current user: public




Query: d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MTPDFQIVTQRLQLRLITADEAEELVQCIRQSQTLHQWVDWCHALFSQQEAEQFIQATRLNWVKAEAYGFGVFERQTQTLVGMVAINEFYHTFNMASLGYWIGDRYQRQGYGKEALTALILFCFERLELTRLEIVCDPENVPSQALALRCGANREQLAPNRFLYAGEPKAGIVFSLIPLast
1 -109.000d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors  100  1MTPDFQIVTQRLQLRLITADEAEELVQCIRQSQTLHQWVDWCHALFSQQEAEQFIQATRLNWVKAEAYGFGVFERQTQTLVGMVAINEFYHTFNMASLGYWIGDRYQRQGYGKEALTALILFCFERLELTRLEIVCDPENVPSQALALRCGANREQLAPNRFLYAGEPKAGIVFSLIP 178
2 -77.200d3r9fa_ d.108.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  23  4LTPSGIKVNDEITLLYPALKYAEELYLLINQNKIFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYK--TKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKV. 179
3 -77.100d1s7ka_ d.108.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]}  ali model 3D-neighbors follow..  23  6........STTLELRAADESHVPALHQLVLKNKALQQSLDWPQYVTSQEETRKHVQGNILLHQRGYAKMYLIFCQ--NEMAGVLSFNAIEPINKAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQASNAVARRNHFTLEGCMKQAEYLNGDYHDVNMYARII 174
4 -75.600d1nsla1 d.108.1.1 (A:1-179) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  25  2...FTCKVNEHITIRLLEPKDAERLAELIIQNQQLGKWLFFAENPSSADTYREIIPDWRRQYADLNGIEAGLLYD--GSLCGMISLHNLDQVNRKAEIGYWIAKEFEGKGIITAACRKLITYAFEELELNRVAICAAVGNEKSRAVPERIGFLEEGKARDGLYVNGMHHDLVYYSLLK 176
5 -64.200d4k4la_ d.108.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  17  1..........QLTLRALERGDLRFIHNLNNNRNIMSYWFE--EPYESFDELEELYN----KHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQ 162
6 -60.100d3igra_ d.108.1.0 (A:) automated matches {Vibrio fischeri [TaxId: 312309]}  ali model 3D-neighbors follow..  21  3.....SFEFEHYQVRLIKSSDAVTIANYFMRNRHLAPWEPRSHAFFTPEGWKQRLLQLVELHKHNLAFYFVVVDKNEHKIIGTVSYSNITRPFHAGHVGYSLDSEYQGKGIMRRAVNVTIDWMFKAQNLHRIMAAYIPRNEKSAKVLAALGFVKEGEAKKYLYINGAWEDHILTSKIN 178
7 -51.200d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  21  1..SIPTLRTERLTLRPLAMADFPAYRDFMASPRSTG-----VGGPYDLPSTWGVFCHDLANWHFFGHGALMIDLGETGECIGQIGINH-GPLFPEKELGWLLYEGHEGRGYAAEAAVALRDWAFETLNLPTLVSYVSPQNRKSAAVAERIGGTLDP...................... 148
8 -44.100d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  18  4.....TLQRGALRLEPLVEADIPELVSLAEANREALQY-------MDGPTRPDWYRQSLAEQREGRALPLAV--RLGVQLVGTTRFAEFLPALPACEIGWWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGAQREGVLRNHRRLGGRLDDTFVYSITD 169
9 -42.200d2z10a_ d.108.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}  ali model 3D-neighbors follow..  13  6....ERFEGRHVRLEPLALAHLPAFLRHYDPE--VYRFLSRAPVAPTEEALRAHLEGL---LGEPGRVNWAIL--FGKEVAGRISVIAPEPEHAKLELGTMLFKPFWGSPANKEAKYLLLRHAFEVLRAERVQFKVDLRNERSQRALEALGAVREGVLRKNRRLDGAFRDDVVYSVLK 173
