current user: public

Query: d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
3 -46.100d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors follow..  19  3.AVPQSFQVAHLHAPTGSGKSTKVPAAYA----AQGYKVLVLNPSVAATLGFGAYMSKAGVDPNIRTGVRTITTGSPITYSTYGKFLAD--GGCSGGAYDIIICDECHSTDATSILGIGTVLDQAEAGARLVVLATATP. 136
4 -26.800d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  19  26.........CLIVLPTGLGKTLIAMMIAEYRLTKYGGKVLMLAPTKPLVLQHAESFRRL-TGEKSPEERSKAWARAKVIVATPQTIENDLLAGRSLEDVSLIVFDEAHRAVGNYAYVFIAREYKRQAKNPLVIGLTASP. 166
6 -23.900d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  19  80.ERWLVDKRGCIVLPTGSGKTHVAMAAIN----ELSTPTLIVVPTLALAEQWKERLGIF-GEEYVGEFSGRIKELKPLTVSTYDSAYVN--AEKLGNRFMLLIFDEVHHLPAESY------VQIAQMSIAPFRLLTATF. 205
7 -22.000d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  16  55...ILRKESFAATAPTGVGKTSFGLA-MSLFLALKGKRCYVIFPTSLLVIQAAETIRKYAEKAGVGT--MQNLRNFKIVITTTQFLSKHYRE---LGHFDFIFVDDVDAILKASLHLLGFHYDLKTEARGCLMVSTATAK 215
9 -20.200d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  18  108..........LLQGDVGSGKT-VVAQLAILDNYEAGFQTAFMVPTSILAIQHYRRTVATTPSEKEKIKSGLRNGQIDVVIGTHALIQ----EDVHFKNLGLVIIDEQH-----GVKQREALMNKGKMVD--TLVMSATP. 241
10 -18.600d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  80..........LVCGDVGFGKTE-VAMRAAFLAVDNHKQVAVLVPTTLLAQQHYDNFRDRFANWPVRIFRSAKEQTQILAEVAEGKI-KLLQSDVKFKDLGLLIVDEEH-----RFGVRHKERIKAMRANVDILTLTATP. 213
11 -17.100d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  18  44...IIEGHDVLAQAQSGTGKTGTFSIAALQR--VKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHDAEGLRDAQIVVGTPGRVFDNIQRRRRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMP 193
12 -16.600d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}  ali model 3D-neighbors follow..  15  83..........IMADEMGLGKTLQCITLIWTLLKQS-DKVIVVSPSSLVYNEVGKWLGGRVQPVAIDGGSKDEIDSKLVNLIISYETFRLHAEVLHKGKVGLVICDEGHRLKNSDNQTYLALNSMNAQRR---VLISGTP. 230
13 -16.600d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  17  34..GALRGESMVGQSQTGTGKTHAYLLPIMEK--RAEVQAVITAPTRELATQIYHETLKIT-GTDKQKALEKLNVQPHIVIGTPGRINDFIREQADVHTAHILVVDEA-----DLMLDMGFITDVDQPKDLQMLVFSATIP 189
14 -16.000d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}  ali model 3D-neighbors follow..  18  38..FLNDEYNIVAQARTGSGKTASFIPLIELVNENNGIEAIILTPTRELAIQVADEIESLKGNKNLKIAQIKALKNANIVVGTPGRILDHINRGTNLKNVKYFILDEA-----DEMLNMGFIKDVEKNKDKRILLFSATMP 187
16 -15.700d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  20  35..........CLADDMGLGKTLQTIAVFSAKKENELTPSLVICPLSVLEEELSKFAPHLRFAVFHEDRSKIKLEDYDIILTTYAVLLRDT--RLKEVEWKYIVIDEAQNIKNPQTKIFKAVKELKSKYR---IALTGTP. 162
17 -15.600d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]}  ali model 3D-neighbors follow..  18  54..AILEHRDIMACAQTGSGKTAAFLIPIINHLVCQDLNCLILAPTRELAIQILSESQKFSLNTPLRSC-REVQMGCHLLVATPGRLVDFIEKNKSLEFCKYIVLDEARMLDMGFEPQIRKIIEESNMPSGQTLMFSATFP 218
18 -15.600d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  19  162.....TRRISVISGGPGTGKTTTVLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPL-------TDEQKKRIPEDASTLHRLLHAGNPLHLDVLVVDEASMIDLPMMSR----------------LIDALPD 287
21 -13.000d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}  ali model 3D-neighbors follow..  13  23...LPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVT-FEETPQDIIKNARSFGWKLFILDASPDPEGQEVVGGFDLSALIERINYAIQKYRARRVSIDSVTSVSSVVRRELFRLVARLKQIGATTVMTTER.. 171
