current user: public

Query: d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}, from SCOP175

Results of FFAS03 search in SCOP175
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
3 -44.800d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}  ali model 3D-neighbors follow..  19  3.AVPQSFQVAHLHAPTGSGKSTKVPAAYA----AQGYKVLVLNPSVAATLGFGAYMSKAGVDPNIRTGVRTITTGSPITYSTYGKFLAD--GGCSGGAYDIIICDECHSTDATSILGIGTVLDQAEAGARLVVLATATP. 136
5 -26.700d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  19  26.........CLIVLPTGLGKTLIAMMIAEYRLTKYGGKVLMLAPTKPLVLQHAESFRRL-TGEKSPEERSKAWARAKVIVATPQTIENDLLAGRSLEDVSLIVFDEAHRAVGNYAYVFIAREYKRQAKNPLVIGLTASP. 166
6 -24.900d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  19  80.ERWLVDKRGCIVLPTGSGKTHVAMAAIN----ELSTPTLIVVPTLALAEQWKERLGIF-GEEYVGEFSGRIKELKPLTVSTYDSAYVN--AEKLGNRFMLLIFDEVHHLPAESY------VQIAQMSIAPFRLLTATF. 205
7 -22.400d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  16  55...ILRKESFAATAPTGVGKTSFGLA-MSLFLALKGKRCYVIFPTSLLVIQAAETIRKYAEKAGVGTENMQNLRNFKIVITTTQFLSKHY---RELGHFDFIFVDDVDAILKASLHLLGFHYDLKTEARGCLMVSTATAK 215
9 -20.300d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  18  108..........LLQGDVGSGKT-VVAQLAILDNYEAGFQTAFMVPTSILAIQHYRRTVATTPSEKEKIKSGLRNGQIDVVIGTHALIQ----EDVHFKNLGLVIIDEQH-----RFGVKQREALMNKGKMVDTLVMSATP. 241
10 -19.200d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  80..........LVCGDVGFGKTE-VAMRAAFLAVDNHKQVAVLVPTTLLAQQHYDNFRDRFANWPVRIFRSAKEQTQILAEVAEGKI-KLLQSDVKFKDLGLLIVDEEH-----RFGVRHKERIKAMRANVDILTLTATP. 213
11 -17.200d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  18  44...IIEGHDVLAQAQSGTGKTGTFSIAALQDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHDAEGLRDAQIVVGTPGRVFDNIQRRRRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMP 193
12 -16.600d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}  ali model 3D-neighbors follow..  15  83..........IMADEMGLGKTLQCITLIWTLLKQS-DKVIVVSPSSLVYNEVGKWLGGRVQPVAIDGGSKDEIDSKLVNLIISYETFRLHAEVLHKGKVGLVICDEGHRLKNSDNQTYLALNSMNAQRR---VLISGTP. 230
14 -16.000d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}  ali model 3D-neighbors follow..  17  38..FLNDEYNIVAQARTGSGKTASFAIPLIELV-NNGIEAIILTPTRELAIQVADEIESLKGNKNLKIAQIKALKNANIVVGTPGRILDHINRGTNLKNVKYFILDEADEMLNMGFIKDVEKILNACNKDKRILLFSATMP 187
16 -15.700d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  19  162.....TRRISVISGGPGTGKTTKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPL-------TDEQKKRIPEDASTLHRLLHAGNPLHLDVLVVDEASMIDLPMMSR----------------LIDALPD 287
17 -15.500d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]}  ali model 3D-neighbors follow..  17  54..AILEHRDIMACAQTGSGKTAAFLIPIINHLVCQDLNCLILAPTRELAIQILSESQKFSLNTPLRSC-REVQMGCHLLVATPGRLVDFIEKNKSLEFCKYIVLDEADRMLDMGFEIRKIIEEMPSGINRQTLMFSATFP 218
18 -15.500d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  20  35..........CLADDMGLGKTLQTIAVFSAKKENELTPSLVICPLSVLEEELSKFAPHLRFAVFHEDRSKIKLEDYDIILTTYAVLLRDT--RLKEVEWKYIVIDEAQNIKNPQTKIFKAVKELKSKYR---IALTGTP. 162
20 -14.300d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  35.DTVLSGRDCLVVMPTGGGKSL--IPALLLNGL-----TVVVSPLISLMKDQVDQLQANGVAAACLNSTQTREQQRLLYIAPERLMLDNFLEHLAHWNPVLLAVDEAHCISQWGHDFRALGQLRQRFPTLPFMALTAT.. 183
