current user: public




d2fcka1
Query: d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MTPDFQIVTQRLQLRLITADEAEELVQCIRQSQTLHQWVDWCHALFSQQEAEQFIQATRLNWVKAEAYGFGVFERQTQTLVGMVAINEFYHTFNMASLGYWIGDRYQRQGYGKEALTALILFCFERLELTRLEIVCDPENVPSQALALRCGANREQLAPNRFLYAGEPKAGIVFSLIPLast
1 -102.000d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors  100  1MTPDFQIVTQRLQLRLITADEAEELVQCIRQSQTLHQWVDWCHALFSQQEAEQFIQATRLNWVKAEAYGFGVFERQTQTLVGMVAINEFYHTFNMASLGYWIGDRYQRQGYGKEALTALILFCFERLELTRLEIVCDPENVPSQALALRCGANREQLAPNRFLYAGEPKAGIVFSLIP 178
2 -84.000d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  23  1...EIIPVSTTLELRAADESHVPALHQLVKNKAWLQQSLDWPQYVTSQEETRKHVQGNILLHQRGYAKMYLIFCQ--NEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQASNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARI. 173
3 -77.700d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  25  3...FTCKVNEHITIRLLEPKDAERLAELIQNQQRLGKWLFFAENPSSADTYETIIPDWRRQYADLNGIEAGLLY--DGSLCGMISLHNLDQVNRKAEIGYWIAKEFEGKGIITAACRKLITYAFEELELNRVAICAAVGNEKSRAVPERIGFLEEGKARDGLYVNGMHHDLVYYSLLK 177
4 -64.800d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  22  3....PTLRTERLTLRPLAMADFPAYRDFMASPRSTGVG-----GPYDLPSTWGVFCHDLANWHFFGHGALMIDLGETGECIGQIGINH-GPLFPEKELGWLLYEGHEGRGYAAEAAVALRDWAFETLNLPTLVSYVSPQNRKSAAVAERIGGTLDPLAPRS-------PEDLVYRYHQ 164
5 -58.700d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  17  3....ITLQRGALRLEPLVEADIPELVSLAEANREALQYM-------DGPTRPDWYRQSLAEQREGRALPLAV--RLGVQLVGTTRFAEFLPALPACEIGWWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGAQREGVLRNHRRLGGRLDDTFVYSITD 169
6 -43.800d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  15  1.........DTVTIKPIRAEHVESFHRALDAVSRERKYLSFLEA-PPLEAVRAFVLDMIENDHP------QFVAIADGDVIGWCDIRRQDRAAHCGTLGMGILPAYRNKGLGARLMRRTLDAA-HEFGLHRIELSVHADNARAIALYEKIGFAHEGRARDAVSIDGHYIDSLNMAII. 162
7 -36.400d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  12  2........STSLTIRLVAEADWPALHALDQI------------IWTKKNTPAEIQPLSLAAYQEKMKDETIFVAISGQQLAGFIEVHSLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDMA-EISGIHKLSLRVMATNQEAIRFYEKHGFVQEAHFKEEFYINGHYCDDYQYAYF. 160
8 -35.200d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  15  24.RPPVPSLEPPYGLRVAQLTDAEMLAEWMNRPHLAAAW----EYDWPASRWRQHLNAQL-----EGTYSLPLIGSWHGTDGGYLELYWAAKDLYDLGLHAAIADSKVNRGFGPLLLPRIVASVFAN-RCRRIMFDPDHRNTATRRLCEWAGCKFLGEHD................... 183
9 -31.600d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  17  2..........EIHFEKVTSDNRKAVENLQVFAE-------------QQAFIESMAENLKESDQFPEWESAGIY--DGNQLIGYAMYGRWQDG-RVWLDRFLIDQRFQGQGYGKAACRLLMLKLIEKYQTNKLYLSVYDTNSSAIRLYQQLGFVFNGELDTN................. 136
10 -30.600d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  16  1..........SLTLRLAEHRDLEAVVAIY-NSTIASRMVTADTEPVTPEDRMEWFSGHTESR------PLYVAEDENGNVAAWISFETFYGRNKTAEVSIYIDEACRGKGVGSYLLQEALRIA-PNLGIRSLMAFIFGHNKPSLKLFEKHGFAEWGLFPGIAEMDGKRYDLKILGR.. 161
