current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d2bopa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
1 -63.900d2bopa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}  ali model 3D-neighbors  100  1SCFALISGTANQVKCYRFRVKKNHRHRYENCTTTWFTVADNGAERQGQAQILITFGSPSQRQDFLKHVPLPPGMNISGFTASLDF 85
2 -55.000d1r8ha_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 6a [TaxId: 37122]}  ali model 3D-neighbors follow..  28  4TPIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKAPHK--HAIVTVTYHSEEQRQQFLNVVKIPPTIRHKLGFMSM.. 84
3 -6.530d2cm5a_ b.7.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  55.PFVKLWLKPDMGKKAKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIGKSNDYIGGCQLGISAK.......... 128
4 -6.350d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  11....LLQGQSLTLTL----------ESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVV.. 79
5 -6.320d3bova_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  9EVYTVDVGSSVSLEC---DFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYR........ 82
6 -6.300d1svya_ d.109.1.1 (A:) Severin, domain 2 {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}  ali model 3D-neighbors follow..  12  6..LLHISGDKNEVPLATSSLNSGDCFLLDAGLTIYQFNGSKSSEKNKAAEVARAIDAERKGLPKVEVFCETDSDIPAEFWKLL.. 92
7 -5.950d2plaa1 c.2.1.0 (A:4-195) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  5...VCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFE---ETVNGRKLTDIINNDHENVKYLPGHKLPENVVAM........ 75
8 -5.830d1tjxa1 b.7.1.2 (A:271-419) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  40.PYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNST.......... 113
9 -5.810d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Norway rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  15  7REVYGAVGSQVTLHC------WSSEWVSDDISFTWRYQPEGGDPSWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTL.. 115
10 -5.780d2z6oa_ d.20.1.4 (A:) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14.PVLKTNAGPRDRELWVQRLKEEYQSLIRYVENN-DWFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIP.............. 87

FFAS is supported by the NIH grant R01-GM087218-01
9 7 7 7 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.