................................................................KPSPIQEESIPIALSGRDILARAKNGTGKSLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGATGGTNDDTVHVVIATILDLIKKGVAKVDHVQMIVLDEADKLLSQDFVQIMEDIKNRQILLYSAT.. 186
15 -15.100d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  16  23.....................................................................KPTEIQERIIPGALRGESMVGQSQTGTGKTIMEKIKPERAEVQAVITAPTRELATQIYHETLKITKVARCLIGGTDNVQPHIVIGTINDFIREQALDVHTAHILVVDEADLMLDMGFITDVDQIKDLQMLVFSAT.. 187
16 -14.700d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  17  32.....................................................................EPSAIQQRAIMPIIEGHDVLAQAQSGTGKTALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFKVHACIGGTSFVEDQIVVGTVFDNIQRRRFRTDKIKMFILDEADEMLSSGFYQIFTLLPPTTQVVLSAT.. 191
17 -14.500d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  23.....................................................................HPSEVQHECIPQAILGMDVLCQAKSGMGKTTLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKKVAVFFGGLKKNCPHIVVGTILALARNKSLNLKHIKHFILDECDKM-RRDVQEIFRMTPHEKQVMMSAT.. 186
18 -14.100d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}  ali model 3D-neighbors follow..  19  26.....................................................................KPTDIQMKVIPLFLNDEYNIVQARTGSGKTALIELVNENNGIEAIILTPTRELAIQVADEIESLKGKIAKIYGGKAIYPQNIVVGTILDHINRGTLNLKNVKYFILDEADEMLNMGFIKDVEKIKDKRILLFSAT.. 185
19 -14.100d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]}  ali model 3D-neighbors follow..  20  43.....................................................................RPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIKTAYPKCLILAPTRELAIQILSESQKFSLNTCVVYGGADTHSQHLLVATLVDFIEKNKISLEFCKYIVLDEADRMLDMGFEPQIRKIINRQTLMFSAT.. 216
20 -13.600d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  142...............................................................KLFPVSDEINWQKVAAAVALTRRISVISGGPGTGKTTTVAKLLAALRCRIRLAAPTGKAAARLTESLGKALRQ----LTDEQKKRIPEDASTLHRLLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIFLGDRD 298
21 -11.000d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  5........................................................................................FLTGPPGVGKTTLIHKASEVLKSSGVLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQR---VCVIDEIGKMESQLFIQAVRQTLSTPGTIILGT.. 142
22 -10.500d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}  ali model 3D-neighbors follow..  12  21.......................................................................REQQLQQLDILLGNPRATLLGRPGTGKTVTLRKLWELYKDKT-FVYINGFIYRNFTAIIGEIARSLNIPFPRRGLSRDEFLALLVEHLRERDLYM-----FLVLDDAFNLAPDILSTFIRLGQE--LVIVGHNDA 169
23 -10.400d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  15  8........................................................................................LLSGHPGSGKSTIAEALANLPGVPKVHF--HSDDLWGYIKH---------GRIDPWLPQSHQQNRMIMQIAADVAGRYAKEGYFVILDGV--VRPDWLPAFTALARPLHYIVLRTTAA 112
24 -10.400d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  15  15......................................................................VEKYRPQRLDDIVGQEH-LFAGPPGVGKTTAALALAREL--------------------FGENWRHNFLELNASDERGINVIREKVKEFARTKPIGGASFKIIFLDEADALTQQALRRTMEMFSSNVRFILSCN.. 147
25 -10.300d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  19  6...................................................................GPSPKGDQPKAIAGLVGERFVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQLAAEFRELFPENAVEYFISYYDQPEAYVPGKDLYIEKDASINPE-----IERLRHSTTRSLLTVVASVSAIYGLG...... 145
26 -10.300d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  16  4........................................................................................IITGEPGVGKTTLVKKIVERLGKRA-FRIITTEGKKKIFSSKFFTSKKLVGSYGVNVQYFEELAIPILERAYREAKK--DRRKVIIIDEIGKMESKKFRDLVRQIMHDPNVNVVATIP 138
27 -10.100d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  21  17.......................................................................QEHVLTALANGLSLGR-LFSGTRGVGKTSIARLLAKGLNCETGITATPCGVCDNCRE-----------IEQGRFVDLIEIDAASRTKVEDTRDLLDNRFKVYLIDEVHMLSRHSFNALLKTLEPEHVKFLLATTD 154
28 -9.810d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}  ali model 3D-neighbors follow..  10  7........................................................................................ILNGGSSAGKSGIVRCLQSVLPEPWLAF--GVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGD-LWVGVRCDGA 124
29 -9.680d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  17  2......................................................................VDKYRPKSLNALSHNEE-LLYGPNGTGKKTRCMALLESIRKLELNVVSSPYHLEITPSDMGNNDRIVI------QELLKEVAQMEQVDFQDSKDGLAHRYKCVIINEANSLTKDALRRTMEKYSKNIRLIMVCD.. 169
30 -9.580d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  15  17.......................................................................REKEIEKLKGLRAP---LVLGLRRTGKSSIIKIGINELNLPYIYLERNYISYKDFLLELQKEINKLVKRLPSLLKALKNIQRLSFANLLESFEQASKDNVIIVLDEAQELVKLRGVNLLPALAYAY......... 164
31 -9.340d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}  ali model 3D-neighbors follow..  106...................................................................LVGCSPVVAEFGGHRYASGMVIVTGKGNSGKTPLVHALGEALGGKTVRFTDFNVFVDDIARAMLQHRVIVIDSLKNVIGAAGGNTTSGAFDLLSDIGAMAASRGCVVIASLNPTSNDKIVELVKEASRSNSTSLVISTD 262
32 -9.190d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  14  1.....................................................................................ERGIIIVFTGNGKTTAAFGTAARAGKNVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYLPLEEVISALNARPGHQTVIITG... 134

FFAS is supported by the NIH grant R01-GM087218-01
6 0 5 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.