11 -29.400d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  13  2...........IMLTPMQTEEFRSYLTYTTKHYAEEKVKAGTLPEDAQLLSKQVFTDLLPRGLETPHHHLWSLKLNEKDIVGWLWIHAEHPQQEAFIYDFGLYEPYRGKGYAKQALAALDQAA-RSMGIRKLSLHVFAHNQTARKLYEQTGFQETDVVMSKKL............... 155
12 -28.800d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  14  2..........QLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRG----------STVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAI-AERHDPDGRRVALIQMD... 155
13 -27.300d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  13  2.............IRDAGVADLPGILAIY-NDAVGNTTAIWNETPVDLANRQAWFDT-----RARQGYPILVASDAAGEVLGYASYGDWRPFEGTVEHSVYVRDDQRGKGLGVQLLQALIERA-RAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLN. 161
14 -25.700d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  10  1...........MKIRVADEKELPMILQFLTEVKAYMD-TQWTKDYPSQGDIQEDITKKR-----------LYLLVHEEMIFSMATFCMEQEQDFVWLKRFATSPNYIAKGYGSLLFHELEKRAVWE-GRRKMYAQTNHTNHRMIRFFESKGFTKIHESLQMNRLDFG........... 147
15 -25.500d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  14  1..........HMDIRTITSSDYEMVTSVLNE---------WGGRQLKEKLPRLFFEHFQDTS---------FITSEHNSMTGFLIGFQSQSDPETAYI-SGVHPDFRKMQIGKQLYDVFIETV-KQRGCTRVKCVTSPVNKVSIAYHTKLGFDIEKGTKTVNNYDGPGQDRVLFVK.. 155
16 -24.800d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  10  2.........DEIKIEKLKKLDKKALNELIDVYMSGYEGLE-EYGGEGRDYARNYIKWCWKKASDG-----FFVAKVGDKIVGFIVCDKDWFSKYEGRHEFVVDKKFQGKGIGRKLLITCLDFL--GKYNDTIELWVGEKNYGAMNLYEKFGFKKVGKSGIWV................ 151
17 -22.800d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  10  1...........MRIVQATLEHLDLLAPLFVK------YREFYGMLSYPESSRKFLE---KRLRRKESVIYLALADEEDRLLGFCQLYPSFSSLSLKRVWIYVAEEARRQLVADHLLQHAKQMA-RETHAVRMRVSTSVDNEVAQKVYESIGFREDQ...................... 139
18 -22.700d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]}  ali model 3D-neighbors follow..  11  1..........HVTIREATEGDLEQMVHMLADDVLGRK------RERYEKPLPVSYVRAFKEIKKDKNNELIVA-CNGEEIVGMLQVTFTPYLTYQGS-GVRTHSAARGQGIGSQLVCWAIERA-KERGCHLIQLTTDKQRPDALRFYEQLGFKASH...................... 143
19 -22.400d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6`)-IY {Salmonella enteritidis [TaxId: 149539]}  ali model 3D-neighbors follow..  13  1.........SHMDIRQMNKTHLEHWRGLRKQ------LWPGHPDDAHLADGEEILQADHLA---------SFIAMADGVAIGFADASIRHDYVNGCD-GIFVLPSFRQRGVAKQLIAAVQRWG-TNKGCREMASDTSPENTISQKVHQALGFEETE...................... 138
20 -22.100d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]}  ali model 3D-neighbors follow..  12  3...........IRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNL---------RSKTFIALAAFDQEAVVGALAAYVLPKFEQPRSEIYAVSGEHRRQGIATALINLLKHEA-NALGAYVIYVQADYGDDPAVALYTKLG........................... 137
