current user: public

anford Burnham Prebys Medical Discovery Institute
We are hiring bioinformatics experts and software developers. Join us!

Query: d1yksa1 c.37.1.14 (A:187-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
3 -44.700d3kqna1 c.37.1.14 (A:189-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors follow..  18  5VPQTFQVAHLHAPTGSGKSTKVPAAYAA----QGYKVLVLNPSVAATLGFGAYMSKAGIDPNIRTGVRTITTGAPITYSTYGKFLAD--GGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAEAGARLVVLATATP. 137
5 -24.400d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  19  26.......CLIVLPTGLGKTLIAMMIAEYRLTKYGGKVLMLAPTKPLVLQHAESFRRL-TGEKSPEERSKAWARAKVIVATPQTIENDLLAGRSLEDVSLIVFDEAHRAVGNYAYVFIAREYKRQAKNPLVIGLTASP. 166
6 -23.100d1gkub1 c.37.1.16 (B:6-250) Helicase-like "domain" of reverse gyrase {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  15  50.ILRKESFAATAPTGVGKTSFGLA-MSLFLALKGKRCYVIFPTSLLVIQAAETIRKYAEKAGVGTENMQNLRNFKIVITTTQFLSKHY---RELGHFDFIFVDDVDAILKASKNVDKLLHLLGFHYDLKLMVSTATAK 210
7 -22.300d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  19  82.WLVDKRGCIVLPTGSGKTHVAMAAIN----ELSTPTLIVVPTLALAEQWKERLGIF-GEEYVGEFSGRIKELKPLTVSTYDSAYVNA--EKLGNRFMLLIFDEVHHLPAESY------VQIAQMSIAPFRLLTATF. 205
9 -21.700d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  20  108........LLQGDVGSGKTVVAQLAILD-NYEAGFQTAFMVPTSILAIQHYRRTVATTPSEKEKIKSGLRNGQIDVVIGTHAL----IQEDVHFKNLGLVIIDEQH-----RFGVKQREALMNKGKMVDTLVMSATP. 241
11 -19.700d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  17  80........LVCGDVGFGKTEVAM-RAAFLAVDNHKQVAVLVPTTLLAQQHYDNFRDRFANWPVRILAEVAEGKIDILIGTH----KLLQSDVKFKDLGLLIVDEEH-----RFGVRHKERIKAMRANVDILTLTATP. 213
12 -18.400d3peya1 c.37.1.0 (A:91-286) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  16  37LHNPPRNMIAQSQSGTGKTAAFSLTMLTNPEDASPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIVPDSFEKVIVGTPGTVLDLMRRKLQLQKIKIFVLDEANMLDQQGLGDQCIRVKRFLPKDTQLVLFSATFA 185
13 -18.400d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  18  44.IIEGHDVLAQAQSGTGKTGTFSIAALQDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHDAEGLRDAQIVVGTPGRVFDNIQRRRRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMP 193
19 -16.100d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]}  ali model 3D-neighbors follow..  18  54AILEHRDIMACAQTGSGKTAAFLIPIINHLVCQDLNCLILAPTRELAIQILSESQKFSLNTPLRSCVVYGGADT-LLVATPGRLVDFIEKNISLEFCKYIVLDEADRMLDMGFQIRKIIEEMPSGINRQTLMFSATFP 218
20 -15.700d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  21  35........CLADDMGLGKTLQTIAVFSAKKENELTPSLVICPLSVLEEELSKFAPHLRFAVFHEDRSKIKLEDYDIILTTYAVLLRD--TRLKEVEWKYIVIDEANIKNPQTKIFKAVKELKSKYR----IALTGTP. 162
24 -15.400d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebrafish (Danio rerio) [TaxId: 7955]}  ali model 3D-neighbors follow..  16  83........IMADEMGLGKTLQCI-TLIWTLLKQSDKVIVVSPSSLVYNEVGKWLGGRVQPVAIDGGSKDEIDSKLILIISYETF-RLHAEVLHKGKVGLVICDEGHRLKNSDNQTYLALNSMNAQRR---VLISGTP. 230
25 -15.300d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  159VALTRRISVISGGPGTGKTTTVLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPL-------TDEQKKRIPEDASTLHRLLHAGNPLHLDVLVVDEASMIDLPMMSR----------------LIDALPD 287
27 -12.300d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus elongatus PCC 7942 [TaxId: 1140]}  ali model 3D-neighbors follow..  14  23.LPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVT--EETPQDIIKNARSFGWKLFILDASPDPEGQEVVGGFDLSALIERINYAIQKYRARRVSIDS.................................. 133