10 -42.100d2vi7a_ d.108.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  14  1..........TIRLERYSERHVEGLTALYNDPAVARQVLQ--MPYQSVEQRRKRLHD-----SADDDRLLILVALHQGDVIGSASLHPRIRRSHSGSIGMGVAVAWQGKGVGSRLLGELLDIADNWMNLRRVELTVYTDNAPALALYRKFGFETEGEMRDYAVRDGRFVDVYSMARLR 163
11 -40.700d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  15  1.........DTVTIKPIRAEHVESFHRALDAVSRERKYLSFLEA-PPLEAVRAFVLDMIEN-------HPQFVAIADGDVIGWCDIQDRATRAHCGTLGMGILPAYRNKGLGARLMRRTLDAA-HEFGLHRIELSVHADNARAIALYEKIGFAHEGRARDAVSIDGHYIDSLNMAII. 162
12 -37.400d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  13  2........STSLTIRLVAEADWPALHALDQIIWT------------KKNTPAEIQPLSLAAYQEKMKDETIFVAISGQQLAGFIEVHSLAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDMA-EISGIHKLSLRVMATNQEAIRFYEKHGFVQEAHFKEEFYINGHYCDDYQYAYF. 160
13 -35.900d3ld2a1 d.108.1.0 (A:1-158) automated matches {Streptococcus mutans [TaxId: 210007]}  ali model 3D-neighbors follow..  10  1...........MKISPMLLSDIEQVVELENK--------TWSEQNTPVPLPVASKDQIIQKFESNTHF---LVAKIKDKIVGVLDYYPFPSGQHIVTFGIAVAEKERRKGIGRALVQIFLNEV--KSDYQKVLIHVLSSNQEAVLFYKKLGFDLEARLTKQFFLKGQYVDDLIYSYD. 156
14 -35.300d2i79a_ d.108.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}  ali model 3D-neighbors follow..  17  2........EYELLIREAEPKDAAELVAFLNRVSLETDFTSL-GILLTSEEMEIFLNK-----QASSDNQITLLAFLNGKIAGIVNITQRKRVRHIGDLFIVIGKRYWNNGLGSLLLEEAIEWAQASGILRRLQLTVQTRNQAAVHLYQKHGFVIEGSQERGAYIEGKFIDVYLMGKL. 170
15 -29.900d1vhsa1 d.108.1.1 (A:2-163) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  16  1............TLRLAEHRDLEAVVAIYNST-IASRMVTADTEPVTPEDRMEWFS------GHTESRPLYVAEDENGNVAAWISFETFYGRNKTAEVSIYIDEACRGKGVGSYLLQEALRIA-PNLGIRSLMAFIFGHNKPSLKLFEKHGFAEWGLFPGIAEMDGKRYDLKILGR.. 159
16 -29.600d4m3sa_ d.108.1.1 (A:) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  12  2..........QLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRG----------STVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE 159
17 -25.800d2j8ma_ d.108.1.1 (A:) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  13  2...........ASIRDAGVADLPGILAIYNDA-VGNTTAIWNETPVDLANRQAWFDA-----RARQGYPILVASDAAGEVLGYASYGDWRPFRGTVEHSVYVRDDQRGKGLGVQLLQALIERA-RAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQL.. 162
18 -24.300d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  13  1..........TIMLTPMQTEEFRSYLTYTTKHYAEEKVKAGTLPEDAQLLSKQVFTDLLPRGLETPHHHLWSLKLNEKDIVGWLWIHAEPEHPQQEAYDFGLYEPYRGKGYAKQALAALDQAA-RSMGIRKLSLHVFAHNQTARKLYEQTGFQETDVVMSKKL............... 155
19 -23.300d1mk4a1 d.108.1.1 (A:1-156) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  15  1...........MDIRTITSSDYEMVTSVLNEW--------WGGRQLKEKLPRLFFEHFQDTS---------FITSEHNSMTGFLIGFQSQSDPETAYIHF-VHPDFRKMQIGKQLYDVFIE-TVKQRGCTRVKCVTSPVNKVSIAYHTKLGFDIE....................... 127