21 -22.000d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  11  1..........SVKMKKCSREDLQTLQQLSIET-----FNDTFKEQNSPENMKAYLESAFNTEQLEKELS--FFIYFDHEIAGYVKVNIDDAQSEEMGAEIYIKNSFQKHGLGKHLLNKAIEIA-LERNKKNIWLGVWEKNENAIAFYKKMGFVQTGA-HSFYMGDEEQTDLIMAKTL. 170
22 -21.800d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  11  2............LIRSATKEDGQAIARLVL--VILKDMELPILEEVSEEQMIDLLAEATAYPTYRYGYQRILVYEHAGEVAGIAVGYPAEDEKIIDEPTISVDERFRGMGIGSKLLDALPEVA-KASGKQALGLNVDFDNPGARKLYASKGFKDVTTMT................... 175
23 -21.500d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  12  1.........DNITVRFVTENDKEGWQRLWKS------YQDFYEVSFPDDLDDFNFGRFLDP--NIKMWAAVAVESSSEKIIGMINFFNHMTTWDFKDKIYYVDENSRVKGAGGKLIQFVYDEA-DKLGTPSVYWCTDESNHRAQLLYVKVGYKAP....................... 141
24 -20.800d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  11  1...........VRIRRAGLEDLPGVARVLVDT-----WRATYRGVVPEAFLEGLSYEGQAERTPTWPGRLFVAESESGEVVGFAAFGPDRASGYTAELAIYVLPTWQRKGLGRALFHEGARLL-QAEGYGRMLVWVLKENPKGRGFYEHLGGVLLG--EREIELGGAKLWEVAYG... 166
25 -20.800d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  18  165........PSEFEIRRLRAEDAAMVHDSWP---------------NKGEGSLTYLQALVRFNKS-----LGICRSDTGELIAWIFQN------DFSGLGLQVLPKAERRGLGGLLAAAMSREIARG-EEITLTAWIVATNWRSEALLKRIGYQKDLVNE................... 289
26 -20.600d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  14  1..........EYTIVD-GEEYIEEIKKLDREISYSFV-----RFPISYEEYEERHEELFESLLSQGEHKFFVALNERSELLGHVWICITLDTVDYVKIAYEVVKWARGLGIGSALLRKAEEWA-KERGAKKIVLRVEIDN-PAVKWYEERGYKARALIMEKPI............... 149
27 -20.500d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]}  ali model 3D-neighbors follow..  4.........PANEFRCLTPEDAAGVFEIEREA--------FISVSGNCPLNLDEVQHFLTLCPE-----LSLGWFVEGRLVAFIIGSLWDEERLTQESALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMC---EDALVPFYQRFGFHPAGPCAIVV................ 154
28 -20.200d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  11  2........PDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFCKLIKYWNEATVWNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELG-DIAVNSKYQGQGLGKLLIDQLVTIG-FDYGCYKIILDC---DEKNVKFYEKCGFSNAGV..................... 151
29 -20.100d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]}  ali model 3D-neighbors follow..  11  3.............LRRVTAESFAHYRHGLAQETVHGGASVGFMADLDMQQAYAWCDGLKADIAAGSLLLWVV--AEDDNVLASAQLSLCQKPNNRAEVKLMVLPSARGRGLGRQLMDEVEQVA-VKHKRGLLHLDTE-AGSVAEAFYSALAYTRVGELPGYCATDGRLHPTAIY.... 166
30 -19.800d1iyka2 d.108.1.2 (A:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]}  ali model 3D-neighbors follow..  34....LPNNPKLKGLRPMTGKDVSTVLSLLYKYQERFDI----VQLFTEEEFKHWMLG-HDENSDSNVVKSYVVEDENGIITDYFSYYLLNAQHDELGIAYLFNYKKRLNELITDALITSKKFGVDVFNCLTC--------QDNTYFLKDCKFGSDGFLNYYLF............... 196
31 -18.000d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  15  2..........SVVIERIPKEAIPKSLLLLADP--------------SERQIATYVQRGL-----------TYVAKQGGSVIGVYVLLETRPKTMEI-MNIAVAEHLQGKGIGKKLLRHAVETA-KGYGMSKLEVGTGNSSVSQLALYQKCGFRIFSIDFDYF................ 126
