current user: public

Announcement: our server is upgraded to a faster system. If you experience any issues during this period please let us know.

Query: d2bopa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
1 -65.800d2bopa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}  ali model 3D-neighbors  100  1SCFALISGTANQVKCYRFRVKKNHRHRYENCTTTWFTVADNGAERQGQAQILITFGSPSQRQDFLKHVPLPPGMNISGFTASLDF 85
2 -56.600d1r8ha_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 6a [TaxId: 37122]}  ali model 3D-neighbors follow..  28  4TPIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKAPHK--HAIVTVTYHSEEQRQQFLNVVKIPPTIRHKLGFMSM.. 84
3 -8.520d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  9KKMDAELGQKVDLVC----------EVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNN... 80
4 -6.750d1ccza2 b.1.1.3 (A:94-171) CD2-binding domain of CD58, second domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  5KPMIYWECSNATLTC----------EVLEGTDVELKLY-QGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESE........ 70
5 -6.650d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11....LLQGQSLTLTL----------ESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVV.. 79
6 -6.590d1rxwa2 c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  15  72RPVFVFDGEPPEFKKAEIEERKKRRAEAEEMWIAALQAGDKDAKKYAQAAGRVDEYIVDSAKTLLSYMGIP.............. 142
7 -6.490d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  1........EPKFTKCRSPERE----------TFSCHWTDEVHHGTKNEGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFN. 66
8 -6.370d1svya_ d.109.1.1 (A:) Severin, domain 2 {Dictyostelium discoideum [TaxId: 44689]}  ali model 3D-neighbors follow..  12  6..LLHISGDKNEVPLATSSLNSGDCFLLDAGLTIYQFNGSKSSEKNKAAEVARAIDAERKGLPKVEVFCETDSDIPAEFWKLLG. 93
9 -6.210d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  10  1.......GKPEIHKCRSPDKE----------TFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYE...................... 46
10 -6.090d1i2ha_ b.55.1.4 (A:) Homer {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  10  69...........................FTKTSQKFGWADSRANTVYG-----LGFSSEHHLSKFAEKFQ................ 106

FFAS is supported by the NIH grant R01-GM087218-01
6 1 0 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Ginalski K, Grishin NV, Godzik A., Rychlewski L. Practical lessons from protein structure prediction. Nucleic Acids Res. 2005 Apr 1;33(6):1874-91.