current user: public




Query: d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MTPDFQIVTQRLQLRLITADEAEELVQCIRQSQTLHQWVDWCHALFSQQEAEQFIQATRLNWVKAEAYGFGVFERQTQTLVGMVAINEFYHTFNMASLGYWIGDRYQRQGYGKEALTALILFCFERLELTRLEIVCDPENVPSQALALRCGANREQLAPNRFLYAGEPKAGIVFSLIPLast
1 -103.000d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors  100  1MTPDFQIVTQRLQLRLITADEAEELVQCIRQSQTLHQWVDWCHALFSQQEAEQFIQATRLNWVKAEAYGFGVFERQTQTLVGMVAINEFYHTFNMASLGYWIGDRYQRQGYGKEALTALILFCFERLELTRLEIVCDPENVPSQALALRCGANREQLAPNRFLYAGEPKAGIVFSLIP 178
2 -81.300d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  23  6........STTLELRAADESHVPALHQLVLKNKALQQSLDWPQYVTSQEETRKHVQGNILLHQRGYAKMYLIFCQ--NEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQASNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARI. 173
3 -77.800d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  25  1.GMFTCKVNEHITIRLLEPKDAERLAELIIQNQQLGKWLFFAENPSSADTYETIIPDWRRQYADLNGIEAGLLYD--GSLCGMISLHNLDQVNRKAEIGYWIAKEFEGKGIITAACRKLITYAFEELELNRVAICAAVGNEKSRAVPERIGFLEEGKARDGLYVNGMHHDLVYYSLLK 177
4 -53.900d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  21  1..SIPTLRTERLTLRPLAMADFPAYRDFMASPRSTGV-----GGPYDLPSTWGVFCHDLANWHFFGHGALMIDLGETGECIGQIGINH-GPLFPEKELGWLLYEGHEGRGYAAEAAVALRDWAFETLNLPTLVSYVSPQNRKSAAVAERIGGTLDP...................... 148
5 -47.500d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  18  4.....TLQRGALRLEPLVEADIPELVSLAEANREALQYMDGPTRPDWYRQSLA---------EQREGRALPLAVRLGVQLVGTTRFAEFLPALPACEIGWWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGAQREGVLRNHRRLGGRLDDTFVYSITD 169
6 -41.300d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  15  1.........DTVTIKPIRAEHVESFHRALDAVSRERKYLSFLEA-PPLEAVRAFVLDMIEN-------HPQFVAIADGDVIGWCDIRDRATRAHCGTLGMGILPAYRNKGLGARLMRRTLDAA-HEFGLHRIELSVHADNARAIALYEKIGFAHEGRARDAVSIDGHYIDSLNMAII. 162
7 -35.600d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  12  2........STSLTIRLVAEADWPALHALDQI------------IWTKKNTPAEIQPLSLAAYQEKMKDETIFVAISGQQLAGFIEVHSLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDMA-EISGIHKLSLRVMATNQEAIRFYEKHGFVQEAHFKEEFYINGHYCDDYQYAYF. 160
8 -29.400d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  16  1..........SLTLRLAEHRDLEAVVAIYNST-IASRMVTADTEPVTPEDRMEWFSGHTESRP--------VAEDENGNVAAWISFETFYGRNKTAEVSIYIDEACRGKGVGSYLLQEALRIA-PNLGIRSLMAFIFGHNKPSLKLFEKHGFAEWGLFPGIAEMDGKRYDLKILGR.. 161
9 -28.500d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  12  2..........QLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRG----------STVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE 159
10 -25.700d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  13  1............SIRDAGVADLPGILAIYNDA-VGNTTAIWNETPVDLANRQAWFDT-----RARQGYPILVASDAAGEVLGYASYGDWRPFRGTVEHSVYVRDDQRGKGLGVQLLQALIERA-RAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLN. 161
11 -25.500d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  13  1..........TIMLTPMQTEEFRSYLTYTTKHYAEEKVKAGTLPEDAQLLSKQVFTDLLPRGLETPHHHLWSLKLNEKDIVGWLWIHAEPEHPQQEAYDFGLYEPYRGKGYAKQALAALDQAA-RSMGIRKLSLHVFAHNQTARKLYEQTGFQETDVVMSKKL............... 155