22 -12.000d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}  ali model 3D-neighbors follow..  18  2......GWIEFITGPMFAGKTAELIRRLHRLEYAD-VKYLVFKPK-------------IDTRSIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAE----NGFVVIIS..... 112
23 -12.000d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  12  3.........IIITGEPGVGKTTLVKKIV---------ERLGKRAIGFWTEEVRDPETKKRTGFRIITTEGKKKIFSSKFFTSKKLILERAYREAKKDRRKVIIIDEIGKMELFSKKFRDLVRQIMHDPNVNVVAT..... 136
24 -11.800d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}  ali model 3D-neighbors follow..  11  23...FFKDSIILATGATGTGKTL-LVSRFVENACANKERAILFA-----YEESRAQLLRNAYSWGMDFEEMERQNLLKIVCAYPEDHLQIIKSEINDFKPARIAIDSLSALNNAFRQFVIGVTGYAKQEEITGLFTNTS.. 161
25 -11.700d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  10  2......KKIILTIGCPGSGKST-----WAREFIAKNPGFYNIN-----RDDYRQSIMAHE---ERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKG---VIISDTNLNPER----RLAWETFAKEYGWKVEHKVFDVP 115
26 -11.600d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  15  53.......RAAMLYGPPGIGKTT-------------------------AAHLVAQELGYDILEQNASDVRSKTLLNAGVKNALDGYFKHNEEAQNLNGKHFVIIMDEVDGMSGGDRGGVGQLAQFCRKTSTPLILIC.... 161
27 -11.300d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}  ali model 3D-neighbors follow..  13  32...ARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAM-LEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFLLAKLAYMRSGLGCDVIILDHISIVVSAS-NLMTKLKGFAKSTGVVLVVIC.... 194
28 -11.300d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}  ali model 3D-neighbors follow..  10  1......NKVVVVTGVPGVGSTT-SSQLAMDNLRKEGVNYKMVSFGSVMFEVAKEE-----------NLVSDRDQMRKMDPETQKRIQKMAGRKAEMAKESPVAVDTHSTVSTPKGYLPGLPSWVLNELNPDLIIVVETTG 123
29 -10.900d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  2.......RHVFLTGPPGVGKTTLIVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRECRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPV.. 145
30 -10.400d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  38....TKSEIKILSIGGGAGEDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKISNLENVKF---------AWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVS... 162
31 -10.400d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  10  19.........RLIEASAGTGKTFTIAALYLRLLLGLGEELLVVTFTEAATAELRGRIRSNIHELRIACLRETTDNPLYERLLEEIDDKAQAAQLLAERQMDEAAVFTIH................................ 130
32 -10.400d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}  ali model 3D-neighbors follow..  10  2.......KIGIVTGIPGVGKST-VLAKVKEILDNQGINNKIINYGDFMLATALKL---------AKDRDEMRKLSVEKQKKLQIDAAKGIAEEARAGGEGYLFIDTHAVIRTPSGYLPGLPSYVITEINPSVIFLLEADP 126
33 -10.400d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  13  1.....ERGIIIVFTGNGKGKTTAAF--TAARAVGHGKNVGVVQ-ERNLLEPHGVEFQVMATGF---TWETQNREADTAACMAVWQHGKRMLAD---PLLDMVVLDELTYM----LPLEEVISALNARPGHQTVIITG... 134
34 -10.100d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  13  36.........LLLYGPNGTGKKTRCMALLESYRLKIDVRQFVTASNRKLELNVVSSPYHLEITPSDMGNNDRIVIQELLKEVAQMQVDFQDSKDGLAHRYKCVIINEANSLTKDA-ALRRTMEKYSKNIRLIMVCDSMS.. 172