32 -17.900d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  2.........EGVKKIKNPSTVKDELLELMNGKYPALEWVKRKPNPNDFNGFREVYEPFLKFRLSQEFDELYTY-QKDNRIIGTIALVYKRMNEKVGLI-FVVDPEFQGKGIGSTLLEFAVKRLRSL---KDPYVVTFPNLEAYSYYYMKKGFREIMRYKEFVILKFNHKK........ 180
33 -17.500d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]}  ali model 3D-neighbors follow..  13  2.........STPALRPYLPEDAAVTAAIFVAS-----IEQLTADDYSEEQQEAWASAADDEAKFAARLS-TLIATLQGVPVGFASLK------GPDHIDLYVHPDYVGRDVGTTLIDALEKLA-GARGALILTVDA---SDNAAEFFAKRGYVAKQ--RNTVSINGEWLANTTMT... 153
34 -17.000d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  1.............MRTLNKDEHNYIKQIANETLLSQVESNYKCTKLSIALRYEMICSRLEHTND------IYIYENEGQLIAFIWGHFSNEKSMVNIELLYVEPQFRKLGIATQLKIALEKWA-KTMNAKRISNT........................................... 118
35 -16.400d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  12  210..........................................................................ERPGRLLGFHWTKVHPDHPGLGEVVLGVDPAAQRRGLGQMLTSIGIVSLLDPAVEPAVLLYVESDNVAAVRTYQSLGFTTYSVDTAYAL............... 308
36 -16.300d1n71a_ d.108.1.1 (A:) Aminoglycoside 6`-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]}  ali model 3D-neighbors follow..  1...........MIISEFDRNNPVLKDQLSDLLRLT-------PEEYGDSSAEEVEEMMNPE-------RIAVAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEV-ASRGGITIYLGTDDLDHGTTEFYEKLGYKIVGVLPNA................. 161
37 -15.800d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  16  1...........LEIRPAVPADAEQILAFIIELADYER---------ARHEVVTDVEGIRRSLFAEGSPTRALMCLSEGRPIGYAVFFYSYSTWLGRNGIYYVTPEYRGVGAGRRLLRELAREAVAN-DCGRLEWSVLDWNQPAIDFYRSIGAL......................... 136
38 -15.000d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  12  43.......................................................................VVKNEEGKIFGGVTGTMYFYHLHIDFL--WVDESVRHDGYGSQLLHEIEGIA-KEKGCRLILL--DSFSFQAPEFYKKHGYREYGVVEDH................. 127
39 -13.900d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2`-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  15  1......MHTQVHTARLVHTADL--------DSETRQDIRQMVTGAFAGDFTETDWEHTLGGMH--------ALIWHHGAIIAHAAVRRLIYRGNALRCGY-VRADWRGQRLVSALLDAVEQVMRGAYQLGALSS-----SARARRLYASRGWL......................... 132
40 -13.400d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]}  ali model 3D-neighbors follow..  11  1..........RFKYTKASQENIQQLGNILE---------------QCFVMSFGDSEIYVKGIGLENF----RVIYREQKVAGGLAILPMGQWWGGQRVAVGIAPEYRGDGAAIALIQHTLQ------EISEQDIPISVLYPATQRLYRKAGYE......................... 124
41 -13.100d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  1..........KFVIRPATAADCSDILRLIKELAKYEY---------MEEQVILTEKDLLEDGFGEHPFYHCLVAEEGHSIVGFAMYYFTYDPWIGKLLDFFVMSDYRGFGIGSEILKNLSQVAMRC-RCSSMHFLVAEWNEPSINFYKRRGAS......................... 144