12 -23.700d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  14  1..........HMDIRTITSSDYEMVTSVLNEWWGGRQLKEKLPRLFFEHFQDTS-----------------FITSEHNSMTGFLIGFQSQSDPETAYIHF-VHPDFRKMQIGKQLYDVFIETV-KQRGCTRVKCVTSPVNKVSIAYHTKLGFDIEKGTKTVNGIDGPGQDRVLFVK.. 155
13 -23.600d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  17  2..........EIHFEKVTSDNRKAVENLQVFAE-------------QQAFIESMAENLKESDQFPEWESAGIY--DGNQLIGYA-MYGRWQDGRVWLDRFLIDQRFQGQGYGKAACRLLMLKLIEKYQTNKLYLSVYDTNSSAIRLYQQLGFVFNGELDT.................. 135
14 -23.100d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  2.........DEIKIEKLKKLDKKALNELIDVYMSGYEGLE--YGGEGRDYARNYIKWCWKKASDG------FVAKVGDKIVGFIVCDKDWFSKYEGR-EFVVDKKFQGKGIGRKLLITCLDFLGKY---DTIELWVGEKNYGAMNLYEKFGFKKVGKSGIWVRMIKR........... 156
15 -21.600d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  11  1...........MKIRVADEKELPMILQFLTEVKAYMD--QWTKDYPSQGDIQEDITKKR-----------LYLLVHEEMIFSMATFCMEQEQDFVWLKRFATSPNYIAKGYGSLLFHELEKRAVWE-GRRKMYAQTNHTNHRMIRFFESKGFTKIHES.................... 138
16 -21.500d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  10  1...........MRIVQATLEHLDLLAPLFVK------YREFYGMLSYPESSRKFLE---KRLRRKESVIYLALADEEDRLLGFCQLYPSFSSLSLKRVWIYVAEEARRQLVADHLLQHAKQMA-RETHAVRMRVSTSVDNEVAQKVYESIGFRED....................... 138
17 -20.600d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]}  ali model 3D-neighbors follow..  12  3...........IRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNL---------RSKTFIALAAFDQEAVVGALAAYVLPKFEQPRSEIYAVSGEHRRQGIATALINLLKHEA-NALGAYVIYVQADYGDDPAVALYTKLG........................... 137
18 -20.200d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6`)-IY {Salmonella enteritidis [TaxId: 149539]}  ali model 3D-neighbors follow..  11  1.........SHMDIRQMNKTHLEHWRGLRKQ-------------LWPGHPDDAHLADGEEILQADHLA--SFIAMADGVAIGFADASIRHDYVNGCD-GIFVLPSFRQRGVAKQLIAAVQRWG-TNKGCREMASDTSPENTISQKVHQALGFEET....................... 137
19 -19.700d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  2.........EGVKKIKNPSTVKDELLELMRSTNGKYPALEWVKRKPNPNDFNGFREVYEPFLKFSQEFDELYTYQKDNRIIGTIALVYKRMNEKVGLI-FVVDPEFQGKGIGSTLLEFAVKRLRSL---KDPYVVTFPNLEAYSYYYMKKGFREIMRYKE.................. 170
20 -19.700d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  11  2............LIRSATKEDGQAIARLVLV--ILKDMELPILEEVSEEQMIDLLAEATAYPTYRYGYQRILVYEHAGEVAGIAVGYPAEDEKIIDE-TISVDERFRGMGIGSKLLDALPEVA-KASGKQALGLNVDFDNPGARKLYASKGFKDVT...................... 172
21 -19.100d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  19  165........PSEFEIRRLRAEDAAMVHDSWPNKG---------------EGSLTYLQALVRFNKS-----LGICRSDTGELIAWIFQND------FSGLGMQVLPKAERRGLGGLLAAAMSR--IARGEEITLTAWIVATNWRSEALLKRIGYQKDLVN.................... 288
22 -18.300d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  13  2........PDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFCKLIKYWNEATVWNDNEDKKIMQYNPMVIVDKRTETVAATGNIKIIHELGLCGHIDIAVNSKYQGQGLGKLLIDQLVTIG-FDYGCYKIILDCDEKNV---KFYEKCGFSNAGV..................... 151