28 -12.000d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  2.....RHVFLTGPPGVGKTT-LIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPV.. 145
29 -12.000d1cr1a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}  ali model 3D-neighbors follow..  13  32.ARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAM-LEESVEETAEDLIGLHNRVRLRQSDSLKREIDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSAS-NLMTKLKGFAKSTGVVLVVIC.... 194
30 -11.900d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  10  2....KKIILTIGCPGSGKST-----WAREFIAKNPGFYNIN-----RDDYRQSIMAHE---ERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKG---VIISDTNLNPER----RLAWETFAKEYGWKVEHKVFDVP 115
31 -11.700d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  12  3.......IIITGEPGVGKTTLVKKIV---------ERLGKRAIGFWTEEVRDPETKKRTGFRIITTEGKKKIFSSKFFTSKKLVGSYAYREAKKDRRKVIIIDEIGKMELFSKKFRDLVRQIMHDPNVNVV....... 134
32 -11.500d1khta_ c.37.1.1 (A:) Adenylate kinase {Methanococcus voltae [TaxId: 2188]}  ali model 3D-neighbors follow..  10  1....NKVVVVTGVPGVGSTT-SSQLAMDNLRKEGVNYKMVSFGSVMFEVAKEE-----------NLVSDRDQMRKMDPETQKRIQKMAGRKAEMAKESPVAVDTHSTVSTPKGYLPGLPSWVLNELNPDLIIVVETTG 123
33 -11.000d2nq2c_ c.37.1.0 (C:) automated matches {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  13  27.LNKGDILAVLGQNGCGKSTLLFAYSVLDIVLMGRS-TFAKPKSHDYQVAMQALDYLNLTLAKREFTSLSGGQRQLILIARAI----------ASECKLILLDESALDLANQDIVLSLLIDLAQSQNMTVVFTTHQP. 188
34 -10.800d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}  ali model 3D-neighbors follow..  14  1.MPTLLRVYIDGPHGMGKTT--TTQLLVALGSRDDIVYVPEPRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGTLIFDRHPIAALLCYPAARYLMGSMTPQAVLIVLGALPED 166
36 -10.700d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  39...KSEIKILSIGGGAGEDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKIS---------NLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMYYVKDIPATLKFFHSLLGTNAKMLIIVVSGS.. 164
37 -10.700d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus elongatus PCC 7942 [TaxId: 1140]}  ali model 3D-neighbors follow..  11  23.FFKDSIILATGATGTGKTL-LVSRFVENACANKERAILFA-----YEESRAQLLRNAYSWGMDFEEMERQNLLKIVCAYPESHLQIIKSEINDFKPARIAIDSLSALNNAFRQFVIGVTGYAKQEEITGLFTNTS.. 161
38 -10.600d1nksa_ c.37.1.1 (A:) Adenylate kinase {Sulfolobus acidocaldarius [TaxId: 2285]}  ali model 3D-neighbors follow..  12  2.....KIGIVTGIPGVGKST-VLAKVKEILDNQGINNKIINYGDFMLATALKL---------AKDRDEMRKLSVEKQKKLQIDAAKGIAEEARAGGEGYLFID--HAVTPSGYLPGLPSYVITEINPSVIFLLEADP. 126
39 -10.100d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  15  53.....RAAMLYGPPGIGKTT-------------------------AAHLVAQELGYDILEQNASDVRSKTLLNAGVKNALDNMSVVGYFKHNEEAQNLVIIMDEVDGMSGGDRGGVGQLAQFCRKTSTPLILIC.... 161
40 -10.100d1w4ra1 c.37.1.24 (A:18-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  1...RGQIQVILGPMFSGKSTELM-RRVRRFQIAQYKCLVIKYA-------------KDTRYSSSFCTHDRNTMEALPACLLRDVAQEA------LGVAVIGIDEGQFFPD----IVEFCEAMANAGKTVIV....... 104
41 -10.000d4rvca_ c.37.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1337888]}  ali model 3D-neighbors follow..  19  25.VDRGEMVALIGLNGAGKSTTIKHIILADGPETYRRQFAYIPETAMAYGLSEAEYERRLPPLLREFRLERRLSSFPAHFSKGMKQKVMIVCAFLLEPPLYIIDE---LDPLAIHALLERMNEQKAKGAGILLST.... 190
42 -9.800d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  6..NIPPYLFFTGKGGVGKTS-ISCATAIRLAEQGKRVLLVSPASNVGQVFSQTIGNTIQAIAVSSINEQLSGACTTEIAAFDEFTGLLTDASLLTRFDHIIFDTA................................. 144