21 -13.300d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}  ali model 3D-neighbors follow..  18  2......GWIEFITGPMFAGKTAELIRR-LHRLEYADVKYLVFKPK-------------IDTRSIRNIQSRTGTSLPSVEVESAPEILNYIMSNSFNDETKVIGIDEVQFFDDRICEVANILAEN................ 105
22 -12.800d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}  ali model 3D-neighbors follow..  13  23...LPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVT--EETPQDIIKNARSFGWKLFILDASPDPEGQEVVGGFDLSALIERINYAIQKYRARRVSIDSVTSVSSVVRRELFRLVARLKQIGATTVMTTER.. 171
23 -12.800d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  1......ARHVFLTGPPGVGKTT-LIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVP. 146
24 -12.700d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  12  3.........IIITGEPGVGKTTLVKKIV---------ERLGKRAIGFWTEEVRDPETKKRTGFRIITTEGKKKIFSSKFFTSKKLILERAYREAKKDRRKVIIIDEIGKMELFSKKFRDLVRQIMHDPNVNVVAT..... 136
25 -12.100d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}  ali model 3D-neighbors follow..  10  1......NKVVVVTGVPGVGSTT-SSQLAMDNLRKEGVNYKMVSFGSVMFEVAKEE-----------NLVSDRDQMRKMDPETQKRIQKMAGRKAEMAKESPVAVDTHSTVSTPKGYLPGLPSWVLNELNPDLIIVVETTG 123
26 -12.000d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}  ali model 3D-neighbors follow..  13  32...ARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAM-LEESVEETAEDLIGLHNRVRLRQSDSLKREIDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSAS-NLMTKLKGFAKSTGVVLVVIC.... 194
27 -11.900d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}  ali model 3D-neighbors follow..  11  23...FFKDSIILATGATGTGKTL-LVSRFVENACANKERAILFA-----YEESRAQLLRNAYSWGMDFEEMERQNLLKIVCAYPEDHLQIIKSEINDFKPARIAIDSLSALNNAFRQFVIGVTGYAKQEEITGLFTNTS.. 161
28 -11.700d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  10  2......KKIILTIGCPGSGKST-----WAREFIAKNPGFYNIN-----RDDYRQSIMAHE---ERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKG---VIISDTNLNPER----RLAWETFAKEYGWKVEHKVFDVP 115
29 -11.400d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  15  53.......RAAMLYGPPGIGKTT-------------------------AAHLVAQELGYDILEQNASDVRSKTLLNAGVKNALDGYFKHNEEAQNLNGKHFVIIMDEVDGMSGGDRGGVGQLAQFCRKTSTPLILIC.... 161
30 -10.700d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}  ali model 3D-neighbors follow..  10  2.......KIGIVTGIPGVGKST-VLAKVKEILDNQGINNKIINYGDFMLATALKL--------YAKDRDEMRKLSVEKQKKLQIDAAKGIAEEARAGGEGYLFIDTHAVIRTPSGYLPGLPSYVITEINPSVIFLLEADP 126
31 -10.300d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  14  1.....ERGIIIVFTGNGKGKTTAAF--TAARAVGHGKNVGVVQ-TWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVW-QHGKRMLADPLLDMVVLDELTYM----LPLEEVISALNARPGHQTVIITG... 134
32 -10.200d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  10  26...MVAGTVGALVSPGGAGKSMLALQLAAQIAGGPTGPVIYLPPPTAIHHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAPEWFDGLKRAAEGRRLMVLDRFHIEEENA-QVIGRMEAIAADTGCSIVFL..... 176
33 -10.100d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  38....TKSEIKILSIGGGAGEDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKISNLENVKF---------AWHKETSSEYQSRMLEKKELQKWDFIHMIQMYYVKDIPATLKFFHSLLGTNAKMLIIVVSGS.. 164
34 -10.000d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  10  18........ERLIEASAGTGKTFTIAALYLRLLLGLGEELLVVTFTEAATAELRGRIRSNIHELRIACLRETTDNPLYERLLEEIDDKAQAAQLLAERQMDEAAVFTIH................................ 130