20 -22.200d4jxqa_ d.108.1.0 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}  ali model 3D-neighbors follow..  16  3...........ATLRDAVAADLRSITEIYRES-VLNGVATYEETPPSEAEMALRFST-----ITGNGYPYVVALDERGAVIGYAYASAFRNRTALVEDSIYLSPEARGKGIGKALLSELVGRC-TALGFRQMIAVIGGAHPSSIALHRALGFELQGLMKATGFKHGRWLDTAFMQR.. 163
21 -22.200d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  17  2..........EIHFEKVTSDNRKAVENLQVFAEQQAF-------------IESMAENLKESDQFPEWESAGIY--DGNQLIGYA-MYGRWQDGRVWLDRFLIDQRFQGQGYGKAACRLLMLKLIEKYQTNKLYLSVYDTNSSAIRLYQQLGFVFNG...................... 131
22 -21.900d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  2.........DEIKIEKLKKLDKKALNELIDVYMSGYEGLE--YGGEGRDYARNYIKWCWKKASDG------FVAKVGDKIVGFIVCDKDWFSKYEGRIEFVVDKKFQGKGIGRKLLITCLDFLGKY---DTIELWVGEKNYGAMNLYEKFGFKKVGKSGIWVRMIKR........... 156
23 -21.300d3ne7a_ d.108.1.0 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}  ali model 3D-neighbors follow..  13  2..........SIEIRKLSIEDLETLIEVARES-----WKWTYAGIYSEEYIESWIREKYSKEKLLNEIVLFLGAFADSTLIGFIELKIIANKAELLRL--YLKPEYTHKKIGKTLLLEAEKIM-KKKGILECRLYVHRQNSVGFSFYYKNGFKVEDTDGSDFIMEKKY.......... 159
24 -21.100d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  11  1...........MKIRVADEKELPMILQFLTEVKAYMD--QWTKDYPSQGDIQEDITKKR-----------LYLLVHEEMIFSMATFCMEQEQDFVWLKRFATSPNYIAKGYGSLLFHELEKRAVWE-GRRKMYAQTNHTNHRMIRFFESKGFTKIHES.................... 138
25 -20.900d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]}  ali model 3D-neighbors follow..  12  3...........IRTCRLGPDQVKSMRAALDLFGREFGDVATYSQHQPDSDYLGNL---------RSKTFIALAAFDQEAVVGALAAYVLPKFEQPRSEIY-VSGEHRRQGIATALINLLKHEA-NALGAYVIYVQADYGDDPAVALYTKLG........................... 137
26 -20.400d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  10  1...........MRIVQATLEHLDLLAPLFVK------YREFYGMLSYPESSRKFLE---KRLRRKESVIYLALADEEDRLLGFCQLYPSFSSLSLKRVWIYVAEEARRQLVADHLLQHAKQMA-RETHAVRMRVSTSVDNEVAQKVYESIGFRED....................... 138
27 -19.800d4evya1 d.108.1.0 (A:1-145) automated matches {Acinetobacter haemolyticus [TaxId: 29430]}  ali model 3D-neighbors follow..  1...........MNIKPASEASLKDWLELRNK--------------LWSDSEASHLQEMHQLLAEKYAL--QLLAYSDHQAIAMLEASIRFEYVNGTE-GIYVLPAHRRSGVATMLIRQAEVWA-KQFSCTEFASDAALDNVISHAMHRSLGFQETE...................... 135
28 -19.600d3fnca_ d.108.1.0 (A:) automated matches {Listeria innocua [TaxId: 272626]}  ali model 3D-neighbors follow..  14  2..........DFHIRKATNSDAEAIQHVATTS-----WHHTYQDLIPSDVQDDFLKRFYNVETLHNRIS--AVLEQADKVIGFANFIELEKGKSELAAFY-LLPEVTQRGLGTELLEVGMTLF----VPLPMFVNVEKGNETAIHFYKAKGFVQVE--EFTEDFYGYPLETIRFNL.. 158