43 -9.730d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  11  1...ERGIIIVFTGNGKGKTTAAF--TAARAVGHGKNVGVVQ-ERNLLEPHGVEFQVMATGFT-------ETQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLLEEVISALNARPGHQTVIITG... 134
44 -9.490d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  2.....NVWQVVGYKHSGKTT-LMEKWVAAAVREGWRVGTVKHHGHGGEPARPEGVDSVRHERAGAVATAVEGDGLLQLHLRRP-LDDVLALYAPLRLDLVLVEGYKQERHPKVVLVRSEEDWASLQHLANIRAVIA.. 133
45 -9.450d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  13  36.......LLLYGPNGTGKKTRCMALLESYRLKIDVRQFVTASNRKLELNVVSSPYHLEITPSDMGNNDRIVIQELLEVAQMEQVDFQDSKDGLAHRYKCVIINEANSLTKDAQAALRRTMEKYSKNIRLIMVCDSM.. 171
46 -9.370d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Methanobacterium thermoautotrophicum [TaxId: 145262]}  ali model 3D-neighbors follow..  14  1MKIRSPIVSVLGHVDHGKTT-LLDHIRGSAVASREAGGITQPMDVIEGICGDFLKKFSIRETLPGL--------FIDTPGHEAFTTLRKRGGALADLAILIVDINEGFKPQTQEALNILRMY................ 121
47 -9.350d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  15  25.IEEGEIFGLIGPNGAGKTTTL--NVVEEPHEVRKLISYLPEEAGAYRNMQSSEIEEMVERATEIAGLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDE---LDVLNAREVRKILKQASQEGLTILVSS.... 190
48 -9.330d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  18  19.......RLIEASAGTGKTFTIAALYLRLLLGLGEELLVVTFTEAATAELRGRIRS.................................................................................. 78
49 -9.320d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]}  ali model 3D-neighbors follow..  42..LDSFFLFLHGRAGSGKSV-----IASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEE---------TIRWAQELRLRCLVTTRD.. 166
50 -9.310d1yj5a2 c.37.1.1 (A:351-522) 5` polynucleotide kinase-3` phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  13  10LSPNPEVVVAVGFPGAGKSTQRCVSSCQAALRQGKRVVITNPDVPSRARYIQCAKDAGVPCNNRFREMTDPSHAPVSDMVMFSYRKQFEPPTLAEGFLEIL..................................... 148
51 -9.270d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  16  48.......LLFAGPPGVGKTTAAL---------------------ALARELFGE------NWRHNFLELNASDERGINVIREKVKEFARTKPIGGASFKIIFLDEADLTQDAQQALRRTMEMFSSNVRFILSCNYSS.. 150
52 -9.230d1sgwa1 c.37.1.12 (A:2-200) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  13  23.IEKGNVVNFHGPNGIGKTTLL-IIYNGVPITKVKGKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEKKKLGELSQGTIRRVQLASTLLVNAEIYVLDD---IDEDSKHKVLKSILEILKEKGIVIISS.... 181
53 -9.110d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}  ali model 3D-neighbors follow..  13  43.......VLLEGPPHSGKT-------------------------ALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAM------KKIFDDAYKSQLSCVVVDDIRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRK 153
54 -9.080d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}  ali model 3D-neighbors follow..  12  30..ESPTAFLLGGQPGSGKTS--LRSAIFEETQGNVIVIDNDTFKQQHPNFDELVKLYEKDVVKHVTPYS------------NRMTEAIISRLSDQGYNLVI--EGTGRTTDVPI--QTATMLQAKGYETKMYVMAVPK 147
55 -9.030d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Pyrobaculum aerophilum [TaxId: 13773]}  ali model 3D-neighbors follow..  10  46.......ATLLGRPGTGKTVTL--RKLWELYKDKTTARFVYINGFIYRNFTAIIGEIARSLNIPFPRRGLSRDEFLALLVEHL--------RERDLYMFLVLDDANLAPDILSTFIRLGQEADKLGAFRIALVIVG.. 165

FFAS is supported by the NIH grant R01-GM087218-01
9 9 7 2 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.