35 -9.870d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}  ali model 3D-neighbors follow..  14  1...MPTLLRVYIDGPHGMGKTTTT--QLLVALGSRDDIVYVPEPRVLGASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGTLIFDRHPIAALLCYPAARYLMGSMTPQAVLIVLGALPED 166
36 -9.830d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  13  36.........LLLYGPNGTGKKTRCMALLESYRLKIDVRQFVTASNRKLELNVVSSPYHLEITPSDMGNNDRIVIQELLKEVAQMQVDFQDSKDGLAHRYKCVIINEANSLTKDAQAALRRTMEKYSKNIRLIMVCDSM.. 171
37 -9.590d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  19  37KHYVKTGSMLLFAGPPGVGKTTAAL-ALARELFGENWRHNFL--------------------------ELNASDERGINVIREKVKEFARTKPIGGASFKIIFLDEADLTQDAQQALRRTMEMFSSNVRFILSCNYSS.. 150
38 -9.510d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}  ali model 3D-neighbors follow..  13  43.........VLLEGPPHSGKT-------------------------ALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAM------KKIFDDAYKSQLSCVVVDDIERLSNLVLQALLVLLKKAPPQGRKLLIIGTT.. 150
39 -9.500d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  6....NIPPYLFFTGKGGVGKTS-ISCATAIRLAEQGKRVLLVSPASNVGQVFSQTIGNTIQAIAVSSINEQLSGACTTEIAAFDEFTGLLTDASLLTRFDHIIFDTA................................. 144
40 -9.430d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  13  24...IEKGNVVNFHGPNGIGKTTLL-IIYNGVPITKVKGKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEKKKLGELSQGTIRRVQLASTLLVNAEIYVLDD---IDEDSKHKVLKSILEILKEKGIVIISS.... 182
41 -9.430d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  1.....RSKYIVIEGLEGAGKTTAR--NVVVETLEQLGIRDMVFTREPGGTQLAEKLRSLLLDIKSVGDEVITDKAEVLMFYAARVQLVETVIKPALANGTWVIGDR.................................. 99
42 -9.400d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  15  25...IEEGEIFGLIGPNGAGKTTTLRINVVEEPHEVRKLISYLPEEAGAYRNMQSSEIEEMVERATEIAGLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDE---LDVLNAREVRKILKQASQEGLTILVSS.... 190
43 -9.390d1yj5a2 c.37.1.1 (A:351-522) 5` polynucleotide kinase-3` phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  14  12....PNPEVVVAVGFPGAGKSTQRCVSSCQAALRQGKRVVITNPDVPSRARYIQCAKDAGVPCNNRFREMTDPSHAPVSDMVMFSYRKQFEPPTLAEGFLEIL..................................... 148
44 -9.260d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}  ali model 3D-neighbors follow..  10  46.........ATLLGRPGTGKTVTL--RKLWELYKDKTTARFVYINGFIYRNFTAIIGEIARSLNIPFPRRGLSRDEFLALLVEHL--------RERDLYMFLVLDDANLAPDILSTFIRLGQEADKLGAFRIALVIVG.. 165
45 -9.220d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  13  28...IENGERFGILGPSGAGKTTFMRIIAGLDVPSTGEQTWALYPNLTAFENIAFPLTRKRVEEVAKILDIHHVLNHFPRELSGAQQQRVALARALVKDPSLLLLDESNLDARMRDSARALVKEVQSRLGVTLLVVS.... 198
46 -9.070d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  14  18....NEHGLIMLMGKGGVGKTT-MAAAIAVRLADMGFDVHLTTPAAHLSMTLNGSLNNLQVSRIDPHEETERYRQHVLE-TEEIAVFQAFSRVIREAGKRFVVMDTA................................. 142

FFAS is supported by the NIH grant R01-GM087218-01
7 9 6 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Alexey M. Eroshkin, Andrew LeBlanc, Dana Weekes, Kai Post, Zhanwen Li, Akhil Rajput, Sal T. Butera, Dennis R. Burton, Adam Godzik. bNAber: database of broadly neutralizing HIV antibodies. Nucl. Acids Res. 2013; published on November 7, 2013.

Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40.