29 -19.000d2vbqb_ d.108.1.1 (B:) Aminoglycoside N-acetyltransferase AAC(6`)-IY {Salmonella enterica [TaxId: 28901]}  ali model 3D-neighbors follow..  14  2.............IRQMNKTHLEHWRGLRKQ------LWPGHPDDAHLADGEEILQADHLAS---------FIAMADGVAIGFADASIRHDYVNGCD-GIFVLPSFRQRGVAKQLIAAVQRWGTNK-GCREMASDTSPENTISQKVHQALGFEET....................... 134
30 -18.800d1u6ma1 d.108.1.1 (A:4-189) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  12  1.............IRSATKEDGQAIARLVLV--ILKDMELPILEEVSEEQMIDLLAEATAYPTYRYGYQRILVYEHAGEVAGIA-------------VGY-VDERFRGMGIGSKLLDALPEVA-KASGKQALGLNVDFDNPGARKLYASKGFKDVTTMT----ISGHLYNHMQKEV.. 186
31 -18.700d4m85a1 d.108.1.0 (A:1-182) automated matches {Staphylococcus aureus [TaxId: 158878]}  ali model 3D-neighbors follow..  10  1............MIRQARPEDRFDIAKLVYM--VWDDMELELVKHLPKDMVLDAIEKSCVDATYRTFYQHILVYEVENKVAGCIQYGTPLPVKEAKDDEYYIEAAYRGRGIATK----LLTSLLESNTHVKWSLNCDINNEAALKLYKKVGFISDG...................... 168
32 -18.300d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  14  2........PDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFCKLIKYWNEATVWNDNEDKKIMQYNPMVIVDKRTETVAATGNI---KIIHELGLCGH-VNSKYQGQGLGKLLIDQLVTIG-FDYGCYKIILDCDEKNV---KFYEKCGFSNAGV..................... 151
33 -17.700d2x7ba_ d.108.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}  ali model 3D-neighbors follow..  11  1..........DFTLRNARMDDIDQIIKINRLT---------LPENYPYYFFVEHLKEYGLAF---------FVAIVDNSVVGYIQLPSLVRKGHVVSIA--VLEEYRRKGIATTLLEASMKSMKNDYNAEEIYLEVRVSNYPAIALYEKLNFKKVKVLKGYY................ 144
34 -17.500d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  19  165........PSEFEIRRLRAEDAAMVHDSWPNKG---------------EGSLTYLQALVRFNKS-----LGICRSDTGELIAWIFQND------FSGLGMQVLPKAERRGLGGLLAAAMSR--IARGEEITLTAWIVATNWRSEALLKRIGYQKDLVN.................... 288
35 -16.900d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  2.........EGVKKIKNPSTVKDELLELMRSTNGKYPALEWVKRKPNPNDFNGFREVYEPFLKFSQEFDELYTYQKDNRIIGTIALVYKRMNEKVGLI-FVVDPEFQGKGIGSTLLEFAVKRLRSL----DPYVVTFPNLEAYSYYYMKKGFREIMRYKEF................. 171
36 -16.700d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  12  1...........VRIRRAGLEDLPGVARV-----LVDTWRAFLEGLSYEGQAERWAQRLKTPTWPGRLF---VAESESGEVVGFAAFGPDRASGFPGYTAIYVLPTWQRKGLGRALFHEGAR-LLQAEGYGRMLVWVLKENPKGRGFYEHLGGVLLG--EREIELGGAKLWEVAYG... 166
37 -16.400d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  14  25........................................FVRFPISYEEYEERHEELFESLLSQGEHKFFVALNERSELLGHVWICITLDTVDYVKIAYEVVKWARGLGIGSALLRKAEEWA-KERGAKKIVLRVEIDN-PAVKWYEERGYKARALIMEKPI............... 149
38 -16.300d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  14  31........EPPYGLRVAQLTDAEMLAEWMNRPHLAAAW----EYDWPASRWRQHLNAQLEGSWHGTDGGYLELYWAAKDLISHY------YDADPYDLGLHADLSKVNRGFGPLLLPRIVASVFNEPRCRRIMFDPDHRNTATRRLCEWAGCKFLGEH.................... 182