23 -18.300d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  14  31........EPPYGLRVAQLTDAEMLAEWMNRPHLAAAW----EYDWPASRWRQHLNAQL-----EGTYSLPLIGSWHGTDGGYLELYWAAKDADPYDLGLHADLSKVNRGFGPLLLPRIVASVFNEPRCRRIMFDPDHRNTATRRLCEWAGCKFLGEH.................... 182
24 -17.300d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]}  ali model 3D-neighbors follow..  11  1..........HVTIREATEGDLEQMVHMLADDVLGR-----KRERYEKPLPVSYVRAFKEIKKDKNN----IVACNGEEIVGMLQVTFTPYLTYQGS-GVRTHSAARGQGIGSQLVCWAIERA-KERGCHLIQLTTDKQRPDALRFYEQLGFKAS....................... 142
25 -17.300d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  10  1...........VRIRRAGLEDLPGVARVLVDTWRATYRGVVPEAFLEGLSYEGQAERWAQRLKTPTW-RLFVAESESGEVVGFAAFGPDRASGFPGYTAIYVLPTWQRKGLGRALFHEGAR-LLQAEGYGRMLVWVLKENPKGRGFYEHLGGVLLG--EREIELGGAKLWEVAYG... 166
26 -17.100d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  12  1.........DNITVRFVTENDKEGWQRLWKS------YQDFYEVSFPDDLDDFNFGRFLDP--NIKMWAAVAVESSSEKIIGMINFFNHMTTWDFKDKIYYVDENSRVKGAGGKLIQFVYDEA-DKLGTPSVYWCTDESNHRAQLLYVKVGYKAPKILYK.................. 146
27 -16.900d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  14  33................................................EEYEERHEELFESLLSQGEHKFFVALNERSELLGHVWICITLDTVDYVKIAYEVVKWARGLGIGSALLRKAEEWA-KERGAKKIVLRVEIDN-PAVKWYEERGYKARALIMEKPI............... 149
28 -16.300d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  1.............MRTLNKDEHNYIKQIANETLLSQVESNYKCTKLSIALRYEMICSRLEHTND-------YIYENEGQLIAFIWGHFSNEKSMVNIELLYVEPQFRKLGIATQLKIALEKWA-KTMNAKRISNT........................................... 118
29 -15.800d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  12  2...........VKMKKCSREDLQTLQQLSIET-----FNDTFKEQNSPENMKAYLESAFNTEQLEKELS--FFIYFDHEIAGYVKVNIDDAQSEEMGAEIYIKNSFQKHGLGKHLLNKAIEIA-LERNKKNIWLGVWEKNENAIAFYKKMGFVQTG...................... 150
30 -15.500d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]}  ali model 3D-neighbors follow..  11  1...........AQLRRVTAESFAHLAQLLFETVHGGASVGFMADL-DMQQAYAWCDGLKADIAAGSLLLWVV--AEDDNVLASAQLS--NGLNRAEVQKLMVLPSARGRGLGRQLMDEVEQVA-VKHKRGLLHLDTE-AGSVAEAFYSALAYTRVGELPGYCATDGRLHPTAIY.... 166
31 -14.400d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]}  ali model 3D-neighbors follow..  10  2.........STPALRPYLPEDAAVTAAIFADDYSEEQQEAWASAADDEAKFAARLSG-----------QLTLIATLQGVPVGFASLKG----------DHYVHPDYVGRDVGTTLIDALEKLA-GARGALILTVDA---SDNAAEFFAKRGYV......................... 133
32 -14.200d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]}  ali model 3D-neighbors follow..  12  4.........PANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVP---FYQRFGFHPAGPCAI.................. 152
33 -14.000d1n71a_ d.108.1.1 (A:) Aminoglycoside 6`-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]}  ali model 3D-neighbors follow..  1...........MIISEFDRNNPVLKDQLSDLLRLT----------WPEEYGDSSAEEVEEMMNPERIA---VAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEV-ASRGGITIYLGTDDLREHPYEFYEKLGYKIVGVLPNA................. 161
