current user: public




Query: d2bopa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .
# Score Template Links and tools%idFirst SCFALISGTANQVKCYRFRVKKNHRHRYENCTTTWFTVADNGAERQGQAQILITFGSPSQRQDFLKHVPLPPGMNISGFTASLDFLast
1 -66.000d2bopa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1 [TaxId: 10559]}  ali model 3D-neighbors  100  1SCFALISGTANQVKCYRFRVKKNHRHRYENCTTTWFTVADNGAERQGQAQILITFGSPSQRQDFLKHVPLPPGMNISGFTASLDF 85
2 -56.900d1r8ha_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 6a [TaxId: 37122]}  ali model 3D-neighbors follow..  28  4TPIVQFQGESNCLKCFRYRLNDKHRHLFDLISSTWHWASPKAPHK--HAIVTVTYHSEEQRQQFLNVVKIPPTIRHKLGFMSM.. 84
3 -7.970d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  9KKMDAELGQKVDLVC----------EVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNN... 80
4 -6.720d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  7SDTHLLQGQSLTLTL----------ESPPGSSPSVQCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQKKVEFKIDIVV.. 79
5 -6.700d1rxwa2 c.120.1.2 (A:3-219) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  15  72RPVFVFDGEPPEFKKAEIEERKKRRAEAEEMWIAALQAGDKDAKKYAQAAGRVDEYIVDSAKTLLSYMGIP.............. 142
6 -6.370d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  2KVVLGKKGDTVELTC----------TASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGNFPLIIKNLK. 75
7 -6.360d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]}  ali model 3D-neighbors follow..  7REVYGAVGSQVTLHC------WSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPSWKDGSIVIH. 86
8 -6.220d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  1........EPKFTKCRSPERE----------TFSCHWTDEVHHGTKNEGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFN. 66
9 -6.020d1svya_ d.109.1.1 (A:) Severin, domain 2 {Dictyostelium discoideum [TaxId: 44689]}  ali model 3D-neighbors follow..  10  6..LLHISGDKNEVPLATSSLNSGDCFLLDAGLTIYQFNGSKSSEKNKAAEVARAIDAERKGLPKVEVFCETDSDI.......... 84
10 -5.680d1r8ea2 d.60.1.1 (A:121-277) Multidrug-binding domain of transcription activator BmrR {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  12  93........PKGRYACIAYN--FSPEHYFLNLQKLIKYIADRQLTVVSDVYIIPIHYSPKKQEEYRVEMKIR.............. 155

FFAS is supported by the NIH grant R01-GM087218-01
4 7 3 3 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Doukhanina EV, Chen S, van der Zalm E, Godzik A, Reed J, Dickman MB. Identification and functional characterization of the BAG protein family inArabidopsis thaliana. Biol Chem. 2006 Jul 7;281(27):18793-801. Epub 2006 Apr 24.