current user: public

Query: d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
3 -48.500d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors follow..  20  3.AVPQSFQVAHLHAPTGSGKSTKVPAAYAA----QGYKVLVLNPSVAATLGFGAYMSKAGVDPNIRTGVRTITTGSPITYSTYGKFLAD--GGCSGGAYDIIICDECHSTDATSILGIGTVLDQAEAGARLVVLATATP. 136
4 -31.300d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  18  24.......TNCLIVLPTGLGKTLIAMMIAEYRLTKYGGKVLMLAPTKPLVLQHAESFRRL-TGEKSPEERSKAWARAKVIVATPQTIENDLLAGRSLEDVSLIVFDEAHRAVGNYAYVFIAREYKRQAKNPLVIGLTASP. 166
6 -26.500d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  17  80.ERWLVDKRGCIVLPTGSGKTHVAMAAINE-----STPTLIVVPTLALAEQWKERLGIF-GEEYVGEFSGRIKELKPLTVSTYDSAYVN--AEKLGNRFMLLIFDEVHHLPAES-----YVQIAQMSIAPFRLGLTATF. 205
8 -22.500d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  15  55...ILRKESFAATAPTGVGKTSFGLA-MSLFLALKGKRCYVIFPTSLLVIQAAETIRKYAEKAGVGTENMQNLRNFKIVITTTQFLSKHYRE---LGHFDFIFVDDVDAI--KLLHLLGFHYDLKTEARGCLMVSTATAK 215
9 -21.600d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  20  108..........LLQGDVGSGKTVVAQLAILD-NYEAGFQTAFMVPTSILAIQHYRRTVATTPSEKEKIKSGLRNGQIDVVIGTHALI----QEDVHFKNLGLVIIDEQH-----GVKQREALMNKGKMVD--TLVMSATPP 243
10 -18.800d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  80..........LVCGDVGFGKT-EVAMRAAFLAVDNHKQVAVLVPTTLLAQQHYDNFRDRFANWPVRIFRSAKEQTQILAEVAEGKI-KLLQSDVKFKDLGLLIVDEEHRFGVRHKERIKAMR-----ANVDILTLTATP. 213
11 -17.800d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  19  44...IIEGHDVLAQAQSGTGKTGTFSIAALQDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHDAEGLRDAQIVVGTPGRVFDNIQRRRRTDKIKMFILDEA-----DEMLSSGFKEQIYQ-PTTQVVLLSATMP 193
12 -17.600d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  17  34..GALRGESMVGQSQTGTGKTHAYLLPIMEK--RAEVQAVITAPTRELATQIYHETLKIT-GTDKQKALEKLNVQPHIVIGTPGRINDFIREQADVHTAHILVVDEA-----DLMLDMGFITDVDQ-KDLQMLVFSATIP 189
13 -17.100d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}  ali model 3D-neighbors follow..  15  83..........IMADEMGLGKTLQCITLIWTLLKQSPDKVIVVSPSSLVYNEVGKWLGGRVQPVAIDGGSKDEIDSKLVNLIISYETFRLHAEVLHKGKVGLVICDEGHRLKNSDNQTYLALNSMNAQRR---VLISGTP. 230
14 -17.100d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}  ali model 3D-neighbors follow..  17  38..FLNDEYNIVAQARTGSGKTASFAIPLIEL--NNGIEAIILTPTRELAIQVADEIESLKGNKNLKIAQIKALKNANIVVGTPGRILDHINRGTNLKNVKYFILDEA-----DEMLNMGFIKDVEK-KDKRILLFSATMP 187
15 -17.000d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  36..IALSGRDILARAKNGTGKSGAYLIPLLER--KDNIQAMVIVPTRELALQVSQICIQVS-GTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVKVDHVQMIVLDEA-----DKLLSQDFVQIMED-KNRQILLYSATFP 188
16 -16.600d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]}  ali model 3D-neighbors follow..  16  54..AILEHRDIMACAQTGSGKTAAFLIPIINHLVCQD-KCLILAPTRELAIQILSESQKFSLNTPLRSCIREVQMGCHLLVATPGRLVDFIEKNKSLEFCKYIVLDEA-----DRMLDMGFEPQIRKGINRQTLMFSATFP 218
17 -16.100d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  20  35..........CLADDMGLGKTLQTIAVFSDAKKENELTSLVICPLSVLEEELSKFAPHLRFAVFHEDRSKIKLEDYDIILTTYAVLLRDT--RLKEVEWKYIVIDEAQNIKNPQTKIFKAVKELKSKYR---IALTGTP. 162
19 -15.400d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  12  3.........IIITGEPGVGKTTLV---------------------KKIVERLGKRAIGFWTEEVRDPETKKRTGFRIITTEGKKKILERAYREAKKDRRKVIIIDEIGKMELFSKKFRDLVRQIMHDPNVNVVATI.... 137
20 -15.200d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}  ali model 3D-neighbors follow..  18  2......GWIEFITGPMFAGKTAELI-RRLHRLEYADVKYLVFKPK-------------IDTRSIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAEN................ 105
21 -15.100d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  162.....TRRISVISGGPGTGKTTKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPL-------TDEQKKRIPEDASTLHRLLHAGNPLHLDVLVVDEASMIDLPMMSRL-----DALPDHARVIFL..... 294