39 -16.200d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  1.............MRTLNKDEHNYIKQIANETLLSQVESNYKCTKLSIALRYEMICSRLEHTND-----KIYIYENEGQLIAFIWGHFSNEKSMVNIELLYVEPQFRKLGIATQLKIALEKWA-KTMNAKRISNT........................................... 118
40 -15.900d3i9sa_ d.108.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  1..........SVEIKRVDKHHCLDLVGIFIELERYYFGDKAASEQDLANYLSHQV--------SEHSGVKVIAAVEHDKVLGFATYTIMFPAPKLSGQMYFVSSSARGKGIGLQLMKHLATIAITH-NCQRLDWTAESTNPTAGKFYKSIGAS......................... 139
41 -15.300d3i3ga_ d.108.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}  ali model 3D-neighbors follow..  2..........DLELRVLEESDLSSHLELLGHLTEAP------------PLSGVELANIADMRRRAGIVTKVFCHQPTGRIVGSASLMIQPKFTRGGRADVVVDPSYRGAGLGKALIMDLCEIS-RSKGCYKVILDSSEKSL---PFYEKLGFRAHER..................... 137
42 -15.300d2fiwa1 d.108.1.1 (A:0-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]}  ali model 3D-neighbors follow..  11  1......MVMSTPALRPYLPEDAAVTAAIFVAS-SEEQQEAWASAADDEA-----------KFAARLSGQLTLIATLQGVPVGFASLKG----------DHYVHPDYVGRDVGTTLIDALEKLA-GARGALILTVDA---SDNAAEFFAKRGYV......................... 135
43 -14.700d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]}  ali model 3D-neighbors follow..  11  1..........HVTIREATEGDLEQMVHMLADDVL--------RKRERYEKPLPVSYVRAFKEIKKDKNNELIVACNGEEIVGMLQVTFTPYLTYQGS-GVRTHSAARGQGIGSQLVCWAIERA-KERGCHLIQLTTDKQRPDALRFYEQLGFKAS....................... 142
44 -14.700d4kvxa_ d.108.1.0 (A:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}  ali model 3D-neighbors follow..  10  2.............IRPARISDLTGMQNCNLHN------------------PENYQLKYYLYHAISWPMLSYVATDPKGRVVGYVLAKMEEEPKDGIPHGH-VMRSYRHLGLAKRLMVQSQRAMVEVYGAKYMSLHVRKSNRAAIHLRDTLQFDVQGIESKYY................ 138
45 -14.600d2hv0a_ d.108.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  31.....THPGEGLVLRPLCTADLNRGFFKVLGQ-----------TETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATL---KFIHSCAKRGR-VSDECRGKQLGKLLLSTLTLLS-KKLNCYKITLECLPQNV---GFYKKFGYTVSEE..................... 173
46 -14.600d4ag7a_ d.108.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}  ali model 3D-neighbors follow..  10  19........PDNFKVRPLAKDDFSKGYVDLLSQ---------LTSVGNLDQEAFEKRFEAMRTSVPNYHIVVIEDSNSQKVVASASLVVEMKFIHGAGSDVVVDTEMRRQKLGAVLLKTLVSLG-KSLGVYKISLECVPELL---PFYSQFGFQDDCN..................... 159
47 -14.500d4e2aa_ d.108.1.0 (A:) automated matches {Streptococcus mutans [TaxId: 1309]}  ali model 3D-neighbors follow..  15  1..........QVEIRKVNQDELSLLQKIAIQT-----FRETFAFDNTAEQLQNFFDEAYTLSVLKLELSETYFILMSGKAAGFLKVNWGSSQTEQVL--LYILKAYQGLGLGKQLFEFALERA-QISGLSWVWLGVWEKNVKAQLLYAKYGFEQFS...................... 150