34 -13.800d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  147........PDGVVIRTYAGTSDDAELLRVNNAAFAGHP----QGGWTAVQLAERRGEAWFDPDGLILAFGDSPRERPGRLLG---FHWTKVHPDHPGLGE-VDPAAQRRGLGQMLTSIGIVSLLDPAVEPAVLLYVESDNVAAVRTYQSLGFT......................... 298
35 -12.600d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  16  1...........LEIRPAVPADAEQILAFIIELADYER---------ARHEVVTDVEGIRRSLFAEGSPTRALMCLSEGRPIG-YAVFFYSYSTWLGRNGIYLEDEYRGVGAGRRLLRELAREAVAN-DCGRLEWSVLDWNQPAIDFYRSIGAL......................... 136
36 -12.200d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11  55.......................................................................LALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYH-IKHNILYFLTYADEY---AIGYFKKQGFSKDIKVPKSRYLG............. 144
37 -11.400d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2`-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  12  1......MHTQVHTARLVHTADLDS-----ETRQDIRQMV-----------TGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRNALRCGYVEVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSS-----SARARRLYASRGWL......................... 132
38 -11.200d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  1..........KFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLE----------DFFVMSDYRGFGIGSEILKNLSQVAMRC-RCSSMHFLVAEWNEPSINFYKRRGAS......................... 144
39 -11.100d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  16  38.......................................................................YVAKQGGSVIGVYVL--LETRPKTMEINIAVAEHLQGKGIGKKLLRHAVET-AKGYGMSKLEVGTGNSSVSQLALYQKCGFRIFSIDFDYFSKH............. 129
40 -10.200d1xfsa_ d.129.3.5 (A:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]}  ali model 3D-neighbors follow..  4........ELDLMLKRELAVPVNLVWRGLTEPELLKKW--FVPKPWSISDCR-------VDLRPGGEFYTVMQDPEGNKFPNSGCFLEVTDEKRLIWTSALVKNPATTSDKECAHIVMTAVIELQPTS-TRYTACAMHNTPGQRKLHEEMGFH-EGWGTTITQLEELLKQEKAY.... 165
41 -10.100d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]}  ali model 3D-neighbors follow..  11  1...........IEVKPINAEDTYELRHRILRPN------------------QPIEACMFESDLLRGAFHLGGY--YGGKLISIASFHQAEHSELQGQKQYQLREGYREQKAGSSLIKHAEEIL-RKRGADLLWCNA---RTSASGYYKKLGFSEQG...................... 126
42 -9.940d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  19  49.......................................................................WSAWEGDELAGCGALKELDTRHGEIKSMR-TSASHLRKGVAKQVLQHIIEEAEKRYERLSLETGSMASFEPARKLYESFGFQ......................... 130
43 -9.280d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]}  ali model 3D-neighbors follow..  13  2...........ITIKKQEIVKLEDVLHLYQA-------VGWTNYTHQTEMLEQALSHSL----------VIYLALDGDAVVGLIRL--VGDGFSSVFVDLIVLPSYQRQGIGSSLMKEAL----GNFKEAYQVQLATEETEKNVGFYRSMGFE......................... 121

FFAS is supported by the NIH grant R01-GM087218-01
6 7 7 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Reed JC, Doctor KS, Godzik A. The domains of apoptosis: a genomics perspective. Sci STKE. 2004 Jun 22;2004(239):re9. Review.