22 -15.100d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  35.DTVLSGRDCLVVMPTGGGKSL-----YQIPALLLNGLTVVVSPLISLMKDQVDQLQANGVAAALNSTQTREQQLEVMTGCRTGQIRLLYIAPERLMNPVLLAVDEAHCISQ---EYAALGQLRQRFPTLPFMALTAT.. 183
23 -14.400d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  1......ARHVFLTGPPGVGKTT-LIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPP-SFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVP. 146
24 -12.900d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}  ali model 3D-neighbors follow..  12  23...LPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVT-FEETPQDIIKNARSFGWDLAKLVDEGKPEGQEVVGGFDLSALIERINYAIQKYRARRVSIDS.................................. 133
25 -12.200d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}  ali model 3D-neighbors follow..  10  2.......KIGIVTGIPGVGKST-VLAKVKEILDNQGINNKIINYGDFMLATALKL---------AKDRDEMRKLSVEKQKKLQIDAAKGIAEEARAGGEGYLFIDTHAVIRTPSGYLPGLPSYVITEINPSVIFLLEADP 126
26 -12.100d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  3.......KIILTIGCPGSGKST-----WAREFIAKNPGFYNIN-----RDDYRQSIMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKG------VIISDTNLNPER----RLAWETFAKEYGWKVEHKVFDVP 115
27 -12.100d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  13  36.........LLLYGPNGTGKKTRCMALLESIFGPGVYRLKIDVRQFVTASNRKLELNVVSSPYHLEITPSDMGNNDRIEVAQMEQVDFQDSKDGLAHRYKCVIINEANSLTKD--AQAALRRTMEKYSKNIRLIMVCD.. 169
28 -12.000d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}  ali model 3D-neighbors follow..  13  32...ARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAM-LEESVEETAEDLIGLHNRVRLRQSDSLKREIDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASDNLMTKLKGFAKSTGVVLVVIC.... 194
29 -12.000d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}  ali model 3D-neighbors follow..  10  41....HHYPRATLLGRPGTGKTVTL--RKLWELYKDKTTARFVYINGFIYRNFTAIIGEIARSLNIPFPRRGLSRDEFLALLVEHL--------RERDLYMFLVLDDANLAPDILSTFIRLGQEADKLGAFRIALVIVG.. 165
30 -11.900d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}  ali model 3D-neighbors follow..  11  1......NKVVVVTGVPGVGSTT-SSQLAMDNLRKEGVNYKMVSFGSVMFEVAKEE----------NLVSDRDQMRKMDPETQKRIQKMAGRKIAEMAKESPVAVDTHSTVSTPKGYLPGLPSWVLNELNPDLIIVVETTG 123
31 -11.800d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  15  53.......RAAMLYGPPGIGKTT-------------------------AAHLVAQELGYDILEQNASDVRSKTLLNAGVKNALDGYFKHNEEAQNLNGKHFVIIMDEVDGMSGGDRGGVGQLAQFCRKTSTPLILIC.... 161
32 -11.800d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}  ali model 3D-neighbors follow..  10  23...FFKDSIILATGATGTGKTL-LVSRFVENACANKERAILFA-----YEESRAQLLRNAYSWGMDFEEMERQNLLKIVCAYPEDHLQIIKSEINDFKPARIAIDSLSVSNNAFRQFVIGVTGYAKQEEITGLFTNTSD. 162
33 -11.500d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  14  1.....ERGIIIVFTGNGKGKTTAAF--TAARAVGHGKNVGVVQ-TWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVW-QHGKRMLADPLLDMVVLDELTYMAYDYLPLEEVISALNARPGHQTVIITG... 134
35 -11.300d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  17  37KHYVKTGSMLLFAGPPGVGKTTAAL---------------------ALARELF--------NWRHNFLELNASDERGINVIREKVKEFARTKPIGGASFKIIFLDEADALTQD--AQQALRRTMEMFSSNVRFILSCN.. 147
36 -11.100d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  13  34......HHAYLFSGTRGVGKTS--IARLLAKGLN------CETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDTRD--LLDNVQYAPARGRFKVYLIDEVHMLSRH--SFNALLKTLEEPPEHVKFLLATTDP 155
37 -11.000d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16......QGERLIEASAGTGKTFTIAALYLRLLLGLGGELLVVTFTEAATAELRGRIRSNIHELRIACLRETTDNPLYERLLEEIDDKAQAAQLLAERQMDEAAVFTIH................................ 130
38 -11.000d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}  ali model 3D-neighbors follow..  14  1...MPTLLRVYIDGPHGMGKTT--TTQLLVALGSRDDIVYVPEPRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHILTLIFDRHPIAALLCYPAARYLMGSMTPQAVLIVLGALPED 166