48 -14.400d1n71a_ d.108.1.1 (A:) Aminoglycoside 6`-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]}  ali model 3D-neighbors follow..  1...........MIISEFDRNNPVLKDQLSD-----------LRLTWPEEYGDSSAEEVEEMMNPER---IAVAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEV-ASRGGITIYLGTDDLREHPYEFYEKLGYKIVGVLPNA................. 161
49 -14.300d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  12  1.........DNITVRFVTENDKEGWQRL---------WKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMWAAVAVESSEKIIGMINFFNHMTTWDFKDKIYYVDENSRVKGAGGKLIQFVYDEA-DKLGTPSVYWCTDESNHRAQLLYVKVG........................... 137
50 -14.300d2veza_ d.108.1.0 (A:) automated matches {Aspergillus fumigatus [TaxId: 5085]}  ali model 3D-neighbors follow..  12  20........PADYTIRPLCRSDYKRGYLDVLRV-----------TTVGDINEEQWNSRYEWIRARSDEYYLLVVCDGEGRIVGTGSLVVERKFIHSLGMDIAVEKGQQGKKLGLRIIQALDYVA-EKVGCYKTILDCSEANE---GFYIKCGFKRAGL..................... 159
51 -14.100d1tiqa1 d.108.1.1 (A:2-172) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  12  2...........VKMKKCSREDLQTLQQLSIET-----FNDTFKEQNSPENMKAYLESAFNTEQLEKELS--FFIYFDHEIAGYVKVNIDDAQSEEMG--IYIKNSFQKHGLGKHLLNKAIEIA-LERNKKNIWLGVWEKNENAIAFYKKMGFVQTG...................... 150
52 -13.600d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]}  ali model 3D-neighbors follow..  12  4.........PANEFRCLTPEDAAGVFEIEREAFISVSGNCPLNLDEVQHFLTLCPELSLGWFVEGRLVAFIIGSLWDEERLTQESLALHRPRGHSAHLALAVHRSFRQQGKGSVLLWRYLHHVGAQPAVRRAVLMCEDALVP---FYQRFGFHPAGPCAI.................. 152
53 -13.600d3t90a_ d.108.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  11  1.........ETFKIRKLEISDKRKGFIELLGQ---------LTVTGSVTDEEFDRRFEEIRSYGDDHVICVIEEETSGKIAATGSV---KFLRNCGKAGH-VDSRFRGKQLGKKVVEFLMDHC-KSMGCYKVILDCSVENK---VFYEKCGMSNKSI..................... 140
54 -12.700d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  17  1...........LEIRPAVPADAEQILAFIIELADYERARHEVVTDVEGIRRSLFPTRALMCLSEGRPIGYAVFFYSYSTWLGRNGIYLED---------LYVTPEYRGVGAGRRLLRELAREAVAN-DCGRLEWSVLDWNQPAIDFYRSIGAL......................... 136
55 -12.100d2b5ga_ d.108.1.1 (A:) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  1.........AKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLE----------DFFVMSDYRGFGIGSEILKNLSQVAMRC-RCSSMHFLVAEWNEPSINFYKRRGAS......................... 145
56 -11.600d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  55.......................................................................LALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYH-IKHNILYFLTYA---DEYAIGYFKKQGFSKDIKVPKSRYLG............. 144
57 -11.600d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  148.........DGVVIRTYAGTSDDAELLRVNNAAFAGHP------EQGGWTAVQLAERRGEAWFDPDGLILAFGDSPRERPGRLLGFHWTKVHPDHPGLGE-VDPAAQRRGLGQMLTSIGIVSTLDPAVEPAVLLYVESDNVAAVRTYQSLGFT-------------TYSVDTAYAL.. 308