42 -13.000d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  17  49.......................................................................WSAWEGDELAGCGALKELDTR--HGEISMRTSASHLRKGVAKQVLQHIIEEAEKRYERLSLETGSMASFEPARKLYESFGFQYCEPFADY................. 138
43 -12.900d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  1.........TTKRVKKMGKEEMKEMFDLVIYA-------------FNQEPTAERQERFEKLLSHTQ----SYGFLIDEQLTSQVMATPFQVNFHGVRYYVASYPEYRGEGGISAIMKEMLA------DLAKQKVALSYLAPFSYPFYRQYGYEQTFEQAEY................. 135
44 -12.600d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  11  40.......................................................................TIRNDDNSVTGGLVGHTARGWLYVQLL--FVPEAMRGQGIAPKLLAMAEEEA-RKRGCMGAYI--DTMNPDALRTYERYGFTKIGSLGPL................. 124
45 -12.600d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  10  1...........LTLKPVEEEHIDQFNELLSYV----------TEADIEESGFENKRAFIKSKQPILELSKVFGWFHENQLISQIAIYPCEVNIHGALYGVGTYPEYANHGLMKDLIQTALE------EMRQDKQWISYLFPYNIPYYRRKGWE......................... 135
46 -12.100d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  10  1........SLDWTCKHHADLTLKELYALLQLRTEV---------------VEQKCPYQEVDGLDLVGDTHHLMAWRDGQLLAYLRLLDPVRHEGQVVIGVVSSSAARGQGLGHQLMERALQAAERLWLDTPVYLSAQAH---LQAYYGRYGFVAVT...................... 133
47 -12.100d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13.............TPKANRRVLLWLVGLQN-----------------SHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRM---PTQGFTEIVFCVTSNEQVKGYGTHLMNHLKEYH-IKHNILYFLTYA---DEYAIGYFKKQGFSKDIKVPKSRYLG............. 144
48 -11.700d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]}  ali model 3D-neighbors follow..  13  2...........ITIKKQEIVKLEDVLHLYQA-------VGWTNYTHQTEMLEQALSHSL----------VIYLALDGDAVVGLIRL--VGDGFSSVFVDLIVLPSYQRQGIGSSLMKEAL----GNFKEAYQVQLATEETEKNVGFYRSMGFE......................... 121
49 -10.400d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  13  1...........MVKVTYDIPTCEDYCALRINA-----------SPKTREAAEKGLPNAL----------FTVTLYDKDRLIGMGRV--IGDGGTVFQIDIAVLKSYQGQAYGSLIMEHIMKY-IKNVSVESVYVSLIA-DYPADKLYVKFGFM......................... 120
50 -9.950d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]}  ali model 3D-neighbors follow..  32..............................................................SDLLRGAFHLGGYYGGKLISIASFHQAEHSELQGQKQYQLREGYREQKAGSSLIKHAEEIL-RKRGADLLWCNA---RTSASGYYKKLGFSEQG...................... 126
51 -9.250d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  3.....HMIVQIGRREEFDKKLLGEMHKL--RAQVFKERKGWDVSVIDEMEIDGY----------DALSPYYMLIQEDGQVFGCWRIKEAPCSPHIWELSFAINSGQKGSLGFSDCTLEAMRALARYSLQNDIQTLVTVTTVGVEKMMIRAGLDVSRF..................... 162

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 1 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Friedberg I, Jaroszewski L, Ye Y, Godzik A. The interplay of fold recognition and experimental structure determination in structural genomics. Curr Opin Struct Biol. 2004 Jun;14(3):307-12.