35 -9.970d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}  ali model 3D-neighbors follow..  16  1...MPTLLRVYIDGPHGMGKTTTT--QLLVALGSRDDIVYVPEPRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGTLIFDRHPIAAPAARYLMGSMTPQATLPGTNIVLGALPED 166
36 -9.870d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  10  26...MVAGTVGALVSPGGAGKSMLALQLAAQIAGGPTGPVIYLPPPTAIHHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAPEWFDGLKRAAEGRRLMVLDRFHIEEENA-QVIGRMEAIAADTGCSIVFLHHA.. 179
38 -9.730d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  19  37KHYVKTGSMLLFAGPPGVGKTTAAL-ALARELFGENWRHNFL--------------------------ELNASDERGINVIREKVKEFARTKPIGGASFKIIFLDEADALTQDA-ALRRTMEMFSSNVRFILSCNYSS.. 150
39 -9.710d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  6....NIPPYLFFTGKGGVGKTS-ISCATAIRLAEQGKRVLLVSPASNVGQVFSQTIGNTIQAIAVSSINEQLSGACTTEIAAFDEFTGLLTDASLLTRFDHIIFDTA................................. 144
40 -9.580d1yj5a2 c.37.1.1 (A:351-522) 5` polynucleotide kinase-3` phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  14  12....PNPEVVVAVGFPGAGKSTQRCVSSCQAALRQGKRVVITNPDVPSRARYIQCAKDAGVPCNNRFREMTDPSHAPVSDMVMFSYRKQFEPPTLAEGFLEIL..................................... 148
41 -9.520d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  15  25...IEEGEIFGLIGPNGAGKTTTL--NVVEEPHEVRKLISYLPEEAGAYRNMQSSEIEEMVERATEIAGLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDE---LDVLNAREVRKILKQASQEGLTILVSS.... 190
42 -9.440d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}  ali model 3D-neighbors follow..  12  43.........VLLEGPPHSGKT-------------------------ALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAM------KKIFDDAYKSQLSCVVVDDIERLRFSNLVLQALLVLLAPPQGRKLLIIGTT.. 150
43 -9.260d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}  ali model 3D-neighbors follow..  42....LDSFFLFLHGRAGSGKSV-----IASQALSKSDQLI-LKDSGTAPKSTFDLFTDILLMLKS---EDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEE---------TIRWAQELRLRCLVTTRD.. 166
44 -9.200d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}  ali model 3D-neighbors follow..  10  46.........ATLLGRPGTGKTVTL--RKLWELYKDKTTARFVYINGFIYRNFTAIIGEIARSLNIPFPRRGLSRDEFLALLVEHL--------RERDLYMFLVLDDANLAPDILSTFIRLGQEADKLGAFRIALVIVG.. 165
46 -9.100d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  33  3.....GGNILLLSGHPGSGKST--IAEALANLPG.......................................................................................................... 29
47 -9.090d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  18....NEHGLIMLMGKGGVGKTT-MAAAIAVRLADMGFDVHLTTPAAHLSMTLNGSLNNLQVSRIDPHEETERYRQHVLE-TEEIAVFQAFSRVIREAGKRFVVMDTA................................. 142
48 -9.060d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  13  28...IENGERFGILGPSGAGKTTFMRIIAGLDVPSTGEQTWALYPNLTAFENIAFPLTRKRVEEVAKILDIHHVLNHFPRELSGAQQQRVALARALVKDPSLLLLDESNLDARMRDSARALVKEVQSRLGVTLLVVS.... 198
49 -9.020d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  13  24...IEKGNVVNFHGPNGIGKTTLL-IIYNGVPITKVKGKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEKKKLGELSQGTIRRVQLASTLLVNAEIYVLDD---IDEDSKHKVLKSILEILKEKGIVIISS.... 182

FFAS is supported by the NIH grant R01-GM087218-01
6 3 9 9 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Locations of visitors to this page

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;