40 -10.600d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  1.....RSKYIVIEGLEGAGKTTAR--NVVVETLEQLGIRDMVFTREPGGTQLAEKLRSLLLDIKSVGDEVITDKAEVLMFYAARVQLVETVIKPALANGTWVIGDR.................................. 99
41 -10.300d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  19.....EHGLIMLMGKGGVGKTT-MAAAIAVRLADMGFDVHLTTPAAHLSMTLNGSLNNLQVKELDEAGKRLLEEDLRSPCTEEIAVFQAFSRVIREAGKRFVVMD----TAPTGHTLLLLPMMLLQDPERTKVLLVTLP. 192
42 -10.300d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  2.......NVWQVVGYKHSGKTT-LMEKWVAAAVREGWRVGTVKHHGHGGEPARPEGVDSVRHERAGAVATAVEGDGLLQLHLRRP-LDDVLALYAPLRLDLVLVEGYKQERHPKVVLVRSEEDWASLQHLANIRAVIA.. 133
44 -9.970d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}  ali model 3D-neighbors follow..  10  49.........YGSIGRVGIGKTKFTVKRVSEAAAKEGLTVKQAYVNAFNAPNLYTILSLIVRQTGYPIQVRGAPALDILKALVDNL--------YVENHYLLVILDEFQSMLSSPRIAAEDLYTLLRVNRIGFLLVASD.. 182
45 -9.810d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}  ali model 3D-neighbors follow..  12  43.........VLLEGPPHSGKT-------------------------ALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAM------KKIFDDAYKSQLSCVVVDDIERLRFSNLVLQALLVLLKKAPPQKLLIIGTT.. 150
46 -9.660d1yj5a2 c.37.1.1 (A:351-522) 5` polynucleotide kinase-3` phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  13  12....PNPEVVVAVGFPGAGKSTQRCVSSCQAALRQGKRVVIDVPSRARYIQCAKDAGVPCRCFNNRFREMTDPSHAPVSDMVMFSYRKQFEPPTLAEGFLEILEIPFRLQEHLDPALQRLYRQFSE.............. 171
47 -9.640d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  12  2........LIAIEGVDGAGKRTLV--EKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQ--GLCRGYDVVILDRYVASN............................. 100
48 -9.520d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  20...IETGSITEMFGEFRTGKTQICHTLAVTCQLGGEGKAMYIDTEGTFRPERLLAVAER-YGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDELSARQMHLARFLRMLLRLADEFGVAVVITNQV.. 172
49 -9.500d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  38....TKSEIKILSIGGGAGEDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKIS---------NLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMYYVKDIPATLKFFHSLLGTNAKMLIIVVSGS.. 164
50 -9.480d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  22....RGHHALLIQALPGMGDDALIYALS--------RYLLCQQPQGHKSCGHCRGCQLMQAGTHPDYYTAPEKGKNTLGVDAVREVTEKLNEHARLGGAKVVWVTDAALLTDA--AANALLKTLEEPPAETWFFLATREP 148
51 -9.470d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  13  24...IEKGNVVNFHGPNGIGKTTLL-IIYNGVPITKVKGKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEKKKLGELSQGTIRRVQLASTLLVNAEIYVLDD---IDEDSKHKVLKSILEILKEKGIVIISS.... 182
52 -9.450d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}  ali model 3D-neighbors follow..  18  5.PVLKDRNLWFLVGLQGSGKTTTAAK--LALYYKGKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPE-------SIRRRVEEKARLEARDLILVDTA-QIDEPLMGELARLKEVLGPDEVLLVLDAMT.. 134
53 -9.400d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  28  3.....GGNILLLSGHPGSGKST-IAEALANL............................................................................................................. 27
54 -9.370d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}  ali model 3D-neighbors follow..  42....LDSFFLFLHGRAGSGKSV-----IASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEE---------TIRWAQELRLRCLVTTRD.. 166
56 -9.240d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}  ali model 3D-neighbors follow..  12  2.....TTRMIILNGGSSAGKSG-------------------------IVRCLQSVLPEPWLAFGVDSLI....................................................................... 40

FFAS is supported by the NIH grant R01-GM087218-01
6 0 5 7 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.