58 -11.200d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]}  ali model 3D-neighbors follow..  10  19.....................AQLLFETVHGGASVGFMAD-----LDMQQAYAWCDGLKADIAAGSLLLWVV--AEDDNVLASAQLSLCQKPNNRAEVQLMVLPSARGRGLGRQLMDEVEQVAVKH---RGLLHLDTEAGSVAEAFYSALAYTRVGELPGYCATDGRLHPTAIY.... 166
59 -11.100d1y9ka1 d.108.1.1 (A:2-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  16  37.......................................................................YVAKQGGSVIGVYVL--LETRPKTMEINIAVAEHLQGKGIGKKLLRHAVET-AKGYGMSKLEVGTGNSSVSQLALYQKCGFRIFSIDFDYFSKH............. 128
60 -11.000d3uida1 d.129.3.0 (A:2-161) automated matches {Mycobacterium smegmatis [TaxId: 246196]}  ali model 3D-neighbors follow..  10  3TDVKHDLDTLTLTITAEFAAPVTRIWQIYADPRQLEKV--WGPPSHPATVVD-------HDLRPGGRVTYFMTGPDGEKYAGYWEITAVDEPHSFSFLDGFADEDFN----NTDLPVSTNVYTFTEHD-TRATYVGTYASAEALQQVLDMGVI-EGASSAINQIDA............ 156
61 -10.400d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2`-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  12  1......MHTQVHTARLVHTAD------------------------LDSETRQDIRQMVTGAFAGDFT-GMHALIWHHGAIIAHAAVIQRRLIYRGNALGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSS-----SARARRLYASRGWL......................... 132
62 -10.200d2lf2a1 d.129.3.0 (A:1-167) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}  ali model 3D-neighbors follow..  14.......ENKTITIKREFAAVRAIVWEAFTRAEILDQW--WAPKPWKAKTKS-------MDFKEGGTWLYAMVGPNGEEHWSICEYAIIKPIERFTGKDGFTDAS----KLNTEMPRSNWDMRFIDKG-TEVQYHISYDDVAQLEATIQMGFK-EGI..................... 151
63 -9.940d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]}  ali model 3D-neighbors follow..  11  1...........IEVKPINAEDTYELRHRI------------------LRPNQPIEACMFESDLLRGAFHLGGY--YGGKLISIASFHQAEHSELQGQ-GMATLEGYREQKAGSSLIKHAEEIL-RKRGADLLWCNA---RTSASGYYKKLGFSEQG...................... 126
64 -9.710d1xfsa_ d.129.3.5 (A:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]}  ali model 3D-neighbors follow..  3.......AELDLMLKRELAVPVNLVWRGLTEPELLKKW--FVPKPWSISDCR-------VDLRPGGEFYTVMQDPEGNKFPNSGCFLEVTDEKRLIWTSALVKNPATTSDKECAHIVMTAVIELQPTS-TRYTACAMHNTPGQRKLHEEMGFH-EGWGTTITQLEELLKQEKAY.... 165
65 -9.330d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}  ali model 3D-neighbors follow..  13  2...........ITIKKQEIVKLEDVLHLYQA-------VGWTNYTHQTEMLEQALSHSL----------VIYLALDGDAVVGLIRL--VGDGFSSVFVDLIVLPSYQRQGIGSSLMKEAL----GNFKEAYQVQLATEETEKNVGFYRSMGFE......................... 121
66 -9.150d1yx0a1 d.108.1.1 (A:1-149) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  20  53...........................................................................EGDELAGCGALKELDTRHGEIK-SMRTSASHLRKGVAKQVLQHIIEEAEKRYERLSLETGSMASFEPARKLYESFGFQ......................... 130

FFAS is supported by the NIH grant R01-GM087218-01
8 5 9 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.